Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F029107.341ON1081085531e-74
SAKL0F10956g7.341ON86992256e-25
TBLA0E004707.341ON1161132224e-24
Kpol_530.377.341ON881052171e-23
TDEL0C020607.341ON88992143e-23
KLTH0H01452g7.341ON86991989e-21
Kwal_YGOB_Anc_7.3417.341ON86991943e-20
Ecym_45207.341ON91991883e-19
ZYRO0F11528g7.341ON1211001861e-18
CAGL0I03432g7.341ON149991881e-18
ACL158W7.341ON951001743e-17
NCAS0A140807.341ON781001657e-16
NDAI0A019507.341ON1221021495e-13
YDL160C-A (MHF2)7.341ON80981361e-11
Smik_4.767.341ON80981362e-11
KLLA0C16709g7.341ON79951292e-10
KAFR0B009007.341ON781001282e-10
Suva_4.847.341ON81991232e-09
Skud_4.957.341ON79981171e-08
KNAG0C038107.341ON82981143e-08
KAFR0C050407.29ON18263604.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02910
         (108 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...   217   1e-74
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    91   6e-25
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    90   4e-24
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    88   1e-23
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    87   3e-23
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    81   9e-21
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    79   3e-20
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    77   3e-19
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    76   1e-18
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    77   1e-18
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    72   3e-17
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               68   7e-16
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    62   5e-13
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    57   1e-11
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    57   2e-11
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    54   2e-10
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    54   2e-10
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    52   2e-09
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    50   1e-08
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    49   3e-08
KAFR0C05040 Chr3 complement(1000430..1000978) [549 bp, 182 aa] {...    28   4.7  

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score =  217 bits (553), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MNEEELDGPIPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQK 60
           MNEEELDGPIPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQK
Sbjct: 1   MNEEELDGPIPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQK 60

Query: 61  QSNIEALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDMS 108
           QSNIEALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDMS
Sbjct: 61  QSNIEALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDMS 108

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
           similar to uniprot|Q3E829 Saccharomyces cerevisiae
           YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 91.3 bits (225), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 65/99 (65%), Gaps = 19/99 (19%)

Query: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           +PKDTIARI Q  SF ++ TRI+ ++V +  KY+ELFVREAVLRS+EN+E+ +   E+L 
Sbjct: 6   LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
                             NG  L+HEDLEEISGLLLLDM
Sbjct: 66  ------------------NGTVLSHEDLEEISGLLLLDM 86

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 90.1 bits (222), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 11/113 (9%)

Query: 2   NEEELDGPIPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQK 60
           N  E D  +P++TIARILQ  SF +E TRI+  +V  LQKYMELF+REA LRS+EN+E++
Sbjct: 8   NTTETDVKLPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQ 67

Query: 61  QSNIEALKKAPAKANP--DQLQTF----QHSFNGIELTHEDLEEISGLLLLDM 107
            SN    +K+  K  P  +  + F    + + N IEL+HE LE I+GLLLLDM
Sbjct: 68  ISN----EKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
           complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 88.2 bits (217), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 67/105 (63%), Gaps = 23/105 (21%)

Query: 7   DGPIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIE 65
           +GPIPK+TIAR+L+  SF    TRI+ + V  LQKYMELFVREA++RSIE + + +    
Sbjct: 4   NGPIPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEE--- 60

Query: 66  ALKKAPAKANPDQLQTFQHSFNG--IELTHEDLEEISGLLLLDMS 108
                            ++SF G  +ELTH DLEEI+GLLLLDMS
Sbjct: 61  -----------------ENSFTGVRVELTHTDLEEIAGLLLLDMS 88

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 88

 Score = 87.0 bits (214), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 65/99 (65%), Gaps = 16/99 (16%)

Query: 10  IPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           IPK+TIAR  Q+ +F  E T I+ E+VG++QKYME+FVREAVLRS  N+EQ       +K
Sbjct: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQ-------IK 57

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
              + A        Q + N I LTHEDLE I+GLLLLDM
Sbjct: 58  VEHSGA--------QRNSNEIVLTHEDLENITGLLLLDM 88

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
           weakly similar to uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160c-a
          Length = 86

 Score = 80.9 bits (198), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (64%), Gaps = 18/99 (18%)

Query: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           IP DTIARI Q  SF ++ TRI+  ++ ++  Y+E+FVREA+LRSIEN+EQ +S      
Sbjct: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE----- 59

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
                 + DQL       + + LTH+DLE +SGLLLLDM
Sbjct: 60  ------HQDQLG------DQVVLTHKDLERVSGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 86

 Score = 79.3 bits (194), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%), Gaps = 18/99 (18%)

Query: 10  IPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           +PKDTIARI Q  SF  + TRI+  ++ ++ +Y+E+FVREA+LRSIEN++Q +       
Sbjct: 5   VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDE----- 59

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
                 + DQL +       + LTH+DLE +SGLLLLDM
Sbjct: 60  ------HQDQLGS------QVVLTHKDLERVSGLLLLDM 86

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
           Ashbya gossypii ACL158W
          Length = 91

 Score = 77.0 bits (188), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (63%), Gaps = 17/99 (17%)

Query: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           +P DTIARI QL SF ++ TRI+ +++ + +KY++LFVREAVLRS+EN+++       +K
Sbjct: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK-------VK 61

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
           K   K +            G  L H DLEEISG+LLLD 
Sbjct: 62  KEDGKGS---------LIEGPVLHHTDLEEISGILLLDF 91

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 76.3 bits (186), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 22/100 (22%)

Query: 10  IPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           +PK+TI RIL+L++F  E T I+ E+V +LQKY+E+FVREAV RS+ N++ + S+ +   
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDG-- 99

Query: 69  KAPAKANPDQLQTFQHSFNG-IELTHEDLEEISGLLLLDM 107
                             +G I+L HEDLE+I+G+LLLDM
Sbjct: 100 ------------------DGEIQLNHEDLEKITGMLLLDM 121

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 77.0 bits (188), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%), Gaps = 20/99 (20%)

Query: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           +P+DTIAR+LQ+ +F ++ TRI ++ V  LQ+Y+++F REAVLRSIE+ +  Q   E L+
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQ---EGLE 126

Query: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
           +   K                E+TH DLE I+GLLLLDM
Sbjct: 127 QEQDK----------------EITHTDLENIAGLLLLDM 149

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL161CX; YDL161CX was
           overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 71.6 bits (174), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 19/100 (19%)

Query: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68
           IP DTIAR+    SF ++ T+I+ ++V ++++YM+LF+REAVLRS+EN+E+ +    A  
Sbjct: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRA-- 70

Query: 69  KAPAKANPDQLQTFQHSF-NGIELTHEDLEEISGLLLLDM 107
                           SF  G  L H DLEEISG+L+LD 
Sbjct: 71  ---------------DSFAEGPVLQHTDLEEISGVLILDF 95

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 68.2 bits (165), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 24/100 (24%)

Query: 9   PIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEAL 67
            IPK+TIA+ILQLE+F   +T+++ E++ ++Q+YMELF+REA+ RS++N+E++       
Sbjct: 2   AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQ---- 57

Query: 68  KKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
                                I +  +DLE + GLLLLDM
Sbjct: 58  -------------------TDIVIDEKDLERVVGLLLLDM 78

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 62.0 bits (149), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (59%), Gaps = 12/102 (11%)

Query: 7   DGPIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIE 65
           D  I  +TI +IL+ ESF  ++T I+ E++ ++Q+YM+LF++EAV+RS EN+   Q    
Sbjct: 32  DMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDF 91

Query: 66  ALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
             ++   + +             IELTH DLE I GLLL+++
Sbjct: 92  DDEEDADEEDKT-----------IELTHLDLERIVGLLLMEL 122

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
           MHF2Protein of unknown function; ortholog of human MHF2,
           and component of the heterotetrameric MHF histone-fold
           complex that in humans interacts with both DNA and Mph1p
           ortholog FANCM to stabilize and remodel blocked
           replication forks and repair damaged DNA; mhf2 srs2
           double mutants are MMS hypersensitive
          Length = 80

 Score = 57.0 bits (136), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 56/98 (57%), Gaps = 19/98 (19%)

Query: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69
           + K+ + +IL     G + +I+ E V ++QKY+++F+ EAVLRS+++   K  N E   K
Sbjct: 2   LSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQS--HKDINGERGDK 59

Query: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
           +P                 +EL+H+DLE I GLLL+DM
Sbjct: 60  SP-----------------LELSHQDLERIVGLLLMDM 80

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
           YDL160C-A (REAL)
          Length = 80

 Score = 57.0 bits (136), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 56/98 (57%), Gaps = 19/98 (19%)

Query: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69
           + K+ + +IL   + G++  IS E + ++QKY+++F+ EA LRS+++   K  N E  KK
Sbjct: 2   LSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQS--HKDINKEHDKK 59

Query: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
            P                 +EL+H+DLE + G+LL+DM
Sbjct: 60  DP-----------------LELSHQDLERVVGVLLMDM 80

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conserved
           hypothetical protein
          Length = 79

 Score = 54.3 bits (129), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 50/95 (52%), Gaps = 26/95 (27%)

Query: 14  TIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKKAPA 72
           TIARILQ E F +  TRI+ E + +L+ Y+ELFVRE VLRS+EN+              A
Sbjct: 9   TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENK--------------A 54

Query: 73  KANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
               D+   F            DLE ++GLLL+D 
Sbjct: 55  DMLADKTVDFV-----------DLEAVAGLLLMDF 78

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 78

 Score = 53.9 bits (128), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 26/100 (26%)

Query: 10  IPKDTIARIL--QLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEAL 67
           IPK+TI+RIL  +L   GE   I+ E+V  + KY ++ + E VLRS+EN+E    NI   
Sbjct: 3   IPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKE----NI--- 55

Query: 68  KKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
               A+A P              L  +DLE+I GLLLLDM
Sbjct: 56  ----AEATP-------------TLDVDDLEKIIGLLLLDM 78

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
           YDL160C-A (REAL)
          Length = 81

 Score = 52.0 bits (123), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 21/99 (21%)

Query: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69
           +PK+ I +IL   +  +  +I  + + ++QKY+E+F+ EA LRS+++ +           
Sbjct: 3   LPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSG------- 55

Query: 70  APAKANPDQLQTFQHSFNG-IELTHEDLEEISGLLLLDM 107
                         H  +G +EL+H DLE I GLLL+DM
Sbjct: 56  -------------AHDGDGPLELSHLDLERIVGLLLMDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
           YDL160C-A (REAL)
          Length = 79

 Score = 49.7 bits (117), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 20/98 (20%)

Query: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69
           + KD + +IL   +F ++ +I  + + ++Q Y+++F+ EA LRS+++++           
Sbjct: 2   LSKDALIKILSQNNFRKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGG------ 55

Query: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
                         H    +EL+H DLE I GLLL+DM
Sbjct: 56  --------------HRDGPLELSHLDLERIVGLLLMDM 79

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 82

 Score = 48.5 bits (114), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 25/98 (25%)

Query: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69
           I ++T++RIL      + T I  +++  +QKY+E +V+E +LRS+EN++        L  
Sbjct: 9   ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD--------LGV 60

Query: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107
            PA                 ELT  D+E I GLLLLDM
Sbjct: 61  NPA-----------------ELTERDIERILGLLLLDM 81

>KAFR0C05040 Chr3 complement(1000430..1000978) [549 bp, 182 aa] {ON}
           Anc_7.29 YOR358W
          Length = 182

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 16  ARILQLESFGEETR-ISAESVGILQKYMELFVREAVLRSIENRE-------QKQSNIEAL 67
           ARI ++    E+ + ISAE+  I  K  E+F+ E  +RS    E       QK    EAL
Sbjct: 105 ARIRKVMKTDEDVKMISAEAPIIFAKACEIFITELTMRSWCVSEKNKRRTLQKNDIAEAL 164

Query: 68  KKA 70
           KK+
Sbjct: 165 KKS 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,449,897
Number of extensions: 360664
Number of successful extensions: 1268
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1239
Number of HSP's successfully gapped: 47
Length of query: 108
Length of database: 53,481,399
Length adjustment: 78
Effective length of query: 30
Effective length of database: 44,537,451
Effective search space: 1336123530
Effective search space used: 1336123530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)