Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E036201.120ON1951958221e-113
TPHA0E040801.1ON1951958221e-113
Kpol_2002.21.1ON2092023244e-37
ZYRO0F18590g1.1ON2001952922e-32
ZYRO0F15840g1.120ON2001952922e-32
TDEL0C070101.1ON2051942896e-32
TBLA0A070401.120ON2011902843e-31
TBLA0A075901.1ON2011902843e-31
YCR040W (MATALPHA1)1.120ON175681752e-15
YCL066W (HMLALPHA1)1.1ON175681752e-15
Suva_3.1481.1ON175681743e-15
Smik_92.1singletonON156641708e-15
Skud_3.1191.120ON174651656e-14
Skud_71.1singletonON155611612e-13
CAGL0B01243g1.120ON143631513e-12
CAGL0B00242g1.1ON1841771534e-12
Suva_69.2singletonON145561392e-10
Ecym_10031.1ON263841142e-06
Ecym_11141.120ON263841142e-06
KNAG0C001501.1ON145168972e-04
NDAI0A001001.1ON13563860.004
KLTH0F00374g1.1ON24975860.008
Smik_3.1441.120ON5422740.039
Kwal_33.matalpha1singletonOFF244191810.042
Kwal_33.12992singletonOFF244191810.042
Kwal_YGOB_matalpha11.120ON244191810.042
Kwal_YGOB_HMalpha11.1ON244191810.042
NCAS0B091501.1ON15063760.13
KAFR0D007101.120ON17254760.14
Suva_3.140singletonON3120680.18
Smik_88.1singletonON3518670.25
Skud_80.1singletonON3218660.38
Suva_3.791.120ON3517650.46
KLLA0C00352g1.1ON26178672.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04080
         (195 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...   321   e-113
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...   321   e-113
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...   129   4e-37
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   117   2e-32
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   117   2e-32
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   115   6e-32
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...   114   3e-31
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...   114   3e-31
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    72   2e-15
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    72   2e-15
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    72   3e-15
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    70   8e-15
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    68   6e-14
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    67   2e-13
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    63   3e-12
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    64   4e-12
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        58   2e-10
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    49   2e-06
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    49   2e-06
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    42   2e-04
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    38   0.004
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    38   0.008
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    33   0.039
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    36   0.042
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    36   0.042
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    36   0.042
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    36   0.042
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      34   0.13 
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    34   0.14 
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    31   0.18 
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    30   0.25 
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    30   0.38 
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    30   0.46 
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    30   2.8  

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score =  321 bits (822), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 161/195 (82%), Positives = 161/195 (82%)

Query: 1   MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL 60
           MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL
Sbjct: 1   MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL 60

Query: 61  LRSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLF 120
           LRSIDAELRRIEIKKSIVAQDVNSLFNVELTW                   YSSEEELLF
Sbjct: 61  LRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLF 120

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KKSLNSFIAFRAYNAQF               AWHSAPEQHHVWDVFAQQFNFVKPKCGF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 181 VEWVGQTYEREWCTE 195
           VEWVGQTYEREWCTE
Sbjct: 181 VEWVGQTYEREWCTE 195

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score =  321 bits (822), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 161/195 (82%), Positives = 161/195 (82%)

Query: 1   MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL 60
           MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL
Sbjct: 1   MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPPTCL 60

Query: 61  LRSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLF 120
           LRSIDAELRRIEIKKSIVAQDVNSLFNVELTW                   YSSEEELLF
Sbjct: 61  LRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLF 120

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KKSLNSFIAFRAYNAQF               AWHSAPEQHHVWDVFAQQFNFVKPKCGF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 181 VEWVGQTYEREWCTE 195
           VEWVGQTYEREWCTE
Sbjct: 181 VEWVGQTYEREWCTE 195

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score =  129 bits (324), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 107/202 (52%), Gaps = 14/202 (6%)

Query: 6   TWSKQPLFKVSLNK------KRIRSIKIKTHKNNVQLKKQRSHQ--FIAENFKLKIPYPP 57
           +W+ QPLFKV LNK      ++ + I I    N+     Q+++   FI  +   KIP+PP
Sbjct: 7   SWTSQPLFKVKLNKSNKIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPP 66

Query: 58  TCLLRSIDAELRRIEIKKSIV-AQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSS-- 114
           + LL  ID E ++++ KK+ +  Q+  ++ N   +W                     +  
Sbjct: 67  SSLLLGIDEETKKMKSKKTSINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSV 126

Query: 115 -EEELLFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNF 173
            E +   KKSLN F+AFRAYN+QF               AWHS PEQ   W V +QQFNF
Sbjct: 127 IEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNF 186

Query: 174 VKPKCGFVEWVGQTYERE--WC 193
           VKPKCGFVEWVGQTYERE  WC
Sbjct: 187 VKPKCGFVEWVGQTYEREMMWC 208

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  117 bits (292), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 99/195 (50%), Gaps = 15/195 (7%)

Query: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKK---------QRSHQFIAENFKLKIPYPPT 58
           S QPLFKV + KK  RS K  T ++  Q  K         Q+ + F+  +  +KIP PP 
Sbjct: 11  SNQPLFKVKVEKKG-RS-KRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68

Query: 59  CLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEEL 118
            LLR I+ E  + ++KK     D   L++  + W                    S +   
Sbjct: 69  VLLRKIEEE--KHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKG-- 124

Query: 119 LFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKC 178
             +K LNSF+AFRAYN+QF               AWHS PEQ  +WD FAQQFNFVKPKC
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 179 GFVEWVGQTYEREWC 193
           GFVEWV Q YERE C
Sbjct: 185 GFVEWVDQRYERESC 199

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  117 bits (292), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 99/195 (50%), Gaps = 15/195 (7%)

Query: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKK---------QRSHQFIAENFKLKIPYPPT 58
           S QPLFKV + KK  RS K  T ++  Q  K         Q+ + F+  +  +KIP PP 
Sbjct: 11  SNQPLFKVKVEKKG-RS-KRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPE 68

Query: 59  CLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEEL 118
            LLR I+ E  + ++KK     D   L++  + W                    S +   
Sbjct: 69  VLLRKIEEE--KHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKG-- 124

Query: 119 LFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKC 178
             +K LNSF+AFRAYN+QF               AWHS PEQ  +WD FAQQFNFVKPKC
Sbjct: 125 CSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKC 184

Query: 179 GFVEWVGQTYEREWC 193
           GFVEWV Q YERE C
Sbjct: 185 GFVEWVDQRYERESC 199

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  115 bits (289), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 95/194 (48%), Gaps = 16/194 (8%)

Query: 10  QPLFKVSLNKKRIRS------------IKIKTHKNNVQLKKQRSHQFIAENFKLKIPYPP 57
           +PLFKV +NK    S            +     +N+ +L+++    F+     +KIP PP
Sbjct: 15  RPLFKVQINKDSRTSQCKAKTKFKKAKLDKCQPENSGRLEERHVKTFVVILRPIKIPLPP 74

Query: 58  TCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEE 117
             LL  I+ E R++    S  + ++ SL++  + W                     + E 
Sbjct: 75  NILLEKIEQEKRKV---YSETSPEIGSLWDSPIAWDNEDLLFSIASDVLGNIYKKPARE- 130

Query: 118 LLFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPK 177
               K LNSF+AFRAYN+QF               AWHS PEQ  +WD FAQQFNFVKPK
Sbjct: 131 TASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDTFAQQFNFVKPK 190

Query: 178 CGFVEWVGQTYERE 191
           CGFVEWV Q YERE
Sbjct: 191 CGFVEWVDQRYERE 204

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score =  114 bits (284), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 105/190 (55%), Gaps = 8/190 (4%)

Query: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQ---FIAENFKLKIPYPPTCLLRSI 64
           +K+ LFKV+L  K  ++I++KT+  +++ K   +      + +N  +KIP+PPT LL +I
Sbjct: 9   TKKALFKVNL--KLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNI 66

Query: 65  DAELRRIEIKKSIVAQ---DVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           + E ++I   + ++ +   D +  +  +L +                    S+   +  +
Sbjct: 67  EVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVNSE 126

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181
           + LN FIAFRAYN+QF               AWH  P Q +VW+ F+Q++NFVKPKCGFV
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 182 EWVGQTYERE 191
           EW+GQTYERE
Sbjct: 187 EWLGQTYERE 196

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score =  114 bits (284), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 105/190 (55%), Gaps = 8/190 (4%)

Query: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQ---FIAENFKLKIPYPPTCLLRSI 64
           +K+ LFKV+L  K  ++I++KT+  +++ K   +      + +N  +KIP+PPT LL +I
Sbjct: 9   TKKALFKVNL--KLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNI 66

Query: 65  DAELRRIEIKKSIVAQ---DVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           + E ++I   + ++ +   D +  +  +L +                    S+   +  +
Sbjct: 67  EVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNPNPVNSE 126

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181
           + LN FIAFRAYN+QF               AWH  P Q +VW+ F+Q++NFVKPKCGFV
Sbjct: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186

Query: 182 EWVGQTYERE 191
           EW+GQTYERE
Sbjct: 187 EWLGQTYERE 196

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KK LNSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 90  KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGF 149

Query: 181 VEWVGQTY 188
           VEW+   Y
Sbjct: 150 VEWLTNNY 157

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KK LNSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 90  KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGF 149

Query: 181 VEWVGQTY 188
           VEW+   Y
Sbjct: 150 VEWLTNNY 157

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KK LNSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149

Query: 181 VEWVGQTY 188
           VEW+   Y
Sbjct: 150 VEWLTNNY 157

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 70.1 bits (170), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           KK LNSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 90  KKYLNSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGF 149

Query: 181 VEWV 184
           VEW+
Sbjct: 150 VEWL 153

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 37/65 (56%)

Query: 124 LNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEW 183
           +NSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 184 VGQTY 188
           +   Y
Sbjct: 152 LTNNY 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 36/61 (59%)

Query: 124 LNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEW 183
           +NSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 184 V 184
           +
Sbjct: 152 L 152

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181
           + +N+F+AFR Y AQ                AW++     ++WD+FAQQFNF  P+CGFV
Sbjct: 73  RPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFV 132

Query: 182 EWV 184
            ++
Sbjct: 133 NYI 135

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 63.5 bits (153), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 81/177 (45%), Gaps = 13/177 (7%)

Query: 13  FKVSLNKKRIRSIKI-KTHKNNVQLKKQRS----HQFIAENFKLKIPYPPTCLLRSIDAE 67
           F+V  NK R+RS K  + H + +     +S    +  + +  K +IP P   LL+ I  E
Sbjct: 8   FRVRTNK-RLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLLKRIREE 66

Query: 68  LRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFKKSLNSF 127
             R+++  S     +N + ++E +W                     S  +   K+ +N+F
Sbjct: 67  --RMKLTSSF-ESGIN-IIDIETSWEIDKFISHHFNTSIGNVLKSKSSSK---KRPMNAF 119

Query: 128 IAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEWV 184
           +AFR Y AQ                AW++     ++WD+FAQQFNF  P+CGFV ++
Sbjct: 120 MAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 176

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKP 176
           KK LNSF+AFRAY +QF                WH+   QH +WD FAQQ+NF+ P
Sbjct: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINP 145

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 112 YSSEEELLFK-KSLNSFIAFRAYNAQF-XXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQ 169
           YS E ++  K K +N F+AFR+Y ++F                 WH  P+    W++FA+
Sbjct: 100 YSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAE 159

Query: 170 QFNFVKPKCGFVEWVGQTYEREWC 193
            +N  +P   F EW+ +TY   + 
Sbjct: 160 HYNMEQPDQSFPEWLEKTYTSSYT 183

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 112 YSSEEELLFK-KSLNSFIAFRAYNAQF-XXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQ 169
           YS E ++  K K +N F+AFR+Y ++F                 WH  P+    W++FA+
Sbjct: 100 YSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAE 159

Query: 170 QFNFVKPKCGFVEWVGQTYEREWC 193
            +N  +P   F EW+ +TY   + 
Sbjct: 160 HYNMEQPDQSFPEWLEKTYTSSYT 183

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 33/168 (19%)

Query: 7   WSKQPLFKVSLNKKRI--RSIKIKTHKNNVQLKKQRSHQFIAENFKLKIP-YPPTCLLRS 63
           +SK+PLFK+++ +     +SI+ +T + N+       + F + N     P  P   ++R+
Sbjct: 2   FSKKPLFKMNITQSHSSNKSIRKRTRRPNL-------NSFASTNAAKNTPKIPDPNIIRA 54

Query: 64  IDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFKKS 123
           +    R +   ++I++ D +S  + +                        S  E+    S
Sbjct: 55  V--LFRNLNDDRNIISHDDSSSLSAK---------------------TIRSPREICKHGS 91

Query: 124 LNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQF 171
           LNSFIAFRAY +QF                W S   Q   WD   +Q+
Sbjct: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%)

Query: 120 FKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCG 179
           + KS+N F+ FR+Y +Q+                W++      +WD FAQQ N +  + G
Sbjct: 59  YAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGG 118

Query: 180 FVE 182
             E
Sbjct: 119 ICE 121

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 1/75 (1%)

Query: 119 LFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPK 177
           + KK +N FI FR+Y A+F                 W    + H VW+ F Q +N     
Sbjct: 93  VLKKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTS 152

Query: 178 CGFVEWVGQTYEREW 192
             F  W+ + Y++ +
Sbjct: 153 MCFTLWLEENYQQSY 167

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 33.1 bits (74), Expect = 0.039,   Method: Composition-based stats.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 167 FAQQFNFVKPKCGFVEWVGQTY 188
           F QQ+NF+ P  GFVEW+   Y
Sbjct: 15  FPQQYNFINPGFGFVEWLTNNY 36

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 67/191 (35%), Gaps = 38/191 (19%)

Query: 10  QPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLK--------IPYPPTCLL 61
           +P FKVS+NK+    +K K  K +++        +++E   L         IP PP  ++
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLK------RNYVSEGVNLYMSYSKQELIPKPPKAVM 58

Query: 62  RSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           +              I+  D     +  L+                    +    +   K
Sbjct: 59  K--------------ILGSDHGKGLSKGLS---------KGIHKDQKSQTFLGSGKCTSK 95

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           K +N FI FR+Y A+                  W S  + H  W+ F + +N       F
Sbjct: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCF 155

Query: 181 VEWVGQTYERE 191
            EW+ + Y+ E
Sbjct: 156 TEWLEKNYKPE 166

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 67/191 (35%), Gaps = 38/191 (19%)

Query: 10  QPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLK--------IPYPPTCLL 61
           +P FKVS+NK+    +K K  K +++        +++E   L         IP PP  ++
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLK------RNYVSEGVNLYMSYSKQELIPKPPKAVM 58

Query: 62  RSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           +              I+  D     +  L+                    +    +   K
Sbjct: 59  K--------------ILGSDHGKGLSKGLS---------KGIHKDQKSQTFLGSGKCTSK 95

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           K +N FI FR+Y A+                  W S  + H  W+ F + +N       F
Sbjct: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCF 155

Query: 181 VEWVGQTYERE 191
            EW+ + Y+ E
Sbjct: 156 TEWLEKNYKPE 166

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 67/191 (35%), Gaps = 38/191 (19%)

Query: 10  QPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLK--------IPYPPTCLL 61
           +P FKVS+NK+    +K K  K +++        +++E   L         IP PP  ++
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLK------RNYVSEGVNLYMSYSKQELIPKPPKAVM 58

Query: 62  RSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           +              I+  D     +  L+                    +    +   K
Sbjct: 59  K--------------ILGSDHGKGLSKGLS---------KGIHKDQKSQTFLGSGKCTSK 95

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           K +N FI FR+Y A+                  W S  + H  W+ F + +N       F
Sbjct: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCF 155

Query: 181 VEWVGQTYERE 191
            EW+ + Y+ E
Sbjct: 156 TEWLEKNYKPE 166

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 67/191 (35%), Gaps = 38/191 (19%)

Query: 10  QPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQFIAENFKLK--------IPYPPTCLL 61
           +P FKVS+NK+    +K K  K +++        +++E   L         IP PP  ++
Sbjct: 5   KPSFKVSVNKRHGAKLKPKISKKSLK------RNYVSEGVNLYMSYSKQELIPKPPKAVM 58

Query: 62  RSIDAELRRIEIKKSIVAQDVNSLFNVELTWXXXXXXXXXXXXXXXXXXXYSSEEELLFK 121
           +              I+  D     +  L+                    +    +   K
Sbjct: 59  K--------------ILGSDHGKGLSKGLS---------KGIHKDQKSQTFLGSGKCTSK 95

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPKCGF 180
           K +N FI FR+Y A+                  W S  + H  W+ F + +N       F
Sbjct: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCF 155

Query: 181 VEWVGQTYERE 191
            EW+ + Y+ E
Sbjct: 156 TEWLEKNYKPE 166

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 122 KSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQFNFVKPKCGFV 181
           K +N FI FR+Y +++                W S+     +WD FA Q++ V   C   
Sbjct: 90  KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV--GCEMG 147

Query: 182 EWV 184
            WV
Sbjct: 148 VWV 150

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 117 ELLFKKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXAWHSAPEQHHVWDVFAQQ 170
           E+   ++LN F+AFR+Y +Q+               AWHS  ++ + W    Q+
Sbjct: 114 EICQNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 30.8 bits (68), Expect = 0.18,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 169 QQFNFVKPKCGFVEWVGQTY 188
           QQ+NF+ P  GFVEW+   Y
Sbjct: 1   QQYNFINPGFGFVEWLTNNY 20

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 30.4 bits (67), Expect = 0.25,   Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 167 FAQQFNFVKPKCGFVEWV 184
           F QQ+NF+ P  GFVEW+
Sbjct: 15  FPQQYNFINPGFGFVEWL 32

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 30.0 bits (66), Expect = 0.38,   Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 167 FAQQFNFVKPKCGFVEWV 184
           F QQ+NF+ P  GFVEW+
Sbjct: 12  FPQQYNFINPGFGFVEWL 29

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 29.6 bits (65), Expect = 0.46,   Method: Composition-based stats.
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 168 AQQFNFVKPKCGFVEWV 184
           AQQ+NF+ P  GFVEW+
Sbjct: 16  AQQYNFINPGFGFVEWL 32

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 3/78 (3%)

Query: 121 KKSLNSFIAFRAYNAQFXXXXXXXXXXXXXXXA-WHSAPEQHHVWDVFAQQFNFVKPKCG 179
           KK +N FIAFR+Y ++                  W    +    W++ AQ++N       
Sbjct: 103 KKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKH 162

Query: 180 FVEWVGQTY--EREWCTE 195
           F  W+   Y  +++W  E
Sbjct: 163 FFNWLEVNYGIDKQWLYE 180

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,251,975
Number of extensions: 562399
Number of successful extensions: 1583
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1578
Number of HSP's successfully gapped: 37
Length of query: 195
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 91
Effective length of database: 41,556,135
Effective search space: 3781608285
Effective search space used: 3781608285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)