Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F025906.65ON30627714030.0
Kpol_1042.116.65ON2922216241e-79
TBLA0G005506.65ON3182045896e-74
ZYRO0D14190g6.65ON2952555868e-74
NCAS0F003306.65ON2812165781e-72
Smik_15.3526.65ON2881815753e-72
KNAG0M010206.65ON2792335589e-70
YOR174W (MED4)6.65ON2842435571e-69
Skud_15.3366.65ON2862495511e-68
CAGL0L04620g6.65ON2642245491e-68
AGR270W6.65ON2942215432e-67
Suva_8.2276.65ON2871985414e-67
SAKL0A08426g6.65ON2991745391e-66
KAFR0G025006.65ON2892025311e-65
KLTH0G15444g6.65ON2632165133e-63
NDAI0J013206.65ON3342435124e-62
Kwal_56.232426.65ON2561774915e-60
KLLA0F20185g6.65ON2851964928e-60
TDEL0G040606.65ON2201634451e-53
Ecym_31246.65ON2742334473e-53
Kwal_23.5529na 1ON62834703.2
KLLA0B05555g4.310ON1997110694.3
KNAG0B028007.310ON1307114694.7
KLLA0C07843g7.258ON79488684.9
Kpol_1001.44.343ON106559685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02590
         (306 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   545   0.0  
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   244   1e-79
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   231   6e-74
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   230   8e-74
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   227   1e-72
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   226   3e-72
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   219   9e-70
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   219   1e-69
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   216   1e-68
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   216   1e-68
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   213   2e-67
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   213   4e-67
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   212   1e-66
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   209   1e-65
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   202   3e-63
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   201   4e-62
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   193   5e-60
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   194   8e-60
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   176   1e-53
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   176   3e-53
Kwal_23.5529 s23 complement(1203524..1205410) [1887 bp, 628 aa] ...    32   3.2  
KLLA0B05555g Chr2 complement(494997..500990) [5994 bp, 1997 aa] ...    31   4.3  
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    31   4.7  
KLLA0C07843g Chr3 complement(688312..690696) [2385 bp, 794 aa] {...    31   4.9  
Kpol_1001.4 s1001 complement(12729..15926) [3198 bp, 1065 aa] {O...    31   5.4  

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/277 (97%), Positives = 269/277 (97%)

Query: 1   MSNNYNMHGLNASEFLTKSNAEAFNSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANV 60
           MSNNYNMHGLNASEFLTKSNAEAFNSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANV
Sbjct: 1   MSNNYNMHGLNASEFLTKSNAEAFNSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANV 60

Query: 61  AIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKI 120
           AIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKI
Sbjct: 61  AIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKI 120

Query: 121 KDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKI 180
           KDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKI
Sbjct: 121 KDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKI 180

Query: 181 SKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDKELXX 240
           SKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDKEL  
Sbjct: 181 SKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDKELEE 240

Query: 241 XXXXXXHGTENTREADVEQEQEESFVFDGKHKNEEKT 277
                 HGTENTREADVEQEQEESFVFDGKHKNEEKT
Sbjct: 241 QQEQEQHGTENTREADVEQEQEESFVFDGKHKNEEKT 277

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  244 bits (624), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 160/221 (72%), Gaps = 8/221 (3%)

Query: 57  LANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTK 116
           L+ V IYNDI  YE+TL KLV S+D F+PDV++A  LI+VD+RL+K+L SF EYD+I TK
Sbjct: 42  LSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTK 101

Query: 117 ISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDY 176
           + +   ++ +LD +TK IL  LN+   +LNSLPMLE++ FE+D++ +++ KINSK+LLDY
Sbjct: 102 LEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDY 161

Query: 177 ATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDK 236
           ATK+SKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLA+AS+H  ELTKLPN+    S+ 
Sbjct: 162 ATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKLPNEPEEASEP 221

Query: 237 ELXXXXXXXXHGTENTREADVEQEQE-----ESFVFDGKHK 272
           +           TE   E  +  + E      S V+DG HK
Sbjct: 222 D---KSTEPDKSTEPIEEEKITVDNEGDISMGSIVYDGSHK 259

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  231 bits (589), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 110/204 (53%), Positives = 153/204 (75%)

Query: 24  FNSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNF 83
           F++TL      ++ + +IS+G     N    D L+ +  YND+  YE+TL KL SS+D +
Sbjct: 4   FHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKY 63

Query: 84  RPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRN 143
           +PD++ A  LI++D++LY  L SF +YDEI TK+ K++ D++ LD +TK +LD LND   
Sbjct: 64  KPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHE 123

Query: 144 MLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWP 203
           +LN+LPMLE++ FE++ M ++++KINSK+LLDYATK++KFTKIPPTFNK ++GPNNFIWP
Sbjct: 124 LLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWP 183

Query: 204 AEDALRRGMLAVASIHRSELTKLP 227
           AEDALRRGMLAVAS H  ELT LP
Sbjct: 184 AEDALRRGMLAVASAHTEELTALP 207

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  230 bits (586), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 169/255 (66%), Gaps = 16/255 (6%)

Query: 33  VPQSTANNISQGTASNMNTAAV-----------DSLANVAIYNDIKNYEDTLIKLVSSID 81
            P + AN +S+G   + +T+ +           D L+ V IY D+  YE+ L  LV S+D
Sbjct: 8   APDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVD 67

Query: 82  NFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDS 141
           NF+PDV++   LIEVDK LYK+L SF EYD ID++++++  +S +LD +TK +L+ L++ 
Sbjct: 68  NFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSEC 127

Query: 142 RNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFI 201
             MLN LPMLE++ FE+  + +++ K+NS +LL+YATK+SKFTKIPPTF+KG+IGPNNF+
Sbjct: 128 YEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFV 187

Query: 202 WPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDKELXXXXXXXXHGTENTREADVEQEQ 261
           WPAEDALRRGMLA+AS+H  E+T++P     + ++E          G +N +E + E + 
Sbjct: 188 WPAEDALRRGMLAIASLHSKEMTRIPG----EPEEEEADATEKQGSGDKNGKEGE-ETKT 242

Query: 262 EESFVFDGKHKNEEK 276
            E     G H NE +
Sbjct: 243 GERPASPGAHGNERR 257

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  227 bits (578), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 156/216 (72%), Gaps = 8/216 (3%)

Query: 55  DSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEID 114
           D ++ V IY+D+ +YE  L  LV+S+D F+PD+  A+ LIEVD+ L++ L SF+EYD+ID
Sbjct: 39  DDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKID 98

Query: 115 TKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILL 174
             + K+  +S +LD +TK IL ILN+  + LN+LPML+++ FE + + +++ KINS +LL
Sbjct: 99  NSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLL 158

Query: 175 DYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDS 234
           DYATK+SKFTKIPPTF+KGSIGPNNFIWPAEDALRRGMLA+AS+H  ELTK P   +++ 
Sbjct: 159 DYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPG--AHEG 216

Query: 235 DKELXXXXXXXXHGTENTREADVEQEQEESFVFDGK 270
           ++EL         G+E   + +    + ESF F GK
Sbjct: 217 EEEL------IPKGSEPIAQEEPVTTRRESFTFSGK 246

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  226 bits (575), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 142/181 (78%), Gaps = 2/181 (1%)

Query: 47  SNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGS 106
           SNMN+   D L+ V +Y D+  YEDTL KLV S+D F+PD++VA+ LI++D+ L+ N+  
Sbjct: 29  SNMNSE--DKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDL 86

Query: 107 FKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQK 166
             EYD ID  + KI  DSE+LD +TK IL+I+N+  + L +LPMLE++ FE++ + +++ 
Sbjct: 87  LSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRS 146

Query: 167 KINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKL 226
           KINS  LLDYATK+SKFT+IPPTF+KGSIGPNNFIWPAEDALRRGMLA+AS+H  ELT++
Sbjct: 147 KINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRV 206

Query: 227 P 227
           P
Sbjct: 207 P 207

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  219 bits (558), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 158/233 (67%), Gaps = 12/233 (5%)

Query: 36  STANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIE 95
           S+ + + +GT +    A  + L  V IY+ I  YEDTL  LV S+D+++PD+ VA+ L++
Sbjct: 22  SSVSLLQEGTDA---AALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVD 78

Query: 96  VDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIY 155
            DK L+ +L  FKEYDEI T++ ++K  S  LD +T+ IL+ LN+  + LN LP LE++ 
Sbjct: 79  ADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQ 138

Query: 156 FERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAV 215
           FE D + E+++KINS  LLDYATK+SKFT+IPPTF+KGSIGPNNFIWPAEDALR+GMLA+
Sbjct: 139 FEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAI 198

Query: 216 ASIHRSELTKLPN-DTSYDSDKELXXXXXXXXHGTENTREADVEQEQEESFVF 267
           A++H  ELT++P  D + D  K+            +    A V +E+  SFVF
Sbjct: 199 AALHSRELTRIPGQDDAEDKKKQ--------TEKPDVPEPAPVTEERRSSFVF 243

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  219 bits (557), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 158/243 (65%), Gaps = 18/243 (7%)

Query: 38  ANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVD 97
           ++++S    +  NT + D L+ V +Y D+  YEDTL KLV S+D F+P++++AK LI  D
Sbjct: 18  SSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTD 77

Query: 98  KRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFE 157
           + L++N+    EYD I   + KI  DSE+LD +T+ IL+ILN+  + L +LPMLE++ FE
Sbjct: 78  EALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFE 137

Query: 158 RDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVAS 217
           ++ + +++ KINS  LLDYATK+SKFTKIPPTF+KG++GPNNFIWPAEDALRRGMLA+AS
Sbjct: 138 KNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMAS 197

Query: 218 IHRSELTKLPN--------DTSYDSDKELXXXXXXXXHGTENTREADVEQEQEESFVFDG 269
           +H  ELT++P          T   S  E          GT  T          +SF+FDG
Sbjct: 198 LHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKT----------DSFIFDG 247

Query: 270 KHK 272
             K
Sbjct: 248 TAK 250

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  216 bits (551), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 167/249 (67%), Gaps = 4/249 (1%)

Query: 30  PVAVPQSTANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEV 89
           P+   +S++ ++    ASNMN+   D L+ V +Y D+  YE  L KLV S+D F+PD++V
Sbjct: 12  PMGHIKSSSVSLVAEAASNMNSE--DKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDV 69

Query: 90  AKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLP 149
           A+ LI  D+ L+ N+    +YD ID  + KI  DSE+LD +++ IL+ILN+  + L+ LP
Sbjct: 70  ARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLP 129

Query: 150 MLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALR 209
            LE++ FE++ + +++ KINS  LLDYATK+SKFTKIPPTF+KG++GPNNFIWPAEDALR
Sbjct: 130 TLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALR 189

Query: 210 RGMLAVASIHRSELTKLPNDTSYDSDKELXXXXXXXXHGTENTREADVEQEQEESFVFDG 269
           RGMLA+AS+H  ELT++P +   +++ E+           E     + +   +++F+F G
Sbjct: 190 RGMLAMASLHSKELTRVPGEDEQETE-EVPTAPLSQPGQQEEQEAQNEDISDKDTFIFKG 248

Query: 270 -KHKNEEKT 277
             HK+ E T
Sbjct: 249 TPHKDAEHT 257

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  216 bits (549), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 107/224 (47%), Positives = 153/224 (68%), Gaps = 4/224 (1%)

Query: 47  SNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGS 106
           SN  T +   L  V +Y+D+  YE+ L KLV S+DNF+P +E+ K LIE DK+LY  L  
Sbjct: 7   SNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDL 66

Query: 107 FKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQK 166
             +YD + T++  + D+  K+D QTK+IL ILN+  + LN+LP+LEE+ FE+ ++ ++++
Sbjct: 67  LPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQRE 126

Query: 167 KINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKL 226
           KI S +LL+YATK++KFTKIPPTF+KG+IGPNNFIWPAEDALR+GMLA+AS+H  ELTKL
Sbjct: 127 KIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKL 186

Query: 227 PNDTSYDSDKELXXXXXXXXHGTENTREADVEQE---QEESFVF 267
           P     + D              E   E ++ Q+   +++SFVF
Sbjct: 187 PGQEDGEEDGSTANEDKNIVKDAEGA-EGEIRQDDKKEDDSFVF 229

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  213 bits (543), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 153/221 (69%), Gaps = 12/221 (5%)

Query: 28  LTPVAVPQSTANNISQGTAS------------NMNTAAVDSLANVAIYNDIKNYEDTLIK 75
           L+  A P++T    +QG +S            + +    + L +VAIY D+  YE++L +
Sbjct: 6   LSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQR 65

Query: 76  LVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHIL 135
           LV+S+D F+PD+E A+ LIE+D +LY NL    +YD ID+++ K++++S+ +D +T  IL
Sbjct: 66  LVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKIL 125

Query: 136 DILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSI 195
            IL +  N LNSLPM+E++ FE   M +++ K+NS +LL+YA K+SKFT++PPTFNK +I
Sbjct: 126 GILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAI 185

Query: 196 GPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDK 236
           GPNNFIWPAEDA+RRGMLA+AS+   ELT LP  +  ++++
Sbjct: 186 GPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQ 226

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  213 bits (541), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 147/198 (74%), Gaps = 2/198 (1%)

Query: 30  PVAVPQSTANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEV 89
           P+   +S++ ++     S+MN+    S   V +Y D+  YED L KLV S+D F+P++E+
Sbjct: 12  PMNQIRSSSVSLVAEATSSMNSEHKSS--KVQLYEDLCRYEDILGKLVESVDRFKPNLEI 69

Query: 90  AKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLP 149
           AK LI+ D+ L+ N+    +YD+ID  + KI  DSE+LD +T+ IL+ILN+  + L++LP
Sbjct: 70  AKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALP 129

Query: 150 MLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALR 209
           MLE++ FE+  + +++ KINS  LLDYATK+SKFT+IPPTF+KG++GPNNFIWPAEDALR
Sbjct: 130 MLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALR 189

Query: 210 RGMLAVASIHRSELTKLP 227
           RGMLA+AS+H  ELT++P
Sbjct: 190 RGMLAMASLHSKELTRIP 207

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  212 bits (539), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 135/174 (77%)

Query: 55  DSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEID 114
           D L+ V +Y DI  YE+TL KLVSS+D F+PD++VA+ LIE DK+L+K L  F +YD+ID
Sbjct: 42  DLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKID 101

Query: 115 TKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILL 174
            +++ ++  S+++D +T  IL++LN     LNSLP LE++  ERD M ++++KI S +LL
Sbjct: 102 GRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLL 161

Query: 175 DYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPN 228
           DYA K++KFT++PPTF+KG +GPNNFIWPAEDA+RRGMLA+AS+   ELT++P 
Sbjct: 162 DYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  209 bits (531), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 98/202 (48%), Positives = 148/202 (73%), Gaps = 2/202 (0%)

Query: 25  NSTLTPVAVPQSTANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFR 84
           +S+L+ +  P ST+  I+     +  + A  ++  V IY+D+  YE+TL +L+ SID ++
Sbjct: 11  SSSLSLLGEPPSTS--ITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYK 68

Query: 85  PDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNM 144
           PD ++A+ LI++D +L+ +L SF +YD I +++   +   ++  L+TK IL+ LN+  N 
Sbjct: 69  PDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNA 128

Query: 145 LNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPA 204
           LN LP +++++FE + M E++KKINS +LLDYATK+SKFTKIPPTF+KGSIGPNNF+WPA
Sbjct: 129 LNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPA 188

Query: 205 EDALRRGMLAVASIHRSELTKL 226
           EDALRRGMLA+A+ H  ELTK+
Sbjct: 189 EDALRRGMLALAASHTDELTKI 210

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  202 bits (513), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 145/216 (67%), Gaps = 4/216 (1%)

Query: 57  LANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTK 116
           L+ + +YNDI  +EDTL KLV+S+D F PD+E+A+ LIE DK+LYK+L    +YDEIDT+
Sbjct: 22  LSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTR 81

Query: 117 ISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDY 176
              + ++    D +T  IL+ L +  + LN+LPMLE++ FER+ M ++++K+ + +LLDY
Sbjct: 82  AKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDY 141

Query: 177 ATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDK 236
           A K++KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+AS+  SE      +    S++
Sbjct: 142 AMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANA-QEQQASSEQ 200

Query: 237 ELXXXXXXXXHGTENTREADVEQE---QEESFVFDG 269
           +             + R  D ++E   +  SF FDG
Sbjct: 201 KTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDG 236

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  201 bits (512), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 155/243 (63%), Gaps = 8/243 (3%)

Query: 38  ANNISQGTASNM-------NTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVA 90
           A  ++ GT S+        N ++ D L+ V IY+DI  YE  L +L+ S+D F+P++ +A
Sbjct: 50  AEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIA 109

Query: 91  KTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPM 150
           + LI+ DK L+  L SF +YDEID  +  ++  + K+D  T+  L  LN+  + LN LP 
Sbjct: 110 QELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPT 169

Query: 151 LEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRR 210
           L +I FE + +  ++ KINS ILLDYATK+SKFTKIPPTF+KGSIGPNNFIWPAED+LRR
Sbjct: 170 LPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRR 229

Query: 211 GMLAVASIHRSELTKLPNDT-SYDSDKELXXXXXXXXHGTENTREADVEQEQEESFVFDG 269
           GMLA+AS+   +LT +P    S   +K L          T+  ++   EQ + ESFVF G
Sbjct: 230 GMLAMASLKADQLTYIPGQAQSMSKEKALPTEVQETQEQTQTQQQDQEEQPRRESFVFSG 289

Query: 270 KHK 272
           K+K
Sbjct: 290 KNK 292

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  193 bits (491), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (71%)

Query: 51  TAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEY 110
           T A   L+   IY+DI  +E+TL KLV+S+D F PD+++A++LIEVDKRL K L S   Y
Sbjct: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75

Query: 111 DEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINS 170
           DEID +  ++     + D +   IL+ L +    LN+LPMLE++ FER  M ++++K+ +
Sbjct: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135

Query: 171 KILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLP 227
            +LLDYA K++KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+AS+  SE  K P
Sbjct: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  194 bits (492), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 139/196 (70%), Gaps = 1/196 (0%)

Query: 29  TPVAVPQSTANNISQGTASNMNTAAV-DSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDV 87
           TP  VP ST+      +A +     V + L +V IY D++ YE+T+ +L  S+D F+PD+
Sbjct: 3   TPGPVPSSTSVATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDL 62

Query: 88  EVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNS 147
            +   +IE DK+LY+ L  F EY +I+ ++S++  + + +D +T+ IL+ LN   N LN 
Sbjct: 63  SLIDKVIECDKKLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNE 122

Query: 148 LPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDA 207
           LPMLE++ FE+ VM ++++KI+SK++LDYA K++KFT+ PPTF+K  IGPNNFIWPAED+
Sbjct: 123 LPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDS 182

Query: 208 LRRGMLAVASIHRSEL 223
           LR+GMLA+AS+ + EL
Sbjct: 183 LRKGMLAMASLKKKEL 198

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  176 bits (445), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 116/163 (71%), Gaps = 3/163 (1%)

Query: 62  IYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIK 121
           +Y D+  YE+ L +LV S+D FRPD+  A+ L+E D+ L K+L  F  YDE+D ++ ++ 
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 122 DDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKIS 181
            +SE+L+  T   L+ L++    L++LPMLE++ FE+  + E++ ++NS +LL+YATK+S
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 182 KFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELT 224
           KFTK P      ++GPNNF+WPAEDALRRG LAVA++H  E+T
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  176 bits (447), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 147/233 (63%), Gaps = 5/233 (2%)

Query: 50  NTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKE 109
           N   ++ +  V +Y D+  +E+ L KLV S+D F PD++ A+ LI  D +LY  L     
Sbjct: 15  NNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPL 74

Query: 110 YDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKIN 169
           YD ID ++ ++ ++S+++D +T  IL IL+   N LN LPM+E++ FE  +M ++++KI 
Sbjct: 75  YDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIK 134

Query: 170 SKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPND 229
           S +LL+YA K++KFT++PPTFNK +IGPNNFIWPAEDA+RRGMLA+AS+   ELT++P +
Sbjct: 135 SGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVE 194

Query: 230 TSYDSDKELXXXXXXXXHG-TENTREADVEQ----EQEESFVFDGKHKNEEKT 277
            + +  +E               T  +D        + ESF F GK KN++ T
Sbjct: 195 LNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQST 247

>Kwal_23.5529 s23 complement(1203524..1205410) [1887 bp, 628 aa]
           {ON} [contig 11] FULL
          Length = 628

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 201 IWPAEDALRRGMLAVASIHRSELTKLPNDTSYDS 234
           +WP+ +AL R  +A   +HR+ L KL    S+DS
Sbjct: 459 LWPSWEALARNYIAAILLHRNSLRKLSLLASHDS 492

>KLLA0B05555g Chr2 complement(494997..500990) [5994 bp, 1997 aa]
           {ON} similar to uniprot|Q00416 Saccharomyces cerevisiae
           YLR430W SEN1 Nuclear protein putative helicase required
           for processing of tRNAs rRNAs and small nuclear RNAs
           potential Cdc28p substrate
          Length = 1997

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 13/110 (11%)

Query: 80  IDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQT-KHILDIL 138
           ++NF  DV      +EV   L   +GS++E+ ++  K +  +DD  K  +   K++L  L
Sbjct: 789 LENFTRDV------LEVSNML---MGSYREFSDVLVKGNITEDDLFKFPMSPFKNMLYWL 839

Query: 139 N-DSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIP 187
             +   +L S  ML  I    D+  EKQ + +  ++LD A   SK  K P
Sbjct: 840 RLNDEQLLASCVML--IVSASDLAKEKQFRFDEMLVLDMARYASKARKYP 887

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
            YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 7/114 (6%)

Query: 18   KSNAEAFNSTLTPVAVPQSTANNISQGTASNM--NTAAVDSLANVAIYNDIKNYEDTLIK 75
            K  AEA  S  TPVA P ST   +S G  +N+  ++++  + A V +  D +    +L  
Sbjct: 1155 KETAEASGSVATPVAPPASTVVPVS-GDGNNVAADSSSAPAPAAVTLPEDQQEIIASLKD 1213

Query: 76   LVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTK--ISKIKDDSEKL 127
             ++ +    P  E AK L + +KRL K L +  E+ E+ T   I K+++ +E L
Sbjct: 1214 ELNRVKPLTPK-EYAKQLKDCEKRL-KILFNHLEHQELLTPPTIDKLRELTELL 1265

>KLLA0C07843g Chr3 complement(688312..690696) [2385 bp, 794 aa] {ON}
           similar to uniprot|P32844 Saccharomyces cerevisiae
           YIL068C SEC6 Essential 88kDa subunit of the exocyst
           complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p
           and Exo84p) which has the essential function of
           mediating polarized targeting of secretory vesicles to
           active sites of exocytosis
          Length = 794

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 69  YEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLD 128
           Y D + KL++ + +  P+  +   ++E DK     L   KE+     +I  I  DSEK  
Sbjct: 358 YYDEIHKLITELVDSEPETIIILDILEFDKNFQSVLK--KEFGFNKDRIKSIIGDSEKEQ 415

Query: 129 LQTKHILDILNDSRNMLNSLPMLEEIYF 156
           L + ++  ILN  R  + +L   E + F
Sbjct: 416 LLSDYLTLILNKMREWIGNLEKTEVVIF 443

>Kpol_1001.4 s1001 complement(12729..15926) [3198 bp, 1065 aa] {ON}
           complement(12729..15926) [3198 nt, 1066 aa]
          Length = 1065

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 41  ISQGTASNMNTAAVDSLANVAIYNDIKNY---EDTLIKLVSSIDNFRPDVEVAKTLIEV 96
           IS G +SN + + + S+A +  Y ++K Y   ED L+ ++S   +   D  V+K +  V
Sbjct: 448 ISSGKSSNFSDSVIISMAPIQYYENVKTYHKIEDNLVTILSYFSSAIRDSFVSKVIFAV 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,250,359
Number of extensions: 1444786
Number of successful extensions: 6384
Number of sequences better than 10.0: 224
Number of HSP's gapped: 6659
Number of HSP's successfully gapped: 225
Length of query: 306
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 197
Effective length of database: 40,982,805
Effective search space: 8073612585
Effective search space used: 8073612585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)