Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E040701.2ON23123110541e-147
TPHA0E036101.121ON23123110541e-147
Kpol_2002.31.2ON2232305962e-77
KAFR0D007201.121ON2062253666e-43
NCAS0B091401.2ON2052273405e-39
ZYRO0F15818g1.121ON2252303391e-38
ZYRO0F18568g1.2ON2252303391e-38
NDAI0A001101.2ON2112233311e-37
Skud_3.1181.121ON2102233129e-35
Suva_3.1471.2ON2102233121e-34
YCR039C (MATALPHA2)1.121ON2102233121e-34
YCL067C (HMLALPHA2)1.2ON2102233121e-34
CAGL0B01265g1.121ON1862273031e-33
KNAG0C001601.2ON2032252953e-32
TBLA0A076001.2ON2302302963e-32
TBLA0A070501.121ON2612462975e-32
CAGL0B00264g1.2ON2102182874e-31
Ecym_11151.121ON230912842e-30
Ecym_10021.2ON230912842e-30
Suva_3.135singletonON119902673e-29
Suva_3.74singletonON119902673e-29
Suva_3.751.121ON119902673e-29
YCR096C (HMRA2)singletonOFF119902673e-29
Skud_102.1singletonON1851982691e-28
Smik_95.1singletonON1851982691e-28
Smik_3.1421.121ON2281982676e-28
TDEL0C070001.2ON2372352407e-24
KLLA0C00374g1.2ON223861802e-15
TDEL0F018106.170ON256571205e-07
Kwal_YGOB_matalpha21.121ON110461155e-07
Kwal_33.12995singletonOFF110461155e-07
Kwal_YGOB_HMalpha21.2ON110461155e-07
Kwal_33.matalpha2singletonOFF110461155e-07
Suva_16.1326.170ON292581198e-07
Skud_16.1036.170ON295581181e-06
CAGL0C01551g6.170ON221581171e-06
ZYRO0G22044g6.170ON201571161e-06
NCAS0D035706.170ON257521171e-06
YPL177C (CUP9)6.170ON306851162e-06
KAFR0A043706.170ON409521172e-06
Smik_6.3746.170ON294571153e-06
Kpol_1036.566.170ON265521143e-06
TBLA0C037406.170ON293521144e-06
KAFR0G036506.170ON177521107e-06
NDAI0I013206.170ON409581127e-06
KNAG0M005006.170ON298521118e-06
Smik_7.1816.170ON274521119e-06
Ecym_22476.170ON349571092e-05
KLTH0F00396g1.2ON108491032e-05
NDAI0F021706.170ON383561092e-05
NCAS0H011306.170ON280561082e-05
SAKL0A05610g6.170ON320521082e-05
Skud_7.1816.170ON274601073e-05
TPHA0B025806.170ON264571064e-05
KLTH0H05236g6.170ON234521054e-05
YGL096W (TOS8)6.170ON276521064e-05
CAGL0H02959g6.170ON259521039e-05
Suva_7.1726.170ON270601021e-04
AFL049C6.170ON257571021e-04
Kwal_27.110926.170ON229521002e-04
KNAG0F022106.170ON324521012e-04
KLLA0B10450g6.170ON38952960.001
ADL394Cna 1ON10254680.80
Skud_71.2singletonON4544650.87
NCAS0F031605.402ON373287730.94
AFR643C1.122ON10254661.6
AER456Wna 2ON5754631.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04070
         (231 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   410   e-147
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   410   e-147
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   234   2e-77
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   145   6e-43
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   135   5e-39
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   135   1e-38
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   135   1e-38
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   132   1e-37
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   124   9e-35
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   124   1e-34
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   124   1e-34
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   124   1e-34
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   121   1e-33
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   118   3e-32
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...   118   3e-32
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...   119   5e-32
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   115   4e-31
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...   114   2e-30
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...   114   2e-30
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   107   3e-29
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   107   3e-29
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   107   3e-29
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   107   3e-29
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       108   1e-28
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         108   1e-28
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   107   6e-28
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    97   7e-24
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    74   2e-15
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    51   5e-07
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    49   5e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    49   5e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    49   5e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    49   5e-07
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    50   8e-07
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    50   1e-06
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    50   1e-06
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    49   1e-06
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    50   1e-06
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    49   2e-06
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    50   2e-06
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    49   3e-06
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    49   3e-06
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    49   4e-06
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    47   7e-06
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    48   7e-06
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    47   8e-06
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    47   9e-06
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    47   2e-05
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    44   2e-05
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    47   2e-05
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    46   2e-05
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    46   2e-05
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    46   3e-05
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    45   4e-05
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    45   4e-05
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    45   4e-05
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    44   9e-05
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    44   1e-04
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    44   1e-04
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    43   2e-04
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    44   2e-04
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    42   0.001
ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON} Non-...    31   0.80 
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         30   0.87 
NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5...    33   0.94 
AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON} ...    30   1.6  
AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]...    29   1.7  

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  410 bits (1054), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 208/231 (90%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQ               SGTSDNSETNS
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
           SCNSSDNEDKNSILVFNVITQDMM        SYRGHRLPKKNVQYLEDWYMDHRKNPYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS 231
           NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS 231

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  410 bits (1054), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 208/231 (90%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQ               SGTSDNSETNS
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNS 120

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
           SCNSSDNEDKNSILVFNVITQDMM        SYRGHRLPKKNVQYLEDWYMDHRKNPYL
Sbjct: 121 SCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS 231
           NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS
Sbjct: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTITS 231

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  234 bits (596), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 165/230 (71%), Gaps = 12/230 (5%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPIN LLNPS   NL +KLQQIN  L++LC+K+P   + L + DH ELQ ILL+LTT
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTS-DNSETN 119
           VVK ++L  +EIMLV+TTYQL TTL++MVKS +                S TS +NSE  
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR---------MANENYESQTSKENSEEE 111

Query: 120 -SSCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNP 178
            +S +SSD+ D+N   VFN++TQDMM        SYRGHRLPK+NV+ LE WY+ + +NP
Sbjct: 112 LTSPSSSDSNDRNE-FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENP 170

Query: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKT 228
           YL++ +I  LM  TSLS++Q+KNW+SNRRRKEKSITISPEVS LL++ KT
Sbjct: 171 YLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKT 220

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  145 bits (366), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 122/225 (54%), Gaps = 23/225 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKI I  LLN  +  +  ++L+ IN  L  LC+KLP +   L    H EL+DI+L L+ 
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  VVKQQELKKEEIMLVKTTYQL-CTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETN 119
           +     +  EE  L  T +QL CT +TL+                      G  +   T 
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLI---------------------KGMKNFHGTG 99

Query: 120 SSCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPY 179
               SS   + +   VFNV+TQDMM        SYRGHR  K+NV+ LE WY  H   PY
Sbjct: 100 GHSYSSSKSESDDKTVFNVVTQDMMNLNRTGI-SYRGHRFSKENVKVLERWYTAHIDRPY 158

Query: 180 LNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLR 224
           LN  + + L+SKT LSR+Q+KNW+SNRRRKEKS+ +SPE+  LL+
Sbjct: 159 LNRQSTEYLISKTGLSRVQIKNWVSNRRRKEKSVHVSPELIQLLQ 203

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  135 bits (340), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 124/227 (54%), Gaps = 22/227 (9%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKI I+ LLNP       E+L+ IN  L+ +C+  P T     +    +L++I + L++
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSS 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           +  Q EL  E   +++ TYQ+ + L  ++                       + N +   
Sbjct: 61  LTNQNELSSENKNVLRVTYQISSVLLKLL--------------------GENAHNKDQPK 100

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
           +  S    ++N  LVFN++T+  M          RGHRL K+ V  LE WY+ H  NPYL
Sbjct: 101 TPTSGSESERNPKLVFNILTKKRMSPTSNE--PRRGHRLAKEKVDLLEHWYIQHMDNPYL 158

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNK 227
           N+ ++++LM +TSLS++Q+KNW+SNRRRKEKS++I+PE+  +L   K
Sbjct: 159 NKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  135 bits (339), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 126/230 (54%), Gaps = 10/230 (4%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI +LLNP       EKL+ IN  L  LC+KLP    +  E D  EL+ IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSE-NEQFEKDKAELEKILPSLNI 59

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           ++++    KE+  +V   +QL +  +L++    +               S    +    +
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLR-----SKPKYHLPYAA 114

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
           +  ++  E     +VFN++TQD +        +YRGHRLPK   + LE W+  + ++PYL
Sbjct: 115 ALGNTGKEG----MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTIT 230
              ++K LM +T LS  Q+KNW+SNRRRKEKS+TIS EVS L++++K  T
Sbjct: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGT 220

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  135 bits (339), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 126/230 (54%), Gaps = 10/230 (4%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI +LLNP       EKL+ IN  L  LC+KLP    +  E D  EL+ IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSE-NEQFEKDKAELEKILPSLNI 59

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           ++++    KE+  +V   +QL +  +L++    +               S    +    +
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLR-----SKPKYHLPYAA 114

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
           +  ++  E     +VFN++TQD +        +YRGHRLPK   + LE W+  + ++PYL
Sbjct: 115 ALGNTGKEG----MVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYL 170

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKTIT 230
              ++K LM +T LS  Q+KNW+SNRRRKEKS+TIS EVS L++++K  T
Sbjct: 171 QTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESKQGT 220

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 124/223 (55%), Gaps = 18/223 (8%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKI I+ LLNP     +T  L  IN  L  +C+K P    ++  +   +L +I+ +L+T
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           + +   L  ++   ++ TY+L + L  ++K                   +GT +  +   
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKD--------------MVLLNGTEEVEKKKV 106

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
                +  + NS  VFNVITQDMM         +RGHRLPK+ V  LE WY+ H + PYL
Sbjct: 107 K--EEEELETNSKYVFNVITQDMMIPEKNK--PHRGHRLPKEKVNRLEHWYLAHIQKPYL 162

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
           +  N+K+LM +T LS++Q+KNWISNRRRKEK ++ISP++  ++
Sbjct: 163 DSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  124 bits (312), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 125/223 (56%), Gaps = 23/223 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
             K +++  EE  L++TT QL TT+T+++K  +                     N +   
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSI--------------ENDRSNYQLTQ 106

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
              S+D       LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL
Sbjct: 107 KNKSADG------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYL 157

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
           +   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 158 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  124 bits (312), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 125/223 (56%), Gaps = 23/223 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
             K +++  EE  L++TT QL TT+T+++K  +                     N +   
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSI--------------ENDRSNYQLTQ 106

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
              S+D       LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL
Sbjct: 107 KNKSADG------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYL 157

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
           +   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 158 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  124 bits (312), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 125/223 (56%), Gaps = 23/223 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
             K +++  EE  L++TT QL TT+T+++K  +                     N +   
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSI--------------ENDRSNYQLTQ 106

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
              S+D       LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL
Sbjct: 107 KNKSADG------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYL 157

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
           +   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 158 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  124 bits (312), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 125/223 (56%), Gaps = 23/223 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI  LLNP         +  IN  L ++C  LP     +T  +  EL+DIL +L+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
             K +++  EE  L++TT QL TT+T+++K  +                     N +   
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSI--------------ENDRSNYQLTQ 106

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
              S+D       LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL
Sbjct: 107 KNKSADG------LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYL 157

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
           +   ++ LM  TSLSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 158 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  121 bits (303), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 114/227 (50%), Gaps = 53/227 (23%)

Query: 3   KIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTTVV 62
           +I I  LLNP Q  NL EKLQ+IN  L +LC+ LP   +    +      DIL +L+   
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS-----DILRFLS--- 57

Query: 63  KQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNSSC 122
            +  L  +EI L+KTTY+L T L+ +                                  
Sbjct: 58  -RNNLDPQEIGLIKTTYRLSTLLSKL---------------------------------- 82

Query: 123 NSSDNEDKNSILVFNVITQDMMXXXX---XXXXSYRGHRLPKKNVQYLEDWYMDHRKNPY 179
                  +   +VFNV+T+D +           SYRGHR  ++NVQ LE WY +H  NPY
Sbjct: 83  -------REHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPY 135

Query: 180 LNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDN 226
           L+  + + L  KT+LS+IQ+KNW++NRRRK+KSI ISP    L+  N
Sbjct: 136 LDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISPFRPTLMAQN 182

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  118 bits (295), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 22/225 (9%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MN+I I  LLN     +L +  + IN  L  +C+  P  +         +LQ ILL+LT 
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNS 120
           +V + +L        + TYQ    +  ++KS +                    +  E N 
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFF----------------ERKEYND 104

Query: 121 SCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYL 180
              +S+NE      VF+V+TQDMM          RGHR    + + LEDWY  H + PYL
Sbjct: 105 PA-TSENE-----FVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYL 158

Query: 181 NEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRD 225
           ++ ++  L  KT LS++Q++NW+SNRRRKEKSI +SP +  LL++
Sbjct: 159 DKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score =  118 bits (296), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 122/230 (53%), Gaps = 23/230 (10%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI+ LLNP+   N+ E+LQ +N  L ++C++LP   +     +  +L +IL +LT 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKS----MEETQLSEILKFLTK 56

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXX------------XXX 108
            +K + L KEE  LV TT QL T L+ +VK  +Q                          
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSN 116

Query: 109 XSGTSDNSETNSSCNSSDNEDKNSILV-------FNVITQDMMXXXXXXXXSYRGHRLPK 161
            + TS +  +NS  NS   +   + L        ++  +   +        S+RGHRLPK
Sbjct: 117 SNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPK 176

Query: 162 KNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211
             +  LE W++ ++ +PYL+  +++ L +++SLS+ QVKNWISNRRRKE+
Sbjct: 177 HTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score =  119 bits (297), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 133/246 (54%), Gaps = 24/246 (9%)

Query: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60
           MNKIPI+ LLNP+   N+ E+LQ +N  L ++C++LP   +     +  +L +IL +LT 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKS----MEETQLSEILKFLTK 56

Query: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMV------------KSCKQXXXXXXXXXXXXXX 108
            +K + L KEE  LV TT QL T L+ +V            +S                 
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSN 116

Query: 109 XSGTSDNSETNSSCNSSDNEDKNSILV-------FNVITQDMMXXXXXXXXSYRGHRLPK 161
            + TS +  +NS  NS   +   + L        ++  +   +        S+RGHRLPK
Sbjct: 117 SNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPK 176

Query: 162 KNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK-SITISPEVS 220
             +  LE W++ ++ +PYL+  +++ L +++SLS+ QVKNWISNRRRKE+ S+ IS  ++
Sbjct: 177 HTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLKISNNIA 236

Query: 221 ALLRDN 226
           +LL+++
Sbjct: 237 SLLQND 242

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  115 bits (287), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 111/218 (50%), Gaps = 53/218 (24%)

Query: 2   NKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTTV 61
           ++I I  LLNP Q  NL EKLQ+IN  L +LC+ LP   +    +      DIL +L+  
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS-----DILRFLS-- 57

Query: 62  VKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNSS 121
             +  L  +EI L+KTTY+L T L+ +                                 
Sbjct: 58  --RNNLDPQEIGLIKTTYRLSTLLSKL--------------------------------- 82

Query: 122 CNSSDNEDKNSILVFNVITQDMMXXXXX---XXXSYRGHRLPKKNVQYLEDWYMDHRKNP 178
                   +   +VFNV+T+D +           SYRGHR  ++NVQ LE WY +H  NP
Sbjct: 83  --------REHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNP 134

Query: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITIS 216
           YL+  + + L  KT+LS+IQ+KNW++NRRRK+KSI IS
Sbjct: 135 YLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYIS 172

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score =  114 bits (284), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (76%), Gaps = 1/91 (1%)

Query: 134 LVFNVITQDMMX-XXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKT 192
           ++FNV+TQDMM         SY+GHRLPKK+VQ LE WY ++ +NPYLN+ +I++LM +T
Sbjct: 138 IIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRET 197

Query: 193 SLSRIQVKNWISNRRRKEKSITISPEVSALL 223
             SR QVKNW++N+RRK+K  TISPE+S LL
Sbjct: 198 GFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score =  114 bits (284), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (76%), Gaps = 1/91 (1%)

Query: 134 LVFNVITQDMMX-XXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKT 192
           ++FNV+TQDMM         SY+GHRLPKK+VQ LE WY ++ +NPYLN+ +I++LM +T
Sbjct: 138 IIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRET 197

Query: 193 SLSRIQVKNWISNRRRKEKSITISPEVSALL 223
             SR QVKNW++N+RRK+K  TISPE+S LL
Sbjct: 198 GFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  107 bits (267), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 67/90 (74%), Gaps = 3/90 (3%)

Query: 134 LVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTS 193
           LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TS
Sbjct: 23  LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 194 LSRIQVKNWISNRRRKEKSITISPEVSALL 223
           LSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  107 bits (267), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 67/90 (74%), Gaps = 3/90 (3%)

Query: 134 LVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTS 193
           LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TS
Sbjct: 23  LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 194 LSRIQVKNWISNRRRKEKSITISPEVSALL 223
           LSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  107 bits (267), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 67/90 (74%), Gaps = 3/90 (3%)

Query: 134 LVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTS 193
           LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TS
Sbjct: 23  LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 194 LSRIQVKNWISNRRRKEKSITISPEVSALL 223
           LSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  107 bits (267), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 67/90 (74%), Gaps = 3/90 (3%)

Query: 134 LVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTS 193
           LVFNV+TQDM+         YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TS
Sbjct: 23  LVFNVVTQDMINKSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 194 LSRIQVKNWISNRRRKEKSITISPEVSALL 223
           LSRIQ+KNW+SNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 23/198 (11%)

Query: 26  NITLSNLCTKLPDTITDLTEADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTL 85
           N  L ++C  LP     +T  +  EL+DIL +L+   K +++  EE  L++TT QL TT+
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  TLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMX 145
           T+++K  +                     N +      S+D       LVFNV+TQDM+ 
Sbjct: 61  TVLLKEMRSI--------------ENDRSNYQLTQKNKSADG------LVFNVVTQDMIN 100

Query: 146 XXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISN 205
                   YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TSLSRIQ+KNW+SN
Sbjct: 101 KSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSN 157

Query: 206 RRRKEKSITISPEVSALL 223
           RRRKEK+ITI+PE++ LL
Sbjct: 158 RRRKEKTITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 23/198 (11%)

Query: 26  NITLSNLCTKLPDTITDLTEADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTL 85
           N  L ++C  LP     +T  +  EL+DIL +L+   K +++  EE  L++TT QL TT+
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  TLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMX 145
           T+++K  +                     N +      S+D       LVFNV+TQDM+ 
Sbjct: 61  TVLLKEMRSI--------------ENDRSNYQLTQKNKSADG------LVFNVVTQDMIN 100

Query: 146 XXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISN 205
                   YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TSLSRIQ+KNW+SN
Sbjct: 101 KSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSN 157

Query: 206 RRRKEKSITISPEVSALL 223
           RRRKEK+ITI+PE++ LL
Sbjct: 158 RRRKEKTITIAPELADLL 175

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  107 bits (267), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 23/198 (11%)

Query: 26  NITLSNLCTKLPDTITDLTEADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTL 85
           N  L ++C  LP     +T  +  EL+DIL +L+   K +++  EE  L++TT QL TT+
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 86  TLMVKSCKQXXXXXXXXXXXXXXXSGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMX 145
           T+++K  +                     N +      S+D       LVFNV+TQDM+ 
Sbjct: 104 TVLLKEMRSI--------------ENDRSNYQLTQKNKSADG------LVFNVVTQDMIN 143

Query: 146 XXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISN 205
                   YRGHR  K+NV+ LE W+  + +NPYL+   ++ LM  TSLSRIQ+KNW+SN
Sbjct: 144 KSTK---PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSN 200

Query: 206 RRRKEKSITISPEVSALL 223
           RRRKEK+ITI+PE++ LL
Sbjct: 201 RRRKEKTITIAPELADLL 218

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 97.1 bits (240), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 114/235 (48%), Gaps = 27/235 (11%)

Query: 3   KIPINKLLNPSQHYNLT---------EKLQQINIT-----LSNLCTKLPDTITDLTEADH 48
           KIPIN LLNP QH +            KL+   +T        L  KL + I        
Sbjct: 4   KIPINLLLNPQQHDDKKEKKDKSESCSKLRGTRVTQHKREADELFFKLSNGIGKPEFELR 63

Query: 49  RELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQXXXXXXXXXXXXXX 108
            EL+ +L  L  V    +L++   +L++TT+QL  TL++++   K+              
Sbjct: 64  CELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFHKSR-- 121

Query: 109 XSGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMXXXXXXXXSYRGHRLPKKNVQYLE 168
               S+  ETN  C   + E    I+  N   QD           +RGHRLP + V+ LE
Sbjct: 122 -DWDSERKETNLRCKVPNFE----IVPLNT-KQDY-----STGKRHRGHRLPSEKVEKLE 170

Query: 169 DWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALL 223
            W+  +   PYLN+  ++ L+ +TSLS IQ+KNW+SNRRRK+KS  I+  +S LL
Sbjct: 171 LWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 73.9 bits (180), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 56/86 (65%), Gaps = 2/86 (2%)

Query: 138 VITQDMMXXXXXXXXSYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRI 197
           ++TQD+M          +G R PK ++Q LE+WY  +R+NPYL E ++  +   T+L++ 
Sbjct: 139 ILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKT 196

Query: 198 QVKNWISNRRRKEKSITISPEVSALL 223
           Q+KNW++NRRRK+K   +S ++  +L
Sbjct: 197 QIKNWLANRRRKDKITEVSSDIRNIL 222

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 156 GHR--LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           G R  LPK+ VQ L  W +DH +NPY      + L+ KT L++IQ+ NW  N RR++
Sbjct: 131 GRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRK 187

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           S R   LPK+ VQ L  W ++H  NPY  +   + L+ KT L++IQ+ NW  N RR++
Sbjct: 149 SGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 206

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           S R   LPK+ VQ L  W ++H  NPY  +   + L+ KT L++IQ+ NW  N RR++
Sbjct: 152 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 209

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           S R   LPK  +Q L  W +DH  NPY  +   + L+ KT L++IQ+ NW  N RR++
Sbjct: 76  SKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRK 133

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRK 209
           S R   LPK+ VQ L  W +DH  NPY      + L+ KT L++IQ+ NW  N RR+
Sbjct: 78  SGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVRRR 134

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LP+  V+ L  W ++H  NPY N    KLL+  T L+++Q+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 127 NEDKNSILVFNVITQDMMXXXXXXXX-SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINI 185
           N++K++   +N    D +         S R   LPK+ VQ L  W ++H  NPY  +   
Sbjct: 136 NKEKDAGAQYNRPFSDFVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEK 195

Query: 186 KLLMSKTSLSRIQVKNWISNRRRKE 210
           + L+ KT L++IQ+ NW  N RR++
Sbjct: 196 RELLIKTGLTKIQLSNWFINVRRRK 220

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ VQ L +W ++H  NPY   I    L+ +T L++IQ+ NW  N RR++
Sbjct: 275 LPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRK 326

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRK 209
           S R   LPK+ VQ L  W ++H  NPY  +   + L+ KT L++IQ+ NW  N RR+
Sbjct: 151 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 207

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK +VQ L  W ++H +NPY      K L+ +T L++IQ+ NW  N RR++
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRRK 214

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ VQ L DW ++H +NPY        L+  T L++IQ+ NW  N RR++
Sbjct: 182 LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRK 233

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ +Q L  W ++H  NPY      + L+ KT L++IQ+ NW  N RR++
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%)

Query: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           S R   LP   VQ L +W +DH  NPY      K L+ +T L++IQ+ NW  N RR++
Sbjct: 306 SGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRK 363

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK  V  L  W +DH  NPY      + L+ KT LS+IQ+ NW  N RR++
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK  V  L  W ++H  NPY      + L++KT L+++Q+ NW  N RR++
Sbjct: 199 LPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 154 YRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           +R   LPK+ V  L +W  DH  NPY +    K L+ +T L+ +Q+ NW  N RR++
Sbjct: 225 HRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 281

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%)

Query: 167 LEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITI 215
           LE W+  + + PY N+I I  L   T+LS  Q++NW+SNRRRK +  +I
Sbjct: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 155 RGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           R   LPK+ ++ L  W ++H +NPY      + L+ KT L+++Q+ NW  N RR++
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 155 RGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           R   LPK+ VQ L  W ++H +NPY      + L+ KT L+++Q+ NW  N RR++
Sbjct: 129 RRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ VQ L +W + H  NPY +    + L+ KT L+ +Q+ NW  N RR++
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 155 RGHR----LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           +GH     LPK  V  L  W ++H  NPY      + L++KT L+++Q+ NW  N RR++
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRK 250

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 156 GHR--LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           G R  LPK++V  L  W ++H  NPY      + L+  T LS+IQ+ NW  N RR++
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISN-RRRK 209
           LPK+ V+ L  W   H  NPY +    + L+ +T LS++Q+ NW  N RRRK
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK 160

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK  V  L  W  +H  NPY      + L++KT L+++Q+ NW  N RR++
Sbjct: 201 LPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ V+ L +W  DH  NPY        L  KT L++IQ+ NW  N RR++
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK 219

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 155 RGHR----LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           +GH     LP   V  L  W ++H  NPY      + L+++T L+++Q+ NW  N RR++
Sbjct: 193 KGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 154 YRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           +R   LPK+ V  L +W  +H  NPY +    K L+ +T L+ +Q+ NW  N RR++
Sbjct: 133 HRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 189

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ V  L +W + H   PY +    + L+ KT LS++Q+ NW  N RR++
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRK 176

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LP++ VQ L +W ++H  +PY        L+ +T L++IQ+ NW  N RR++
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKE 210
           LPK+ +  L DW + +  NPY      + L+ KT L+ +Q+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 30.8 bits (68), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKS 212
           LPK+  ++LE  + + ++ P  N    + +  K  L+ IQ++ W +N+R + K+
Sbjct: 47  LPKETKEFLESVF-ERKRCP--NAKERRAIAEKCGLTPIQIRIWFTNKRMRSKT 97

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 29.6 bits (65), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 1  MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCT---KLPDTIT 41
          MNKIPI  LLNP         +  IN  L ++C    KLP+++T
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVT 44

>NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5.402
            YHR099W
          Length = 3732

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 18/87 (20%)

Query: 3    KIPINKLLNPSQHY-----------NLTEKLQQINITLSNLCTKLPDTITDLTEADHREL 51
            +IPI KL+  S+H+            L+  +Q  NI     C  LPD+     E   R L
Sbjct: 1318 QIPIVKLMEHSKHFLLSPIFTKPLRALSFTMQIGNIDAMTYCVGLPDSFLTFNEELFRFL 1377

Query: 52   QDILLY-------LTTVVKQQELKKEE 71
            Q++++        L+TV +  E K  E
Sbjct: 1378 QEVIVLADAEDESLSTVQRSTEYKTAE 1404

>AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR097W
           (HMRA1)
          Length = 102

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKS 212
           LPK+  ++LE  +   R   + N    + +  K  L+ IQ++ W +N+R + K+
Sbjct: 47  LPKETKEFLESVFERKR---WPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSKT 97

>AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]
           {ON} Non-syntenic homolog of Saccharomyces cerevisiae
           YCR097W (HMRA1); 1-intron
          Length = 57

 Score = 28.9 bits (63), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 159 LPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKS 212
           LPK+  ++LE  + + ++ P  N    + +  K  L+ IQ++ W +N+R + K+
Sbjct: 2   LPKETKEFLESVF-ERKRCP--NAKERRAIAEKCGLTPIQIRIWFTNKRMRSKT 52

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.127    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,273,827
Number of extensions: 817455
Number of successful extensions: 3892
Number of sequences better than 10.0: 78
Number of HSP's gapped: 3887
Number of HSP's successfully gapped: 82
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)