Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0F024806.45ON60560529150.0
Kpol_1035.506.45ON60159413051e-173
ZYRO0C07194g6.45ON55860410961e-142
TDEL0G042506.45ON51740310751e-140
TBLA0B005606.45ON4924139781e-126
YOL013C (HRD1)6.45ON5514239651e-123
Smik_15.1576.45ON5504559641e-123
Skud_15.1486.45ON5484189481e-120
SAKL0E01958g6.45ON5245999411e-120
Suva_15.1596.45ON5504259431e-120
KAFR0A052406.45ON5534689251e-117
KLTH0C10604g6.45ON5156048541e-107
NCAS0D020106.45ON5104308471e-106
Kwal_56.225226.45ON5134348151e-101
NDAI0C027706.45ON6304528122e-99
KNAG0E027406.45ON5564318044e-99
CAGL0E02299g6.45ON5454307887e-97
KLLA0C05874g6.45ON5534615558e-63
ACL019C6.45ON5754054851e-52
Ecym_30486.45ON6704023878e-39
KLTH0G12408g8.317ON603401153e-05
Kwal_56.239008.317ON589401092e-04
KLLA0F25674g2.545ON7571391073e-04
AFR275W2.545ON753251073e-04
TPHA0C042602.545ON757251064e-04
ZYRO0E05632g2.545ON765251047e-04
KAFR0B014602.545ON761251047e-04
TBLA0I014902.545ON750251030.001
NDAI0K018102.545ON762281020.001
TDEL0B063402.545ON762251020.001
Suva_11.1892.545ON758251020.001
YKL034W (TUL1)2.545ON758251020.001
Ecym_72412.545ON758251020.001
Skud_11.1922.545ON758251010.001
Smik_11.2132.545ON759251010.001
Skud_4.4028.317ON612401010.001
KNAG0A070902.545ON762251010.001
NCAS0A047602.545ON761251010.001
Ecym_42508.317ON657401010.002
Kpol_1002.72.545ON754251000.002
Kwal_26.80992.545ON75025990.003
NCAS0C033108.317ON570122980.003
KLTH0D07216g2.545ON74725980.003
KAFR0B030708.317ON64340980.003
Suva_2.3048.317ON62440980.003
SAKL0A09812g2.545ON75125970.004
Smik_4.3878.317ON63440960.005
YDR143C (SAN1)8.317ON61040960.005
TPHA0C008508.317ON78147960.006
Kpol_1036.668.317ON66831950.008
CAGL0K02563g2.542ON58630950.008
NDAI0G026308.317ON66141940.009
CAGL0E01441g8.317ON71735940.010
CAGL0L01947g2.545ON75725930.012
Kwal_27.105463.279ON10438860.012
YBR062C3.279ON18087890.015
KNAG0G023908.317ON68838920.016
SAKL0H17116gsingletonON54440920.016
AGR034W3.279ON15932870.019
Kpol_1048.731.389ON1549106920.019
TDEL0F02870na 1ON26093890.022
ZYRO0D05830g8.317ON78040910.024
Suva_4.3023.279ON15028850.028
KLLA0E04071g8.317ON70430900.034
KLTH0C05258g3.279ON15232850.034
KAFR0A019902.542ON56030890.037
Skud_2.1863.279ON17884850.044
TBLA0G023102.542ON67430880.052
TBLA0A096405.628ON325117860.060
Kpol_526.345.628ON32829860.071
KNAG0C056602.542ON50730860.074
CAGL0M08690g5.628ON32829850.086
TDEL0F044408.317ON55452850.10
NDAI0A074503.279ON17338820.11
KLLA0F25740g2.542ON51738850.12
SAKL0H15686g8.317ON59940850.12
ZYRO0C11176g5.628ON36829830.16
SAKL0A09746g2.542ON54838840.17
Smik_2.1963.279ON18532810.17
Kpol_1002.82.542ON55828830.17
ZYRO0A04906g3.190ON16087800.18
Ecym_26583.279ON15938800.18
ZYRO0B02244g2.542ON56328830.18
SAKL0G07370g5.628ON32129820.19
NCAS0A04680singletonON27432820.20
Ecym_13285.628ON32041820.21
TDEL0D034603.279ON14438780.22
NCAS0A125502.542ON57228820.23
Kwal_55.199995.628ON152160780.25
Suva_8.422.542ON58528820.25
TPHA0C042502.542ON55626820.27
YHL010C (ETP1)2.542ON58528820.27
Smik_8.322.542ON58528820.29
TDEL0A031802.542ON56728820.29
TPHA0H006403.190ON18092790.30
KNAG0J008503.279ON16228780.31
KLTH0D07150g2.542ON54028810.31
Skud_8.352.542ON58528810.31
KLTH0E02464g5.628ON32929800.33
NDAI0B018202.542ON62528810.35
TPHA0A033403.405ON38439790.45
Kwal_26.80902.542ON52046790.51
NDAI0H008405.628ON34142790.54
KLLA0E16677g5.628ON30529780.57
AER390W5.628ON31629780.58
Ecym_54453.405ON32147780.68
Kwal_56.231123.190ON13573740.76
KAFR0H005605.628ON32729770.80
ABR104W3.405ON32829770.91
TBLA0A002603.190ON18470750.93
Skud_4.5285.628ON33729760.98
YDR265W (PEX10)5.628ON33729760.98
TBLA0B026708.808ON47836771.0
Suva_10.3441.389ON156085781.0
NDAI0E004408.808ON41635771.0
NCAS0A082803.279ON11838721.0
KNAG0I013801.389ON149326771.1
TBLA0I019603.279ON18433741.1
TDEL0A049405.628ON32629761.1
Smik_4.5165.628ON33729761.2
Suva_2.4335.628ON33729761.2
SAKL0C01760gsingletonON147462771.2
SAKL0C03586gsingletonON147462771.2
NDAI0D02810na 1ON252111751.2
SAKL0D03058g3.279ON15533731.3
NDAI0G052001.389ON1586109771.3
KLLA0F12166g1.389ON152873761.4
KLLA0F18458g3.279ON14028721.6
TBLA0C013301.389ON145246761.7
TPHA0A039903.279ON17528721.7
TBLA0A039008.317ON69835752.0
TPHA0I005608.808ON39436742.1
NCAS0C052905.628ON33029742.2
NCAS0B009908.808ON39246742.2
Kwal_26.8030na 2ON66030742.4
Kpol_1052.193.279ON10328683.0
CAGL0B02013g8.288ON112021733.6
ZYRO0E06996g3.279ON17238703.6
YLR247C (IRC20)1.389ON155670734.0
KLTH0D06886gna 2ON66430724.1
KAFR0C004603.279ON15731694.5
AGL191W8.317ON58242714.7
KLTH0F18502gsingletonON26729705.3
CAGL0B05049g1.389ON147024716.4
KLLA0E18503gna 2ON65028707.1
NCAS0A087801.389ON150227707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0F02480
         (605 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...  1127   0.0  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   507   e-173
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   426   e-142
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   418   e-140
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   381   e-126
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   376   e-123
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   375   e-123
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   369   e-120
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   367   e-120
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   367   e-120
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   360   e-117
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   333   e-107
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   330   e-106
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   318   e-101
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   317   2e-99
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   314   4e-99
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   308   7e-97
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   218   8e-63
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   191   1e-52
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   153   8e-39
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    49   3e-05
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    47   2e-04
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    46   3e-04
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    46   3e-04
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    45   4e-04
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    45   7e-04
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    45   7e-04
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    44   0.001
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    44   0.001
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    44   0.001
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    44   0.001
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    44   0.001
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    44   0.001
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    44   0.001
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    44   0.001
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    44   0.001
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    44   0.001
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    44   0.001
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    44   0.002
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    43   0.002
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    43   0.003
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     42   0.003
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    42   0.003
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    42   0.003
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    42   0.003
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    42   0.004
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    42   0.005
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    42   0.005
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    42   0.006
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    41   0.008
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    41   0.008
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     41   0.009
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    41   0.010
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    40   0.012
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    38   0.012
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    39   0.015
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    40   0.016
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    40   0.016
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    38   0.019
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    40   0.019
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      39   0.022
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    40   0.024
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    37   0.028
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    39   0.034
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    37   0.034
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    39   0.037
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    37   0.044
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    39   0.052
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    38   0.060
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    38   0.071
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    38   0.074
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    37   0.086
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    37   0.10 
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    36   0.11 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    37   0.12 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    37   0.12 
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    37   0.16 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    37   0.17 
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    36   0.17 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    37   0.17 
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...    35   0.18 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    35   0.18 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.18 
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    36   0.19 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      36   0.20 
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    36   0.21 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    35   0.22 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    36   0.23 
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    35   0.25 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    36   0.25 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.27 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    36   0.27 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   0.29 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    36   0.29 
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...    35   0.30 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    35   0.31 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    36   0.31 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    36   0.31 
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    35   0.33 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     36   0.35 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    35   0.45 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    35   0.51 
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    35   0.54 
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    35   0.57 
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    35   0.58 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    35   0.68 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    33   0.76 
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    34   0.80 
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    34   0.91 
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...    33   0.93 
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    34   0.98 
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    34   0.98 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    34   1.0  
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    35   1.0  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    34   1.0  
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    32   1.0  
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    34   1.1  
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    33   1.1  
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    34   1.1  
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    34   1.2  
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    34   1.2  
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    34   1.2  
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    34   1.2  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   1.2  
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    33   1.3  
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    34   1.3  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    34   1.4  
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    32   1.6  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    34   1.7  
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    32   1.7  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    33   2.0  
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    33   2.1  
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    33   2.2  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    33   2.2  
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    33   2.4  
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    31   3.0  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   3.6  
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    32   3.6  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    33   4.0  
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    32   4.1  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    31   4.5  
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    32   4.7  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    32   5.3  
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    32   6.4  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    32   7.1  
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    32   7.6  

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/605 (93%), Positives = 565/605 (93%)

Query: 1   MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLN 60
           MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLN
Sbjct: 1   MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLN 60

Query: 61  VAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIF 120
           VAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIF
Sbjct: 61  VAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIF 120

Query: 121 MKVAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNS 180
           MKVAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNS
Sbjct: 121 MKVAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNS 180

Query: 181 MGASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXX 240
           MGASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNI             
Sbjct: 181 MGASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDEE 240

Query: 241 XFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWK 300
            FNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWK
Sbjct: 241 EFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWK 300

Query: 301 TWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAI 360
           TWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNS           QIYNAAI
Sbjct: 301 TWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAAI 360

Query: 361 HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTEL 420
           HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTEL
Sbjct: 361 HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTEL 420

Query: 421 TATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVXXXXXXXXXX 480
           TATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADV          
Sbjct: 421 TATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYDL 480

Query: 481 XXXXXIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVNKESISFELTDLKNPDQTIL 540
                IPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVNKESISFELTDLKNPDQTIL
Sbjct: 481 DNELEIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVNKESISFELTDLKNPDQTIL 540

Query: 541 TKLIIKEKPILKDSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEK 600
           TKLIIKEKPILKDSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEK
Sbjct: 541 TKLIIKEKPILKDSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEK 600

Query: 601 ETVEQ 605
           ETVEQ
Sbjct: 601 ETVEQ 605

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 281/594 (47%), Positives = 386/594 (64%), Gaps = 29/594 (4%)

Query: 22  STIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKGLMYLLFSSLRLIEY 81
           +T    Y A+ SS+SYLQVTIKL++G N I+LVLF +LN  ++W+  ++L F +LRLIEY
Sbjct: 23  ATFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEY 82

Query: 82  EHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWVLKDRLESLLQSMND 141
           EH++ERLPFTI+N  +  SMFN++ I  + S +G  LIFMKV HW+L+DRL++++QS ND
Sbjct: 83  EHVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFND 142

Query: 142 NSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGASTSIHLLLGVEFTMLLVD 201
           +S++ S+I SN FFLNL +F ++DY+M+  CV+NS+ NSMGAST++HLLLG+EFTMLL+D
Sbjct: 143 SSTLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGASTTVHLLLGMEFTMLLID 202

Query: 202 LVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXX-XFNELEGKFMYEKAIDIFTR 260
           L+NLFLHTCLNLYEFH +  +R+ NI               FN LEGKFMYEK ID+FTR
Sbjct: 203 LLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTIDVFTR 262

Query: 261 FLKTLLHLLMFIPFRMK-IVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEE 319
           FLKT +H+LM IP RMK  +LLKDVIW+VI+LY+ T SLWKTW+N+KQLD+KLPT S+EE
Sbjct: 263 FLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIEE 322

Query: 320 LKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGC 379
           LK++DN++CIVCMD L+    NS           ++Y+  + SKQKPKKLPC HILHL C
Sbjct: 323 LKNTDNNICIVCMDDLLP-RINS--EKYDSQREKELYDHIMKSKQKPKKLPCGHILHLNC 379

Query: 380 LKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDAADESTENDTEM 439
           LKNWMERSQTCPICRL VFD  GN++P  +T S     T+     +   +    +  TE+
Sbjct: 380 LKNWMERSQTCPICRLPVFDDKGNVMP--STHSQNQTETQQQQPQTQTQSTTELQPQTEV 437

Query: 440 DALLSSQVQ-------ESVGDTLARDINFRSSIGDADVXXXXXXXXXXXXXXXIPNSDNP 492
              L+ + +       ++V +T  RD    +S G                   + N+   
Sbjct: 438 QPDLNQRQETNIQHNVQNVIETPGRDSAQDASRGGTG----------SNSDHNLTNTQVS 487

Query: 493 SQLLNSESQN--AECEFNNVKWKSFLIKSVNKESISFELTDLKNPDQTILTKLIIKEK-- 548
           S+  ++E Q        N   W SF IK+ +  SI+F+++D  +P +    KL ++EK  
Sbjct: 488 SEGSSNEQQGNVTNSILNTSSWYSFPIKTSSDSSITFDISDAHDPAKVYPAKLSVEEKVS 547

Query: 549 -PILKDSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKIDEKE 601
              L     + QVVIKD+DI   T+ KTI  L  +I ELE K+  +++ +   E
Sbjct: 548 SRTLNSDGGMLQVVIKDKDIKTVTDSKTIDLLKKRITELEEKVDSLAANVQNVE 601

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  426 bits (1096), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/604 (41%), Positives = 361/604 (59%), Gaps = 65/604 (10%)

Query: 5   SVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFI 64
           S TR+ Q+A     +Y  TI+  Y + ++S S+LQ TIKLT G NV+IL +F +LN A +
Sbjct: 4   SDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVL 63

Query: 65  WKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVA 124
           WK    +LF +L L+EYEHI ERLPFTIIN   +SSMF+E+D   +++ +G++L++MKV 
Sbjct: 64  WKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDF-FTVTLFGLLLLYMKVF 122

Query: 125 HWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGAS 184
           HW+LKDRLE+LLQS++++++++SLI + RF  NL L A++DY+++  C+TNS+ NS GAS
Sbjct: 123 HWILKDRLEALLQSIHESTTLKSLICT-RFSFNLVLLAILDYKIVSGCITNSLSNSFGAS 181

Query: 185 TSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXX------ 238
           TS+HL++G+EF MLL+DL+NL +HT LN YEF+++  D +L+                  
Sbjct: 182 TSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDEDV 241

Query: 239 -XXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVS 297
               F  LEGKFMYE+ ID+FTRFLKTL+H +M IPFRM I+L+KDV WDV+TL Q   S
Sbjct: 242 NGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSS 301

Query: 298 LWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYN 357
           LW+ W+N+KQLD+KL T+S  EL ++DN +CIVCMD L   D                  
Sbjct: 302 LWRIWQNNKQLDDKLKTMSPVELSATDN-ICIVCMDELC-ADLEEVVQGPDRE------K 353

Query: 358 AAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRN 417
            A   K KPK+LPC H+LHL CLKNWMERSQTCPICRL VFD NGN++   +  S T R 
Sbjct: 354 VAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVV--QSQSSTTNRT 411

Query: 418 TELT--ATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRS---SIGDADVXX 472
           T+ T  +TN    A  +T   T      ++++  S G T +   + +S   ++GD     
Sbjct: 412 TQATNQSTNVTTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQSTQQTLGD----- 466

Query: 473 XXXXXXXXXXXXXIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVNKESISFELTD- 531
                           +D+ S + N              W S+ I+      ++F L D 
Sbjct: 467 ---------LTPTPTTADSNSNIAN-------------LWYSYPIQEAKDGVVTFSLRDS 504

Query: 532 -LKNPDQTILTKLIIKEKPILKDSKNIKQVVIKDEDIWMATEPKTIKSLNDKINELERKL 590
              NP         ++ K  L +    +++ I +E I      ++I+ L  +I+ELE ++
Sbjct: 505 VSGNP---------VRAKLTLNNDNETQRITIPNECI---HHLESIQGLKRRISELEAQV 552

Query: 591 KDIS 594
           +++S
Sbjct: 553 REMS 556

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  418 bits (1075), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/403 (50%), Positives = 282/403 (69%), Gaps = 23/403 (5%)

Query: 3   SLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVA 62
           ++S TRK Q  + +  +Y  TI+  Y A ++S S+LQ  ++LT+G N++I+ +F  LN  
Sbjct: 2   AISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSV 61

Query: 63  FIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMK 122
            +WK    LLF SLRLIEYEHI ERLPFTIIN  L+SSMF+E D  ++++ YG++L+FMK
Sbjct: 62  LLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDF-LTVAIYGLLLLFMK 120

Query: 123 VAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG 182
           V HW+L+DRLE+LLQ++ +++++  LIF+ RF  NL L A+ DYQ++  CV+NS+ NS G
Sbjct: 121 VFHWILRDRLEALLQTIQESTTLSDLIFT-RFTFNLVLLAIADYQIISHCVSNSLDNSFG 179

Query: 183 ASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXXXF 242
           AS S+HL++G+EF +LL+DL+N  LH  L  YEF++S      N               F
Sbjct: 180 ASASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRRN-----AVNDDEDDTQF 234

Query: 243 NELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTW 302
           + LEGKF+YE+ IDI TRFLKT+LH L+ +PFRM I+L+KDV+WD +TL+Q+   LWK W
Sbjct: 235 SGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIW 294

Query: 303 RNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHS 362
           RN+KQLD+KLPT+S ++L++ DN MCI+CMD LI                 Q      ++
Sbjct: 295 RNNKQLDDKLPTMSEDQLRNIDN-MCIICMDELI---------------PEQDEGHTRNT 338

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNIL 405
           K KPK+LPC H+LHL CLKNWMERSQTCPICRL+VFD  GN++
Sbjct: 339 KNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVV 381

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  381 bits (978), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 207/413 (50%), Positives = 283/413 (68%), Gaps = 28/413 (6%)

Query: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66
           +R  Q  L T  IY  T    Y AI SS S+LQVTIKLT+G N+II+ +F ++N   +WK
Sbjct: 6   SRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILWK 65

Query: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126
              YLLF  LRLIEYEH+LERLPFT+IN   +SSMFNE DI  +I    ++L++MKV++W
Sbjct: 66  FSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIL-SLLLLYMKVSNW 124

Query: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSI--KNSMGAS 184
           +L+DRLESLLQ++ND+++I +LIFS +FF NL LF++IDY MM  C++NS+   +++G+S
Sbjct: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSNIGSS 184

Query: 185 TSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS---IEDRNLNIXXXXXXXXXXXXXX 241
            S++LL+G+EFTMLLVDL N+  H+ LN+YEF+KS     D +L                
Sbjct: 185 ASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLT-----SEDEEDDESG 239

Query: 242 FNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKT 301
           FN LEGKF+YEK ID FTRFLKT++H+L+ IPF M ++L KDV+ D++TL Q+  ++WK 
Sbjct: 240 FNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKI 299

Query: 302 WRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIH 361
           W N+++LD++LPTV+  +L S ++ +CI+CMD L     NS                   
Sbjct: 300 WVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDL---SINSIQKN--------------F 342

Query: 362 SKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDT 414
            K+KPK LPC HILH+ CLKNWMERSQTCP+CRL VF+  G +LP    R+ T
Sbjct: 343 EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRRERATT 395

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 17/95 (17%)

Query: 509 NVKWKSFLIKSVNKESISFELTDLKNPDQTILTKLIIKEKPILKDSKNIKQVVIKDEDIW 568
           N +W SF I++++  +I+F   +L N D  IL     K + ++  + +  Q    + D  
Sbjct: 409 NEEWVSFPIETIDDSTITF---NLANDDGRIL-----KSRLLINSTTDTTQ----NSDDI 456

Query: 569 MATEPKTIKSLNDKINELERKLKDISSKIDEKETV 603
           +  + K I  L D+IN+L + +K     IDEKE +
Sbjct: 457 LGLKQK-INQLQDQINQLNKNMK----PIDEKENI 486

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  376 bits (965), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 284/423 (67%), Gaps = 42/423 (9%)

Query: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67
           R+ QLA+   V Y  T +  Y A ++S S+LQVT+KL +G N+++L +F LLN   +W+ 
Sbjct: 6   RRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127
           L  LLF  LRLIE+EHI ERLPFTIIN   +SS+F+ER    +++ +G++L+++KV HW+
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHER-YFFTVAFFGLLLLYLKVFHWI 124

Query: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG--AST 185
           LKDRLE+LLQS+ND++++++LIFS RF  NL L AV+DYQ++ +C+++   N      ST
Sbjct: 125 LKDRLEALLQSINDSTTMKTLIFS-RFSFNLVLLAVVDYQIITRCISSIYTNQKSDIEST 183

Query: 186 SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS---------------------IEDRN 224
           S++L+  +EFTMLL+DL+NLFL TCLN +EF++S                     +E   
Sbjct: 184 SLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQ 243

Query: 225 LNIXXXXXXXXXXXXXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDV 284
                            F  LEGKFMYEKAID+FTRFLKT LHL M IPFRM ++LLKDV
Sbjct: 244 SQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 303

Query: 285 IWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDND--MCIVCMDSLINIDFNS 342
           +WD++ LYQS  SLWK WRN+KQLD+ L TV++E+L++S ND  +CI+CMD LI+     
Sbjct: 304 VWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIH----- 358

Query: 343 XXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
                      Q +    +  +KPK+LPC HILHL CLKNWMERSQTCPICRL VFD  G
Sbjct: 359 -------SPNQQTWK---NKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 408

Query: 403 NIL 405
           N++
Sbjct: 409 NVV 411

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  375 bits (964), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/455 (48%), Positives = 298/455 (65%), Gaps = 47/455 (10%)

Query: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67
           R+ QL +   + Y  T +  Y A ++S S+LQVT+KL +G N+++L +F LLN   +W  
Sbjct: 6   RRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLWHL 65

Query: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127
           L  LLF  LRLIE+EHI ERLPFTIIN   +SSMF+ER    +++ +G++L+++KV HW+
Sbjct: 66  LTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHER-YFFTVAFFGLLLLYLKVFHWI 124

Query: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSM--GAST 185
           LKDRLE+LLQS+ND++++++LIFS RF LNL L A +DYQ+++ C+++   N      ST
Sbjct: 125 LKDRLEALLQSINDSTTMKTLIFS-RFSLNLVLLAALDYQIIVHCISSIYTNQKIDIVST 183

Query: 186 SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIE--------------------DRNL 225
           S++L+  +EFTMLL+DL+NLFL TCLN +EF++S +                    D + 
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDFDG 243

Query: 226 NIXXXXXXXXXXXXXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVI 285
           +               F  LEGKFMYEKAID+FTRFLKT LHL M IPFRM ++LLKDVI
Sbjct: 244 SQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVI 303

Query: 286 WDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDND--MCIVCMDSLINIDFNSX 343
           WD++ LYQS   LWK WRN+KQLD+ L TV++E+L++S N+  +CI+CMD LI+      
Sbjct: 304 WDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIH------ 357

Query: 344 XXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGN 403
                     Q +    +  +KPK+LPC HILHL CLKNWMERSQTCPICRL VFD  GN
Sbjct: 358 ------STNQQTWK---NKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGN 408

Query: 404 ILPFNNT----RSDTMRNTELTAT--NSNDAADES 432
           ++    T     S TM  T+ T T  NS D A+E+
Sbjct: 409 VVQTTFTSETNSSITMAATDNTRTIVNSQDFANET 443

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  369 bits (948), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/418 (49%), Positives = 282/418 (67%), Gaps = 37/418 (8%)

Query: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67
           R+ QL +   V Y  T +  Y A ++S S+LQVT+KL +G N+++L +F LLN   +W+ 
Sbjct: 6   RRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127
           L  LLF  LRLIE+EHI ERLPFTIIN   +SSMF+ER    +++ +G++L+++KV HW+
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHER-YFFTVAFFGLLLLYLKVFHWI 124

Query: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG--AST 185
           LKDRLE+LLQS+ND++++++LI S RF  NL L AV+D+Q++++C+++   N      ST
Sbjct: 125 LKDRLEALLQSINDSTTMKNLILS-RFSFNLVLLAVVDFQILIRCISSIYTNQNIDIIST 183

Query: 186 SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDR----------------NLNIXX 229
           S++L+  +EFTMLL+DL+NLFL TCLN +EF++S + +                      
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEEAH 243

Query: 230 XXXXXXXXXXXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVI 289
                       F  LEGKFMYEKAID+FTRFLKT LHL M IPFRM ++LLKDV+WDV+
Sbjct: 244 AVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWDVL 303

Query: 290 TLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDND--MCIVCMDSLINIDFNSXXXXX 347
            LYQS  SLWK WRN+KQLD+ L TV+ E+L++S N+  +CI+CMD L++          
Sbjct: 304 ALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMH---------- 353

Query: 348 XXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNIL 405
                 Q      +  +KPK+LPC HILHL CLKNWMERSQTCPICRLSVFD  GN++
Sbjct: 354 -----SQADQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVV 406

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  367 bits (941), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 231/599 (38%), Positives = 332/599 (55%), Gaps = 85/599 (14%)

Query: 4   LSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAF 63
           +S  R+ Q  + +   Y++ I+  Y ++ SS ++LQ TIKL +G+N+IIL  F LLN   
Sbjct: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62

Query: 64  IWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKV 123
           +WK L  LLF  LRLIEYEH+ ERL FTI+N   +SSMF E+D  +++  +  +LIF+KV
Sbjct: 63  LWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDF-LTVLVFTAVLIFLKV 121

Query: 124 AHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGA 183
            HW+LKDRLE + Q+ N+N++++ ++FS RF  NL   A +DYQM+  C++NSI N    
Sbjct: 122 FHWILKDRLEFVFQNANENTNLKKMLFS-RFNFNLLFLASVDYQMVRYCLSNSISNDQWT 180

Query: 184 STSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXXXFN 243
           S+S++L+ G++F MLLVD +++ LH  +N  E ++ ++  N                 F 
Sbjct: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYR-LQSHN-----------SHYDEEFL 228

Query: 244 ELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWR 303
            LEGKFMYEK ID+  R LK LLH+ + IPFRM I+++KD+IWD I+LYQ+  SLWKTW+
Sbjct: 229 GLEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLWKTWK 288

Query: 304 NSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSK 363
           N+K+LDEKLP V+ EEL    N+MCIVCMD ++    NS           +  NA +   
Sbjct: 289 NAKKLDEKLPDVTEEELNQG-NNMCIVCMDDMLP---NS-----------ETRNANL--- 330

Query: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTAT 423
            KPKKLPC HILHL CLK+WMERSQTCPICRL VFD  GN+                   
Sbjct: 331 -KPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNV------------------- 370

Query: 424 NSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVXXXXXXXXXXXXX 483
                        T MD+  SSQ Q+          N +    + +V             
Sbjct: 371 -------------TRMDS--SSQEQQLPH-------NLQRQEAEGEVVQMTTSPFHTTSA 408

Query: 484 XXIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVN--KESISFELTDLKNPDQTILT 541
              P S  P+Q  N      +       W +F I++    K+ + F+L D  N +  I  
Sbjct: 409 SVGPTSTTPTQ-ANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNE--ITA 465

Query: 542 KLIIKEKPILKDSKNI---KQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKI 597
            L+ K +P  +    +   +++ I    I    E   I+SL  KI+E+E KL  ++ ++
Sbjct: 466 NLLTKTRPQFQKVTEVSGGQRITIPQSCIEQKEE---IESLKRKISEMENKLDALTKRV 521

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  367 bits (943), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 284/425 (66%), Gaps = 42/425 (9%)

Query: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67
           R+ QL     V Y  T +  Y A ++S S+LQVT+KL +G N+++L +F LLN   +W+ 
Sbjct: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127
           L  LLF  LRLIE+EHI ERLPFTIIN   +SSMF+ER    +++ +G++L+++KV HW+
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHER-YFFTVAFFGLLLLYLKVFHWI 124

Query: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTN--SIKNSMGAST 185
           +KDRLE+LLQS+ND++++++LIFS RF  NL L A+ DYQ++ +C+++  + KN    ST
Sbjct: 125 IKDRLEALLQSINDSTTLKTLIFS-RFSFNLALLALTDYQIITRCISSIYTNKNIDVVST 183

Query: 186 SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS---------------IEDRN----LN 226
           S++L+  +EFTMLL+DL+NLFL T LN +EF+ S               +ED N      
Sbjct: 184 SLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDSGE 243

Query: 227 IXXXXXXXXXXXXXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIW 286
                          F  LEGKFMYEKAID+FTRFLKT LHL M IPFRM ++LLKDV+W
Sbjct: 244 PHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVW 303

Query: 287 DVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDND--MCIVCMDSLINIDFNSXX 344
           DV+ LYQS  +LWK WRN+KQLD+ L TV++E++++S N+  +CI+CMD LI+       
Sbjct: 304 DVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIH------- 356

Query: 345 XXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
                        A  +  +KPK+LPC HILHL CLKNWMERSQTCPICRL VFD  GN+
Sbjct: 357 --------SANQQAWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 408

Query: 405 L--PF 407
           +  PF
Sbjct: 409 VQTPF 413

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  360 bits (925), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/468 (41%), Positives = 289/468 (61%), Gaps = 46/468 (9%)

Query: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66
           +RK QL + + +IY  TI   + + +SS ++LQ TIKLT+G+NV+IL +F  LN+  +W+
Sbjct: 5   SRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLWE 64

Query: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126
            L ++LF  LRLIE+EHI ERLPFTIIN   + S+FNE     ++  + +IL  +KV HW
Sbjct: 65  FLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALV-FALILSVLKVFHW 123

Query: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGAST- 185
           +LKDRLESLLQS+ND + +++LIFS R+ LNL +F+V+D+ +     +N+ +   G    
Sbjct: 124 ILKDRLESLLQSINDATDLKNLIFS-RYMLNLAIFSVLDFWI----CSNTYRAFRGYDNN 178

Query: 186 --------------------------SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFH-- 217
                                     ++ LL G+EF +L +DL+NL +HT LN YEF+  
Sbjct: 179 NSTNNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCS 238

Query: 218 -KSIEDRNLNIXXXXXXXXXXXX----XXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFI 272
            ++    N+N                   FN LEGKFMYEK ID+ T+F KT++H+ + I
Sbjct: 239 QRATAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLI 298

Query: 273 PFRMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCM 332
             +++I++LKDV+WD +TLYQ ++SLWK ++N+KQLD+KLPT+S+ ++++ ++++CIVCM
Sbjct: 299 QTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCM 358

Query: 333 DSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPI 392
           D L+                 Q    +I   ++PKKLPC H+LHL CLKNWMERSQTCPI
Sbjct: 359 DDLV-----PSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413

Query: 393 CRLSVFDSNGNILPF-NNTRSDTMRNTELTATNSNDAADESTENDTEM 439
           CRL VFD NGN+ PF + T ++ M+        S  A +  T+  T M
Sbjct: 414 CRLPVFDENGNVKPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPM 461

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  333 bits (854), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/604 (35%), Positives = 319/604 (52%), Gaps = 104/604 (17%)

Query: 3   SLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVA 62
           +L V R+ Q    T   YT+  +     +Q S S+L   +KL +GLN+++L  F ++N  
Sbjct: 2   ALRVQRR-QFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60

Query: 63  FIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMK 122
            +WKGL  LLF  LRL+EYEHI ERL FTI+N   +SS F E   +  +  + + L F++
Sbjct: 61  LLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFAL-LTFIR 119

Query: 123 VAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG 182
           V HWVLKDRLE + Q  ++ ++I  L+ S RFFLN+ +FAV+DYQM+  C+ NS+ N   
Sbjct: 120 VFHWVLKDRLEYVFQHTDERTNIARLLCS-RFFLNVIIFAVVDYQMVRFCLRNSLTNKHD 178

Query: 183 ASTS--IHLLLGVEFTMLLVDLVNLFLHTCLNLYEF--HKSIEDRNLNIXXXXXXXXXXX 238
            S S  +++L  V+F+MLLVD+  + + + +NL E    K   +R+ +            
Sbjct: 179 PSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGD------------ 226

Query: 239 XXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSL 298
              F  L+GKFMYEK + +  + LK  L +    PF M +++ KD+IWD I L+ +  S+
Sbjct: 227 --DFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSV 284

Query: 299 WKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNA 358
           W+TW++++Q+DEKLP V+  +L +S++ MCIVCM+ ++                    + 
Sbjct: 285 WRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPP------------------SE 326

Query: 359 AIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI-LPFNNTRSDTMRN 417
           A  +K KPKKLPC H LHLGCLK+WMERSQTCPICR+SVFDS GN+ LP  N     +  
Sbjct: 327 ATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISE 386

Query: 418 TELTATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVXXXXXXX 477
               A     AA+ES  N T     L+S    S+G   + + NF +              
Sbjct: 387 DASVAQQPLSAANES--NSTS----LASTHTGSLGAVSSSNPNFPT-------------- 426

Query: 478 XXXXXXXXIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIK-SVNKESISFELTDLKNPD 536
                                             W +F +  S N  ++ F++ D+   +
Sbjct: 427 ----------------------------------WYTFPVTLSDNDGAVDFKVRDINGVE 452

Query: 537 QTILTKLIIKEKPILKDSKNIKQ----VVIKDEDIWMATEPKTIKSLNDKINELERKLKD 592
             I  KLIIK++P     K   Q    VVI D     AT+ + I+ L  +I+ELE K+ +
Sbjct: 453 --INAKLIIKKRPGFDVPKEQDQESQRVVINDPP---ATQYQDIERLKRRISELENKVDE 507

Query: 593 ISSK 596
           ++ K
Sbjct: 508 LTKK 511

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  330 bits (847), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/430 (43%), Positives = 265/430 (61%), Gaps = 57/430 (13%)

Query: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66
           TR+ QL   T +IY  TI     +   S+S+L +++KL +G NV+I+ +F LLN   +WK
Sbjct: 4   TRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLWK 63

Query: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126
            L +LLF  LRLIE EHI+ERLPFTIINF  +S+MFNE+  I +++ YG IL++MK+ +W
Sbjct: 64  FLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFI-TMAFYGFILLYMKIFYW 122

Query: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVT------------ 174
           +LKDRLE L+QS N N S+   IFS +F+LNL + + I+ Q++  C+             
Sbjct: 123 ILKDRLEFLIQS-NTNYSVSRFIFS-KFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 175 -----NSIKNSMGASTS-----------IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHK 218
                 S+ N    S++           I+L+L +EF +LL++ +NLFLH+ L+LYE +K
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 219 SIEDRNLN----IXXXXXXXXXXXXXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPF 274
           S +   LN                   FN LE KF+YEK ID+FTR L T++H+ + +P 
Sbjct: 241 SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300

Query: 275 RMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDS 334
            + +++LKD+IWD+I+LYQ+   L++  +N+K LD KLP +  E+L+ SDN +CIVCMD 
Sbjct: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDN-VCIVCMDD 359

Query: 335 LINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICR 394
           L++ +                     H K+K K+LPC H LHL CLKNWMERSQTCPICR
Sbjct: 360 LLSEE---------------------HKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398

Query: 395 LSVFDSNGNI 404
           L VFD +GN+
Sbjct: 399 LPVFDESGNV 408

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/434 (38%), Positives = 251/434 (57%), Gaps = 40/434 (9%)

Query: 8   RKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKG 67
           ++ Q A   F  Y +  +     +Q S S+L+++ +L +GLN+I+L  F  +N   +WK 
Sbjct: 6   QRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGVLLWKA 65

Query: 68  LMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWV 127
           L +LLF  LRL+EYEHI ERL FTI+N   +SS F+E +  MS+ ++   LIF+KV HWV
Sbjct: 66  LTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEF-MSVMAFSAALIFVKVFHWV 124

Query: 128 LKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTN----SIKNSMGA 183
           L+DRLE + Q  +++++   L+ S RFF N+ L   +D+QM   C+      S      +
Sbjct: 125 LRDRLEHVFQHTDEHTNFARLLLS-RFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGFYSS 183

Query: 184 STSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXXXFN 243
           S S+HL+  VEF MLLVD+  + + + +NL E ++                       + 
Sbjct: 184 SLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQC------------KRSFARDGEDYT 231

Query: 244 ELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWR 303
            LEGKFMYEK + +  +  +  LH+++ +PF M +++ KD++WD   ++ +  SL  TW+
Sbjct: 232 GLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWK 291

Query: 304 NSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSK 363
           +++Q+DEKLP VS  +L +SD+ MCIVCMD ++                    +   ++K
Sbjct: 292 SNRQIDEKLPDVSEAQLAASDDKMCIVCMDDMLAP------------------SECTNAK 333

Query: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTAT 423
           QKPK+LPC H LHLGCLK+WMERSQTCPICR+ VFD  GN++      SD   N   T++
Sbjct: 334 QKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVV----VTSDQTNNQPGTSS 389

Query: 424 NSNDAADESTENDT 437
                ADE++   T
Sbjct: 390 AVESTADETSTAAT 403

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  317 bits (812), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/452 (38%), Positives = 274/452 (60%), Gaps = 57/452 (12%)

Query: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66
           ++K+Q  + +  +Y  T F    A  SS+S+L + +KL +G N++I+ +F LLN    WK
Sbjct: 10  SKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSWK 69

Query: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126
            + + LF+ LRLIE EHI+ERLPFT+INF ++++MFNER    +++ YG++LI ++V HW
Sbjct: 70  LITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNER-FFFTLTIYGLLLISLRVYHW 128

Query: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVT------------ 174
           +LKDRLE ++Q++ND++S+  +IFS +F  NL   ++I+ +++  C+T            
Sbjct: 129 ILKDRLEFIIQTINDSTSMTKIIFS-KFSFNLISLSLINLKLIQNCLTWDDINFWKNNQN 187

Query: 175 --NSIKNSM--------------GASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHK 218
             NSI N +                S  ++L+LG+EF++LL++  N+  H+ L+L+EF+K
Sbjct: 188 LFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYK 247

Query: 219 SI-------------------------EDRNLNIXXXXXXXXXXXXXXFNELEGKFMYEK 253
           S                           + N+ +              FN LEGKF+YEK
Sbjct: 248 SKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEK 307

Query: 254 AIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLP 313
            ID+FTRFL T++H+ + +P  + ++L+KD++WD  +LY++ +SL+K W+N+++L+  LP
Sbjct: 308 IIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALP 367

Query: 314 TVSLEELKSSDNDMCIVCMDSLI-NIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCC 372
            ++ ++L+ SDN +CI+CMD L+ +++                +   I  K+KPKKLPC 
Sbjct: 368 NMTPDDLQHSDN-VCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCG 426

Query: 373 HILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           H LH  CLKNWMERSQTCPICRL VFD NGN+
Sbjct: 427 HFLHFSCLKNWMERSQTCPICRLDVFDKNGNV 458

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  314 bits (804), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 167/431 (38%), Positives = 249/431 (57%), Gaps = 34/431 (7%)

Query: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66
           +RK Q AL+  VIY  T F    A  +S ++L+ T  LT+G+N +I+  F LLN+  +WK
Sbjct: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67

Query: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126
           G  Y++F  LRLIE EHI ER+P T+IN  ++SS+ +++  +  I   G +L+ +KV+HW
Sbjct: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDK-YMFDIVLLGGLLLVLKVSHW 126

Query: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKN--SMGAS 184
           +L+DRLE  LQ +ND +++ SL+FS +F  NL +F ++DY +   C  N   N    G  
Sbjct: 127 ILRDRLEGFLQRINDTTTLTSLLFS-KFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDF 185

Query: 185 TSI-HLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS-IEDRNLNIXXX----XXXXXXXX 238
           ++I  ++ G+E+ ++ +DL+N+  HT LN Y FH++ ++    N+               
Sbjct: 186 SNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSG 245

Query: 239 XXXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSL 298
                 LEGKF+YEK ID     L+T LH  M IP R + +L+KD +WD+  L  +  SL
Sbjct: 246 VNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSL 305

Query: 299 WKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNA 358
           WK ++N++QL++KLP +++E+L   DN MCIVCMD L+ +   +              N 
Sbjct: 306 WKIYKNNRQLNKKLPNIAIEDLLDHDN-MCIVCMDDLVLVHHPTKRRQSVQEECDDEKNT 364

Query: 359 A-----------------------IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRL 395
                                   +   +KPKKLPC H+LH  CLKNWMERSQTCPICR+
Sbjct: 365 EKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRV 424

Query: 396 SVFDSNGNILP 406
            VFD +GN+ P
Sbjct: 425 PVFDKDGNVRP 435

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  308 bits (788), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 180/430 (41%), Positives = 257/430 (59%), Gaps = 48/430 (11%)

Query: 4   LSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAF 63
           L+   K +  + T + Y  TI+    A QSS S+LQ+ +KL++G N++I+ +F LLN   
Sbjct: 2   LTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTL 61

Query: 64  IWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKV 123
           +W+ L  +LF  LR+IE+EHI ERLPF +IN   + S FNE+    ++++  ++L++MKV
Sbjct: 62  LWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEK-YFFTLATCALVLLYMKV 120

Query: 124 AHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCV---------- 173
            HW+L+DRL+ LLQ +N+++  + L+  NR+  NL L  VID  ++  CV          
Sbjct: 121 FHWILRDRLDLLLQGINEDTRWKDLLV-NRYICNLLLLVVIDSYVISFCVSTAYNIASSI 179

Query: 174 ----TNSIKNSMGASTS----IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNL 225
               TNSI    G+  +    I+++  +EFT L++DLVNL L+T L  YEFH S +    
Sbjct: 180 FTAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQN 239

Query: 226 NIXXXXXXXXXXXX------XXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIV 279
           N                     FN LEGKFMYEK ID+ TRFL+TL+H++M +   + ++
Sbjct: 240 NPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLM 299

Query: 280 LLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDN--DMCIVCMDSLIN 337
           L+KD+  DV  LY ++ SL   W+NSKQLD KLPT++ ++L +  N  ++CIVCMD L++
Sbjct: 300 LVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVS 359

Query: 338 IDFNSXXXXXXXXXXXQIYNAAIHSK--QKPKKLPCCHILHLGCLKNWMERSQTCPICRL 395
                              N   H    +KPKKLPC H+LHL CLKNWMERSQTCPICRL
Sbjct: 360 ------------------ENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRL 401

Query: 396 SVFDSNGNIL 405
            VFD NG IL
Sbjct: 402 PVFDENGEIL 411

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  218 bits (555), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 140/461 (30%), Positives = 228/461 (49%), Gaps = 45/461 (9%)

Query: 20  YTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKGLMYLLFSSLRLI 79
           YT+  +  +  + +S SYL    K+T+G++ +I     LLN   I KG++++LF  LRLI
Sbjct: 34  YTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIHMLFGQLRLI 93

Query: 80  EYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWVLKDRLESLLQSM 139
           EYEHILER+ +T+I   L  S  N    +M I  + ++ +  +  HW+LKDR+E   Q+ 
Sbjct: 94  EYEHILERISYTVITLLLSCSSMNGLISVMQI--HCVLFVCCRTLHWILKDRMEVTFQAN 151

Query: 140 NDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGASTSIHLLLGVEFTMLL 199
           +   +++ ++ S RF  NL +   +D  +++    N I        +  L +  ++ +L 
Sbjct: 152 DMRLTLKDILLS-RFMFNLLVLTAVD-GIIVAYYVNKILYKSNIDVTYTLFIISQYAILG 209

Query: 200 VDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXXXFNE--------------- 244
            DL+ + L T LNL+E   +I++R   I                E               
Sbjct: 210 TDLLQVILRTGLNLFEL-STIQNR-ARIRRNADHHVDEPVINHEERPNAVAIEEDEDEDE 267

Query: 245 ----LEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWK 300
               LEGKF+YEK ID+F   +K ++       F    V++  V+W+ IT ++S   LWK
Sbjct: 268 ENAGLEGKFIYEKLIDVFISTVKVIIKFAS--SFSTGRVMMVTVLWEAITTFKSARGLWK 325

Query: 301 TWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAI 360
            W++SK LD  L   +  +++S + D+CIVCM+     DF                    
Sbjct: 326 NWKSSKSLDASLMDATDIQIESGEIDICIVCME-----DFLPSHQRKS------------ 368

Query: 361 HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTEL 420
              +K K LPC H LHL CLKNW+ RS TCPICRL +FD NGN++P+ +    T  NT  
Sbjct: 369 -DGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMPYQDHSQSTDPNTTA 427

Query: 421 TATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINF 461
              +   A + +++ +       +  +  S  ++ A+++ F
Sbjct: 428 QEISPGIAVETNSQTNINTLETTNQNITLSPDNSTAQNLAF 468

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  191 bits (485), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 204/405 (50%), Gaps = 30/405 (7%)

Query: 13  ALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVA-FIWKGLMYL 71
           A+     Y    +  Y    S    L      + G++ +I   F +++   F+W  ++ +
Sbjct: 11  AMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVW-AIIRV 69

Query: 72  LFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHWVLKDR 131
           LF  L  IEY+HI ERL   ++   L S +   R   M+     +      VAHWVL+DR
Sbjct: 70  LFGQLTAIEYDHIFERLHVVLVT--LASIVITMRKTYMAGHMTILFYTLCLVAHWVLRDR 127

Query: 132 LESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGASTSIHLLL 191
           ++ + Q    +SS+  ++ S RF  +L +  ++DY+M+  CV N+  N  G    ++L+L
Sbjct: 128 MDFVFQVHGTDSSLLGILCS-RFMFSLLVLGMVDYKMLKFCVQNT--NVDGKRHELYLML 184

Query: 192 GVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIXXXXXXXXXXXXXXFNELEGKFMY 251
            + F  L++D++++ L T LNL+E  +S   R+ N+                 LEGK++Y
Sbjct: 185 ALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFILEGKYIY 244

Query: 252 EKAIDIFTRFLKTLLHLL--MFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLD 309
           E   D+    LK +L ++  +F+P+ + +V    +    I   +S + ++  W+N+K+L 
Sbjct: 245 ETVFDLTITVLKVILDIIQEVFVPWSITVVY--SIFVRSIKAGESFLLVYNYWKNNKKLY 302

Query: 310 EKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKL 369
           EKL  VS E+L  +D+ MCI+CMD ++                           ++ K L
Sbjct: 303 EKLSDVSEEQLDDTDS-MCIICMDDMLPT------------------TETTKMNRRAKML 343

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDT 414
           PC H+LH GCLK+WMERSQTCPICRLSVF ++ N       R  T
Sbjct: 344 PCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAREQT 388

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  153 bits (387), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 199/402 (49%), Gaps = 42/402 (10%)

Query: 18  VIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKGLMYLLFSSLR 77
           V Y    +  Y    +S S+LQ   K T G+++II   F L++       ++ +LF  L 
Sbjct: 16  VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFGRLT 75

Query: 78  LIEYEHILERLPFTIIN-FCLLSSMFNERDIIMSISSYGMILIFMKVAHWVLKDRLESLL 136
           L+EYEHI ERL  T+++   +L +M  +   I  I+    +L   +V HWV++DR+E + 
Sbjct: 76  LLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLC--QVLHWVVRDRMEFVF 133

Query: 137 QS-MNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNS----------IKNSMGAST 185
              +    +++ L+FS RF L++ +  V+D+++MM                + +  G +T
Sbjct: 134 APPIGTRMAMKDLLFS-RFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNT 192

Query: 186 S---IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS---IEDRNLNIXXXXXXXXXXXX 239
           S   + L LGV+F +L +D + + L  CL   E  K+   +++  L +            
Sbjct: 193 SEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQL-LDNNELENDIEDD 251

Query: 240 XXFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLW 299
             F  LE KF+YEK ++     LK LL++ +        V+  ++    I   +  V L+
Sbjct: 252 GAFI-LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLF 310

Query: 300 KTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAA 359
             W+N+++L EKL  V+   L   D   C +CMD ++                    +  
Sbjct: 311 NYWKNNRRLHEKLLDVTAGHLDGVD-ITCTICMDDMLPSK-----------------DVK 352

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSN 401
           +++K K K LPC H+LH GCLK+WM+R+QTCPICR  VF S+
Sbjct: 353 VNNK-KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSS 393

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P KLPC HI    C++ W     TCPICR  +  ++G
Sbjct: 223 KHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P +LPC H+    C++ W     TCPICR ++  ++G
Sbjct: 219 KHSPVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 53/139 (38%), Gaps = 21/139 (15%)

Query: 256 DIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTV 315
           DI  RF   LL L M   F++ I+  +D++     L Q  +       +       +P  
Sbjct: 634 DIDVRF-AVLLSLWML--FQLLILYSQDLLGSRWFLPQHVIP------DGYHYHRPVPQS 684

Query: 316 SLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHIL 375
            L E  S +N  C VC   ++++               Q Y             PC HI 
Sbjct: 685 ILMEYGSQNN--CFVCPICMVDVPVYVEETEETHKIDAQSYMIT----------PCSHIF 732

Query: 376 HLGCLKNWMERSQTCPICR 394
           H  CL+NWM     CP+CR
Sbjct: 733 HTECLENWMSYKLQCPVCR 751

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H GCL+NWM     CP+CR
Sbjct: 723 PCSHLFHTGCLENWMSYKLQCPVCR 747

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 727 PCNHIFHTACLENWMGYKLQCPVCR 751

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 735 PCAHIFHTQCLENWMSYKLQCPVCR 759

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 731 PCNHIFHTSCLENWMSYKLQCPVCR 755

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 720 PCNHIFHTTCLENWMSYKLQCPVCR 744

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSV 397
           PC HI H  CL+NWM     CP+CR S+
Sbjct: 732 PCNHIFHTECLENWMGYKLQCPVCRSSL 759

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 732 PCGHVFHTQCLENWMSYKLQCPVCR 756

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 728 PCNHVFHTSCLENWMSYKLQCPVCR 752

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 728 PCNHVFHTSCLENWMNYKLQCPVCR 752

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 728 PCAHVFHTECLENWMSYKLQCPVCR 752

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 728 PCDHVFHTSCLENWMSYKLQCPVCR 752

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 729 PCNHVFHTPCLENWMSYKLQCPVCR 753

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P KLPC HI    C+  W +   +CP+CR  + +S G
Sbjct: 248 KHSPIKLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 732 PCNHIFHTECLENWMSYKLQCPVCR 756

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL+NWM     CP+CR
Sbjct: 731 PCDHIFHTDCLENWMGYKLQCPVCR 755

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P +LPC HI    C+  W +   +CPICR  + +  G
Sbjct: 273 KHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL+NWM     CP+CR
Sbjct: 724 PCNHVFHTQCLENWMGYKLQCPVCR 748

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL++WM     CP+CR
Sbjct: 720 PCSHIFHTQCLESWMSYKLQCPVCR 744

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 45/122 (36%), Gaps = 32/122 (26%)

Query: 305 SKQLDEKLPTVSLEELKSSDNDM-CIVCMDSLINIDFNSXXXXXXXXXXXQIYNA----- 358
           SK+  EKLP ++L++LK + +D+ C +C +  +     +           +  NA     
Sbjct: 137 SKEQFEKLPVLTLDDLKKNGSDLQCSICFEPYVADATTTKKRSLSGTDSEEPGNAKKRKI 196

Query: 359 ------------------------AIHS--KQKPKKLPCCHILHLGCLKNWMERSQTCPI 392
                                     H      P KLPC HI    CL  W +   TCP+
Sbjct: 197 DATTASTPTSNEPEPTTTVEDNDEEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPL 256

Query: 393 CR 394
           CR
Sbjct: 257 CR 258

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL++WM     CP+CR
Sbjct: 717 PCSHIFHTQCLESWMSYKLQCPVCR 741

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGN 403
             P KLPC HI    CL  W +   TCP+CR  + ++N N
Sbjct: 297 HSPLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQN 336

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P +LPC H+    CL  W     +CP+CR  + +S G
Sbjct: 267 KHSPIRLPCGHVFGRECLYKWSRLENSCPLCRHKISESAG 306

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC HI H  CL++WM     CP+CR
Sbjct: 721 PCGHIFHTQCLESWMSYKLQCPVCR 745

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P KLPC HI    C+  W     +CP+CR  + ++ G
Sbjct: 259 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG 298

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P KLPC HI    C+  W     +CP+CR  + +S G
Sbjct: 249 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG 288

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILP 406
           +HS   P +LPC HI    CL  W     TCP+CR  + +S  N  P
Sbjct: 273 LHS---PTELPCKHIFGRECLYKWTRVQNTCPLCRHIIAESPVNAPP 316

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICR 394
           + P +LPC HI    CL  W     TCP+CR
Sbjct: 257 ESPVELPCHHIFGRECLYKWTRHENTCPLCR 287

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVF 398
           +PC H  H  CL  W  ++  CP+CRLS F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDS 400
           +HS   P KLPC HI    CL  W +   +CP+CR  + +S
Sbjct: 238 LHS---PVKLPCDHIFGRECLYKWSKLENSCPLCRHKIIES 275

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICR 394
           +HS   P K+PC HI    CL  W     +CP+CR
Sbjct: 287 LHS---PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICR 394
           PC H+ H  CL++WM     CP+CR
Sbjct: 727 PCDHMFHTSCLESWMSYKLQCPVCR 751

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 37.7 bits (86), Expect = 0.012,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           +LP C H   L C+  W+ +S+TCP+CR  V     N+
Sbjct: 52  ELPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 38.9 bits (89), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 26/87 (29%)

Query: 312 LPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPC 371
           LP ++ ++LK++DN  C +C  + +  ++                           +LP 
Sbjct: 95  LPRINKKKLKATDN--CSICYTNYLEDEYPLVV-----------------------ELPH 129

Query: 372 CH-ILHLGCLKNWMERSQTCPICRLSV 397
           CH    L CL  W+ RS TCP+CR +V
Sbjct: 130 CHHKFDLECLSVWLSRSTTCPLCRDNV 156

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSV 397
           +HS   P KLPC HI    C+  W     +CP+CR ++
Sbjct: 332 LHS---PTKLPCGHIFGRDCIFKWSHLENSCPLCRKAI 366

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P +L C H+    C+  W + + +CPICR ++    G
Sbjct: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 38.1 bits (87), Expect = 0.019,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVF 398
           +LP C H   L C+  W+ RS TCP+CR  V 
Sbjct: 107 ELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVL 138

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 18/106 (16%)

Query: 354  QIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSD 413
            QIY  +I        + C H     C+++W++   +CP+C+     S   I  F     D
Sbjct: 1232 QIYTGSI--------IKCGHFFCKKCIQSWLKNKNSCPLCKTETGLS--EIYNFKFKEED 1281

Query: 414  TMRNTELTATNSNDAADESTENDT----EM----DALLSSQVQESV 451
            T  ++  +   S + +DE  END     EM    D L++S+  +S+
Sbjct: 1282 TEYSSYGSQPKSKEISDECYENDRITDDEMVKKEDELMNSRDSDSI 1327

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 37/93 (39%), Gaps = 26/93 (27%)

Query: 322 SSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKK----------LPC 371
           ++D++ C +C++ L   ++++                 + +K  P            +PC
Sbjct: 135 ANDDETCCICLELLKTQEYDTITTQD---------GMRVKTKGGPPTKSIKDTDIVMIPC 185

Query: 372 CHILHLGCLKNWM-------ERSQTCPICRLSV 397
            H  H GCLK W         R   CP+CR+ +
Sbjct: 186 QHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDI 218

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 360 IHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFD 399
           +HS   P +LPC HI    CL  W +   +CP+CR  + +
Sbjct: 295 LHS---PVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVE 331

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 37.4 bits (85), Expect = 0.028,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 368 KLPCCH-ILHLGCLKNWMERSQTCPICR 394
           +LP CH    L CL  W+ RS TCP+CR
Sbjct: 96  ELPHCHHKFDLECLSVWLSRSTTCPLCR 123

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVF 398
           LPC H+    CL  W     +CPICR  + 
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPIL 246

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 37.4 bits (85), Expect = 0.034,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVF 398
           KLP C H   L C+  W+ +S+TCP+CR  V 
Sbjct: 100 KLPHCSHRFDLECVAVWLSKSRTCPLCRDDVL 131

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVF 398
           +PC H  H  CL  W  ++  CP+CR S F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 37.4 bits (85), Expect = 0.044,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 26/84 (30%)

Query: 312 LPTVSLEELKSSDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLP- 370
           LP ++ ++L S+DN  C +C  + +  ++                           +LP 
Sbjct: 93  LPRINRKKLNSTDN--CSICYTNYLEDEYPLVV-----------------------ELPH 127

Query: 371 CCHILHLGCLKNWMERSQTCPICR 394
           C H   L CL  W+ RS TCP+CR
Sbjct: 128 CNHRFDLECLSVWLSRSTTCPLCR 151

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVF 398
           +PC H  H  CL  W  ++  CPICR S  
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 45/117 (38%), Gaps = 38/117 (32%)

Query: 282 KDVIWDVITLYQSTVSLWKTWRNSKQLDEK----LPTVSLEELKSSDNDMCIVCMDSLIN 337
           K +I+D   +  + V+      N++++D K    LP +  E  K      CI+CM  +IN
Sbjct: 231 KTLIYDDNPISLNKVTTKNVKYNNEKIDLKNPKILPYIPEESRK------CILCMSFMIN 284

Query: 338 IDFNSXXXXXXXXXXXQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICR 394
                                       P   PC HI    CL NW +  + CP+CR
Sbjct: 285 ----------------------------PSCAPCGHIYCWNCLINWCKEKEECPLCR 313

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC HI    C+ NW +    CP+CR
Sbjct: 288 PSAAPCGHIFCWDCIINWCKERPECPLCR 316

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVF 398
           +PC H  H  CL  W  ++  CP+CR S F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P  LPC H+    C+ +W + +  CP+CR
Sbjct: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 9/52 (17%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICR---------LSVFDSNGNIL 405
           K  P  LPC H+    CL  W +   +CP+CR          S  DSNG + 
Sbjct: 210 KHSPVVLPCNHVFGRECLFKWSQLENSCPLCRHKIVEAAAGQSGEDSNGAVA 261

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           +LP C H   L C+  W+ +S TCP+CR SV     +I
Sbjct: 121 ELPHCGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDI 158

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSVF-DSNGNILP 406
           PC H  H  CL  W  ++  CP+CR S   D N   LP
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNNEPLP 268

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 18/40 (45%)

Query: 363 KQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           K  P +L C H     C+  W +   +CPICR  +    G
Sbjct: 239 KHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    C+ NW +  + CP+CR
Sbjct: 328 PSCPPCGHLFCWACIMNWCKEREECPLCR 356

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVFD-SNGNIL 405
           +PC H  H  CL  W  +   CP+CR S    + GN+L
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCRYSNLKLTRGNLL 289

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 368 KLPCCH-ILHLGCLKNWMERSQTCPICRLSVF 398
           +LP CH    L CL  W+ RS TCP+CR  V 
Sbjct: 131 ELPHCHHKFDLECLSVWLSRSTTCPLCRDDVM 162

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCRYS 277

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score = 35.4 bits (80), Expect = 0.18,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSND 427
           C H  H+ C+  W++ + +   CP+CR       G  L  N+++ +  +  +L    +N 
Sbjct: 64  CNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRG--LAINDSQLEKFKELQLR-KRTNT 120

Query: 428 AADESTENDTE-MDALLSSQVQESVGD 453
           A + + E+D E ++  ++ Q Q  V D
Sbjct: 121 AGEFADEDDEEAIERAMAQQDQAEVDD 147

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 368 KLPCC-HILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           KLP C H   L C+  W+ +S TCP+CR  V  S   I
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKI 144

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCRYS 276

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC HI    C+ NW +    CP+CR
Sbjct: 281 PSCAPCGHIFCWNCIINWCKERSECPLCR 309

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 369 LP-CCHILHLGCLKNWMERSQTCPICRLSVFD 399
           LP C H  H  C+K W++++  CP+CR +V +
Sbjct: 228 LPNCSHHFHFECIKLWLQKNSLCPLCRDNVME 259

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILP 406
           P  LPC H+    C+ +W      CP+CR     S  +ILP
Sbjct: 280 PSCLPCGHLFCWNCIMHWCTERSECPLCRQHC--SKQSILP 318

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 34.7 bits (78), Expect = 0.22,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           +LP C H   L CL  W  +S +CP+CR  V      +
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV 129

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCRYS 280

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 34.7 bits (78), Expect = 0.25,   Method: Composition-based stats.
 Identities = 38/160 (23%), Positives = 63/160 (39%), Gaps = 45/160 (28%)

Query: 260 RFLKTLLHLLMF----IP-FRMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQL--DEKL 312
           R L TLL + +F    +P FR    L+ D   D      S++S+ +T  ++  L  D ++
Sbjct: 25  RILGTLLLVQLFSKRLLPAFRWMKGLIAD---DQNEKATSSLSVGETTLSTAGLPTDSQV 81

Query: 313 PTVSLEELKS-----SDNDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHSKQKPK 367
             + LE+        SD+  CI+C+  +++                            P 
Sbjct: 82  EHIGLEQASEMSFIPSDSRKCILCLGFMLD----------------------------PS 113

Query: 368 KLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPF 407
             PC H+    CL +W      CP+CR +      N+LP 
Sbjct: 114 CAPCGHVFCWKCLLSWCNERPECPLCRQTCHAQ--NVLPL 151

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICR 394
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCRYS 276

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score = 35.0 bits (79), Expect = 0.30,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSND 427
           C H  H+ C+  W+E   +   CP+CR  VF+    ++  N+    T +   L      +
Sbjct: 84  CKHNFHVHCIFEWLETEASRGLCPMCR-QVFELRKGVV-INDLHYVTFKELILKRQKEQN 141

Query: 428 AADESTENDTEMDALLSSQVQESVGDTLARDI 459
             + + E+D  +  ++++Q + + GD    DI
Sbjct: 142 EFEATAEDDEALARMIAAQ-EGNNGDVPVDDI 172

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 34.7 bits (78), Expect = 0.31,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICR 394
           +LP C HI  L C+  W+    TCP+CR
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  +   CP+CR S
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCRYS 289

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    CL NW +    CP+CR
Sbjct: 289 PSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 2/28 (7%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLS 396
           +PC H  H  CL  W      CP+CR S
Sbjct: 285 IPCQHTFHCSCLDKW--NDSRCPVCRYS 310

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 370 PCCHILHLGCLKNWMERSQ--TCPICRLSVFDSNGNILP 406
           PC H  H+ C++ W   S    CP CR+     + NI P
Sbjct: 35  PCNHKYHIDCIRTWHNYSNDLNCPTCRIETNQLSVNIYP 73

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 2/46 (4%)

Query: 369 LPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDT 414
           +PC H  H  CL  W +    CP+CR S      + L     R  T
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCRYSGLKLTKSSLARQGARCST 287

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 2/42 (4%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPF 407
           P   PC HI    CL +W +    CP+CR         ILP 
Sbjct: 300 PSCSPCGHIFCWRCLMDWCQERAECPLCRQPCLPQ--QILPL 339

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    C+  W    Q CP+CR
Sbjct: 265 PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P  LPC H+    C+  W      CP+CR
Sbjct: 276 PSCLPCGHMFCWACVMQWCNERNECPLCR 304

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 8/47 (17%)

Query: 366 PKKLPCCHILHLGCLKNWME---RSQTCPICRLSV-----FDSNGNI 404
            K +PC H  HL C++ W       +TCP CR+ +      D N NI
Sbjct: 21  AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEIRELIDMDHNVNI 67

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 33.1 bits (74), Expect = 0.76,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSND 427
           C H  H+ C++ W+E +     CP+CR       G  +  N  + D++    L    S  
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRG--VAINECQMDSLAKLLL---QSQP 116

Query: 428 AADESTENDTEMD 440
           AA  + + D  MD
Sbjct: 117 AALTTEDQDMMMD 129

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    C+ NW      CP+CR
Sbjct: 287 PSCAPCGHLYCWDCILNWCNEKPECPLCR 315

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 3/29 (10%)

Query: 369 LPCCHILHLGCLKNWME---RSQTCPICR 394
           +PC H  HL C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score = 33.5 bits (75), Expect = 0.93,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELT-ATNSN 426
           C H  H+ C+  W++ + +   CP+CR       G  +  N ++ D  ++ EL  A    
Sbjct: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEG--VALNKSQEDVFKSLELKQARQRF 135

Query: 427 DAADESTEND 436
            A DE  + D
Sbjct: 136 GAFDEDVDVD 145

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWNCLMSWCKERPECPLCR 324

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQ----TCPICRLSV 397
           P   PC H    GCL +W   S     +CP CR S+
Sbjct: 40  PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSI 75

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDA 428
            + C H     C+  W+     CPIC+     S      F NT     + T+ +  + +D+
Sbjct: 1256 IKCGHYFCKSCILTWLRSHSKCPICKSFCRTSEVYNFKFKNTNEKKEKETQESQMDGSDS 1315

Query: 429  ADESTENDTEMDALLSSQVQESVGD 453
            +  +T   + +  +  S+V++  G+
Sbjct: 1316 SQGATSGSSTISNV--SEVEKLFGN 1338

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 366 PKKLPCCHILHLGCLKNWM---ERSQTCPICRLSV 397
           P   PC H    GCL NW+    +   CP CR ++
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCRSTI 74

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 368 KLPCC-HILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           +LP C H   L C+  W+ +S TCP+CR +V +   NI
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICR 394
            + C H     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 368 KLPCC-HILHLGCLKNWMERSQTCPICRLSVFD 399
           +LP C H   L C+  W++++ +CPICR  V +
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLE 164

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC HI    C+ +W +    CP+CR
Sbjct: 286 PSCAPCGHIFCWDCILSWCKERPECPLCR 314

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWDCLMSWCKERPECPLCR 324

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC H+    CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWDCLMSWCKERPECPLCR 324

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 371  CCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDAAD 430
            C H     C+  W++   TCP+C+ +V  S   +  F     +     EL    + +AA 
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNVTPS--EVYNFRYKEGE-----ELPEDGAEEAAQ 1231

Query: 431  ES 432
            ES
Sbjct: 1232 ES 1233

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 371  CCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDAAD 430
            C H     C+  W++   TCP+C+ +V  S   +  F     +     EL    + +AA 
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNVTPS--EVYNFRYKEGE-----ELPEDGAEEAAQ 1231

Query: 431  ES 432
            ES
Sbjct: 1232 ES 1233

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 25/111 (22%)

Query: 308 LDEKLPTVSLEELKSSD-----NDMCIVCMDSLINIDFNSXXXXXXXXXXXQIYNAAIHS 362
           +D+K+P     E+ + D     N+ CI+C++ +  +   S           +     I S
Sbjct: 124 MDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVP--STNDLEKQQNGTEQTTDMIPS 181

Query: 363 KQKPKKLPCCHILHLGCLKNWME------RSQT----------CPICRLSV 397
           K    KLPC H  H  C+K+W        +S T          CP+CRL +
Sbjct: 182 KVV--KLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRLDL 230

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSVFD 399
           +LP C H   L CL  W+ ++ TCP+CR  V +
Sbjct: 103 ELPHCSHRFDLECLTPWLLKNSTCPLCRDDVME 135

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 41/109 (37%), Gaps = 13/109 (11%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICRLSV-FDSNGNILPFNNTRSDTMRNTELTATNSND 427
            L C H     C+ +W++    CPIC+     D N N   F N    T  N ++     N+
Sbjct: 1280 LKCGHFFCEDCIYDWLQTRTICPICKHKASLDGNYN-FTFKNGPLKTDANKQMNE-KENE 1337

Query: 428  AADESTE--------NDT--EMDALLSSQVQESVGDTLARDINFRSSIG 466
               E  E        N+T  E   +L  + QE         I+ R S G
Sbjct: 1338 TKKEQPETSPDLKSTNNTFKEKKTVLGEKYQEFPDIESVNKIHLRESYG 1386

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDA 428
            L C H     C+ +W +++ +CP+C+  +  S+  +  F        R  EL   +  D 
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCKNRM--SSSEVYHFK------FREEELKEEDDTDN 1272

Query: 429  ADESTENDTEMDA 441
             ++ T++D + ++
Sbjct: 1273 PEQVTKDDDQTNS 1285

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICR 394
           K+P C H   L CL  W++ + TCP+CR
Sbjct: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 11/46 (23%)

Query: 369  LPCCHILHLGCLKNWMERS--QTCPICRLSV---------FDSNGN 403
            L C H     C+ NW+E+S  + CPIC++           FDS  N
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKIETNINDTYNFKFDSTNN 1195

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICR 394
           +LP C H     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDS 400
           P +L C HI    CL  W +   +CP+CR  + ++
Sbjct: 332 PVQLSCKHIFCRSCLYEWSKLKNSCPLCRKKIVET 366

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQT----CPICRLSV 397
           P    C H    GCLK+W   ++T    CP CR SV
Sbjct: 40  PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSV 75

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 366 PKKLPCCHILHLGCLKNWMERSQTCPICR 394
           P   PC HI    C+ +W +    CP+CR
Sbjct: 290 PSCSPCGHIFCWECILDWCKERPECPLCR 318

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 366 PKKLPCCHILHLGCLKNWM----ERSQTCPICRLSVFDSNGNILPF 407
           P    C H    GCLK+W+    ++   CP CR  + D+  N+ PF
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDT-PNLNPF 84

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSVFD 399
           PC H +H  C   + + S  CP C++SV +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICR 394
           KLP C H     CL  W+ +++TCP+CR
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 371  CCHILHLGCLKNWMERSQTCP 391
            C H+LHL C K W   S+ CP
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECP 1106

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 368 KLPCC-HILHLGCLKNWMERSQTCPICRLSVFDSNGNI 404
           +LP C H   L C+  W+ +S +CP+CR  V      I
Sbjct: 120 ELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGI 157

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 3/70 (4%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDA 428
            + C H     C+  W+     CPIC+   F S   +  F    S   R  E+      + 
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK--GFCSISEVYNFKFKNSTEKREKEIQEP-RREG 1308

Query: 429  ADESTENDTE 438
            AD S +N  E
Sbjct: 1309 ADSSQDNSNE 1318

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSVFD 399
           PC H +H  C   + + S  CP C++S+ +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 368 KLP-CCHILHLGCLKNWMERSQTCPICRLSV 397
           +LP C H   L C+  W+  + TCP+CR  V
Sbjct: 104 ELPHCSHKFDLQCISVWLSSNSTCPVCRDKV 134

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 19/42 (45%)

Query: 361 HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNG 402
           H K  P +LPC H+    C+  W +   +   C   + ++ G
Sbjct: 216 HYKHSPTELPCGHVFGRDCIFRWTQEHNSLSYCWARIVENEG 257

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 369 LPCCHILHLGCLKNWMER-SQTCPICRLS 396
           L C HI H  C+  W+ R S  CP+C+ S
Sbjct: 126 LGCSHIFHSHCIDRWICRNSACCPLCKRS 154

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 16/24 (66%)

Query: 371  CCHILHLGCLKNWMERSQTCPICR 394
            C H+    C+ +W++  +TCP+C+
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCK 1202

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 370 PCCHILHLGCLKNWMERSQTCPICRLSV 397
           PC H +H  C   +++ S  CP C +SV
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSV 417

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 16/27 (59%)

Query: 369  LPCCHILHLGCLKNWMERSQTCPICRL 395
            L C H     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,996,947
Number of extensions: 2526119
Number of successful extensions: 13590
Number of sequences better than 10.0: 243
Number of HSP's gapped: 14055
Number of HSP's successfully gapped: 252
Length of query: 605
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 490
Effective length of database: 40,294,809
Effective search space: 19744456410
Effective search space used: 19744456410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)