Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E04055singletonON84844352e-57
TPHA0E035951.122ON84844352e-57
Kpol_2002.481.122ON90823953e-51
Kpol_408.2singletonON90823953e-51
Kpol_1058.2na 1ON90823953e-51
TBLA0G01060na 1ON174822235e-24
Kwal_33.12991singletonOFF91872123e-23
YCR097W (HMRA1)na 1ON126752075e-22
ADL394Cna 2ON102942046e-22
AFR643C1.122ON102942002e-21
Kthe_YGOB_MATa11.122ON111931952e-20
AER456Wna 1ON57501884e-20
KNAG0C007951.122ON107681821e-18
KNAG0C01625na 1ON140721832e-18
NDAI0A006701.122ON95501761e-17
NDAI0H00100na 1ON95501761e-17
TDEL0G00190na 2ON112571762e-17
TDEL0C058201.122ON112571762e-17
TDEL0E00330singletonON112571762e-17
ZYRO0C18348gna 1ON140481711e-16
Suva_3.138na 1ON82661662e-16
Suva_3.771.122ON82661662e-16
Skud_80.2singletonON125441666e-16
Smik_3.1431.122ON125511622e-15
NCAS0A15350na 1ON103531612e-15
NCAS0B085601.122ON103531603e-15
Smik_88.2singletonON177381628e-15
SAKL0C03674g1.122ON186451611e-14
Kwal_YGOB_HMa1na 1ON105731447e-13
KLLA0C03135g1.122ON228551482e-12
KLLA0B14553gna 1ON228551482e-12
KLTH0F00242gna 1ON142461442e-12
KAFR0G001801.122ON131431432e-12
CAGL0E00341gna 1ON130531144e-08
KNAG0C027705.567ON321561034e-06
ZYRO0A07194g2.337ON49766850.001
TDEL0G026802.337ON51161850.001
AFL049C6.170ON25761840.002
KLTH0F09636g2.337ON48447810.004
Ecym_22476.170ON34960790.009
TBLA0B070702.337ON64561780.011
KLLA0D10043g2.337ON48845780.011
Kwal_23.34942.337ON46647780.013
KAFR0C056005.567ON38443770.016
AFL202C2.337ON48147770.017
Ecym_33782.337ON49147760.021
TBLA0D013905.567ON28660740.040
Ecym_41035.567ON43145720.086
Kpol_1043.242.337ON52747720.087
NDAI0C008505.567ON45744710.093
Skud_7.1816.170ON27441710.10
NCAS0H027705.567ON41343700.12
Suva_2.6265.567ON35743690.21
KNAG0A056002.337ON62659690.23
SAKL0E06402g2.337ON49159680.24
KAFR0E04495singletonON27450680.27
Smik_7.1816.170ON27427680.27
NCAS0B059802.337ON49354680.28
TPHA0C036202.337ON54847680.30
KNAG0B034605.567ON44943680.30
TBLA0A070501.121ON26159670.32
TBLA0A076001.2ON23059670.32
KAFR0A043706.170ON40926670.34
YGL096W (TOS8)6.170ON27627670.35
CAGL0G07249g5.567ON34539670.37
Skud_13.1245.567ON38643670.39
Skud_4.1482.337ON56345670.40
Smik_4.7285.567ON34643670.41
YML027W (YOX1)5.567ON38543670.42
Skud_4.7275.567ON34843660.44
SAKL0A05610g6.170ON32060660.44
TPHA0K003605.567ON33343660.45
CAGL0L07436g2.337ON51547660.47
Suva_4.1402.337ON55745660.49
Smik_13.1245.567ON38543660.50
YDR451C (YHP1)5.567ON35343660.52
AER314W5.567ON43164660.55
Suva_7.1726.170ON27027650.61
NDAI0I013206.170ON40928650.64
Suva_13.1325.567ON38443650.66
Smik_4.1302.337ON56045650.66
YDL106C (PHO2)2.337ON55945650.67
TBLA0A010807.154ON159071650.68
Kpol_1044.37.86ON93260650.72
Kpol_1036.566.170ON26527650.75
KAFR0G036506.170ON17779640.87
TDEL0C070001.2ON23758640.90
SAKL0G05896g5.567ON38643641.0
NDAI0F021706.170ON38355631.1
ZYRO0D13596g5.567ON44943631.3
KNAG0M005006.170ON29863631.4
TDEL0A043205.567ON33043621.5
CAGL0C01551g6.170ON22169621.6
NCAS0H011306.170ON28028621.8
KAFR0A067702.337ON39143612.1
NDAI0B032902.337ON59542612.6
NDAI0G026408.315ON22052602.7
Kpol_1004.505.567ON41143612.7
KLTH0G04686g5.567ON37543603.0
ZYRO0G22044g6.170ON20164603.2
Skud_7.2464.74ON47257603.2
NCAS0D035706.170ON25729603.5
TDEL0F018106.170ON25658603.6
KLLA0B10450g6.170ON38922603.7
KAFR0D007201.121ON20673593.8
CAGL0H02959g6.170ON25927593.8
Smik_6.3746.170ON29419594.5
YPL177C (CUP9)6.170ON30619594.6
Skud_16.1036.170ON29519595.0
Suva_16.1326.170ON29219586.0
TPHA0B025806.170ON26427586.1
TBLA0C037406.170ON29327577.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04055
         (84 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925) ...   172   2e-57
TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948) ...   172   2e-57
Kpol_2002.48 s2002 complement(103569..103598,103652..103813,1038...   156   3e-51
Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [27...   156   3e-51
Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90...   156   3e-51
TBLA0G01060 Chr7 complement(267271..267300,267367..267663,267722...    91   5e-24
Kwal_33.12991 s33 complement(30624..30899) [276 bp, 91 aa] {OFF}...    86   3e-23
YCR097W Chr3 (293835..293939,293994..294239,294292..294321) [381...    84   5e-22
ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON} Non-...    83   6e-22
AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON} ...    82   2e-21
Kthe_YGOB_MATa1 Chr6 complement(282329..282664) [336 bp, 111 aa]...    80   2e-20
AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]...    77   4e-20
KNAG0C00795 Chr3 complement(141421..141450,141508..141732,141810...    75   1e-18
KNAG0C01625 Chr3 complement(322219..322248,322306..322698) [423 ...    75   2e-18
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    72   1e-17
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    72   1e-17
TDEL0G00190 Chr7 complement(36313..36360,36422..36712) [339 bp, ...    72   2e-17
TDEL0C05820 Chr3 (1050752..1051042,1051104..1051151) [339 bp, 11...    72   2e-17
TDEL0E00330 Chr5 complement(75774..75821,75883..76173) [339 bp, ...    72   2e-17
ZYRO0C18348g Chr3 (1436144..1436218,1436270..1436617) [423 bp, 1...    70   1e-16
Suva_3.138 Chr3 (212009..212254) [246 bp, 82 aa] {ON} YCR097W (R...    69   2e-16
Suva_3.77 Chr3 (113778..114023) [246 bp, 82 aa] {ON} YCR097W (REAL)    69   2e-16
Skud_80.2 Chr80 complement(176..448,504..608) [378 bp, 125 aa] {...    69   6e-16
Smik_3.143 Chr3 (198230..198334,198389..198661) [378 bp, 125 aa]...    67   2e-15
NCAS0A15350 Chr1 (3019029..3019088,3019146..3019367,3019420..301...    67   2e-15
NCAS0B08560 Chr2 (1643716..1643775,1643833..1644054,1644107..164...    66   3e-15
Smik_88.2 Chr88 complement(174..446,501..761) [534 bp, 177 aa] {...    67   8e-15
SAKL0C03674g Chr3 complement(347672..348232) [561 bp, 186 aa] {O...    67   1e-14
Kwal_YGOB_HMa1 s33 complement(22840..23093,23178..23241) [318 bp...    60   7e-13
KLLA0C03135g Chr3 complement(279869..280555) [687 bp, 228 aa] {O...    62   2e-12
KLLA0B14553g Chr2 complement(1278622..1279308) [687 bp, 228 aa] ...    62   2e-12
KLTH0F00242g Chr6 complement(21856..22284) [429 bp, 142 aa] {ON}...    60   2e-12
KAFR0G00180 Chr7 complement(60883..61254,61328..61351) [396 bp, ...    60   2e-12
CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 ...    49   4e-08
KNAG0C02770 Chr3 complement(539538..540503) [966 bp, 321 aa] {ON...    44   4e-06
ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {...    37   0.001
TDEL0G02680 Chr7 complement(512112..513647) [1536 bp, 511 aa] {O...    37   0.001
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    37   0.002
KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {...    36   0.004
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    35   0.009
TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa] ...    35   0.011
KLLA0D10043g Chr4 (849549..851015) [1467 bp, 488 aa] {ON} simila...    35   0.011
Kwal_23.3494 s23 complement(318582..319982) [1401 bp, 466 aa] {O...    35   0.013
KAFR0C05600 Chr3 complement(1115478..1116632) [1155 bp, 384 aa] ...    34   0.016
AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON} Syn...    34   0.017
Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}...    34   0.021
TBLA0D01390 Chr4 (348236..349096) [861 bp, 286 aa] {ON} Anc_5.56...    33   0.040
Ecym_4103 Chr4 complement(207513..208808) [1296 bp, 431 aa] {ON}...    32   0.086
Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON} (47321....    32   0.087
NDAI0C00850 Chr3 (166280..167653) [1374 bp, 457 aa] {ON} Anc_5.5...    32   0.093
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    32   0.10 
NCAS0H02770 Chr8 complement(542783..544024) [1242 bp, 413 aa] {O...    32   0.12 
Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {...    31   0.21 
KNAG0A05600 Chr1 complement(833013..834893) [1881 bp, 626 aa] {O...    31   0.23 
SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} simila...    31   0.24 
KAFR0E04495 Chr5 (914267..915091) [825 bp, 274 aa] {ON}                31   0.27 
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    31   0.27 
NCAS0B05980 Chr2 (1131961..1133442) [1482 bp, 493 aa] {ON} Anc_2...    31   0.28 
TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa] {O...    31   0.30 
KNAG0B03460 Chr2 (669607..670956) [1350 bp, 449 aa] {ON} Anc_5.5...    31   0.30 
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    30   0.32 
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    30   0.32 
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    30   0.34 
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    30   0.35 
CAGL0G07249g Chr7 complement(688189..689226) [1038 bp, 345 aa] {...    30   0.37 
Skud_13.124 Chr13 (207585..208745) [1161 bp, 386 aa] {ON} YML027...    30   0.39 
Skud_4.148 Chr4 complement(265683..267374) [1692 bp, 563 aa] {ON...    30   0.40 
Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {...    30   0.41 
YML027W Chr13 (221406..222563) [1158 bp, 385 aa] {ON}  YOX1Homeo...    30   0.42 
Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {...    30   0.44 
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    30   0.44 
TPHA0K00360 Chr11 (71970..72971) [1002 bp, 333 aa] {ON} Anc_5.56...    30   0.45 
CAGL0L07436g Chr12 (820507..822054) [1548 bp, 515 aa] {ON} simil...    30   0.47 
Suva_4.140 Chr4 complement(258729..260402) [1674 bp, 557 aa] {ON...    30   0.49 
Smik_13.124 Chr13 (210178..211335) [1158 bp, 385 aa] {ON} YML027...    30   0.50 
YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}...    30   0.52 
AER314W Chr5 (1218410..1219705) [1296 bp, 431 aa] {ON} Syntenic ...    30   0.55 
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    30   0.61 
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    30   0.64 
Suva_13.132 Chr13 (211462..212616) [1155 bp, 384 aa] {ON} YML027...    30   0.66 
Smik_4.130 Chr4 complement(246835..248517) [1683 bp, 560 aa] {ON...    30   0.66 
YDL106C Chr4 complement(270222..271901) [1680 bp, 559 aa] {ON}  ...    30   0.67 
TBLA0A01080 Chr1 complement(241869..246641) [4773 bp, 1590 aa] {...    30   0.68 
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    30   0.72 
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    30   0.75 
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    29   0.87 
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    29   0.90 
SAKL0G05896g Chr7 complement(480608..481768) [1161 bp, 386 aa] {...    29   1.0  
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    29   1.1  
ZYRO0D13596g Chr4 complement(1138485..1139834) [1350 bp, 449 aa]...    29   1.3  
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    29   1.4  
TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON...    28   1.5  
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    28   1.6  
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    28   1.8  
KAFR0A06770 Chr1 (1369670..1370845) [1176 bp, 391 aa] {ON} Anc_2...    28   2.1  
NDAI0B03290 Chr2 (841165..842952) [1788 bp, 595 aa] {ON} Anc_2.3...    28   2.6  
NDAI0G02640 Chr7 complement(604606..605268) [663 bp, 220 aa] {ON...    28   2.7  
Kpol_1004.50 s1004 complement(106081..107316) [1236 bp, 411 aa] ...    28   2.7  
KLTH0G04686g Chr7 complement(371252..372379) [1128 bp, 375 aa] {...    28   3.0  
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    28   3.2  
Skud_7.246 Chr7 complement(427922..429340) [1419 bp, 472 aa] {ON...    28   3.2  
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    28   3.5  
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    28   3.6  
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    28   3.7  
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    27   3.8  
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    27   3.8  
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    27   4.5  
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    27   4.6  
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    27   5.0  
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    27   6.0  
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    27   6.1  
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    27   7.5  

>TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925)
          [255 bp, 84 aa] {ON} silenced copy of a1 at HMLalpha
          locus
          Length = 84

 Score =  172 bits (435), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA 60
          MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA
Sbjct: 1  MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA 60

Query: 61 IAKKCGLTPLQVRVWFINKRMRTK 84
          IAKKCGLTPLQVRVWFINKRMRTK
Sbjct: 61 IAKKCGLTPLQVRVWFINKRMRTK 84

>TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948)
          [255 bp, 84 aa] {ON} MATa1 gene at MAT locus
          Length = 84

 Score =  172 bits (435), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA 60
          MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA
Sbjct: 1  MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDA 60

Query: 61 IAKKCGLTPLQVRVWFINKRMRTK 84
          IAKKCGLTPLQVRVWFINKRMRTK
Sbjct: 61 IAKKCGLTPLQVRVWFINKRMRTK 84

>Kpol_2002.48 s2002
          complement(103569..103598,103652..103813,
          103869..103949) [273 bp, 90 aa] {ON}
          complement(103569..103598,103652..103813,
          103869..103949) [273 nt, 91 aa]
          Length = 90

 Score =  156 bits (395), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (97%), Gaps = 2/82 (2%)

Query: 5  IELTLESLQNACKDILS--IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 62
          +ELTLESLQNACKDILS  IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA
Sbjct: 9  LELTLESLQNACKDILSLNIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 68

Query: 63 KKCGLTPLQVRVWFINKRMRTK 84
          KKCGLTPLQVRVWFINKRMR+K
Sbjct: 69 KKCGLTPLQVRVWFINKRMRSK 90

>Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [273
          bp, 90 aa] {ON}
          complement(1157..1186,1240..1401,1457..1537) [273 nt,
          91 aa]
          Length = 90

 Score =  156 bits (395), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (97%), Gaps = 2/82 (2%)

Query: 5  IELTLESLQNACKDILS--IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 62
          +ELTLESLQNACKDILS  IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA
Sbjct: 9  LELTLESLQNACKDILSLNIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 68

Query: 63 KKCGLTPLQVRVWFINKRMRTK 84
          KKCGLTPLQVRVWFINKRMR+K
Sbjct: 69 KKCGLTPLQVRVWFINKRMRSK 90

>Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90
          aa] {ON} (4720..4800,4856..5017,5071..5100) [273 nt, 91
          aa]
          Length = 90

 Score =  156 bits (395), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (97%), Gaps = 2/82 (2%)

Query: 5  IELTLESLQNACKDILS--IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 62
          +ELTLESLQNACKDILS  IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA
Sbjct: 9  LELTLESLQNACKDILSLNIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 68

Query: 63 KKCGLTPLQVRVWFINKRMRTK 84
          KKCGLTPLQVRVWFINKRMR+K
Sbjct: 69 KKCGLTPLQVRVWFINKRMRSK 90

>TBLA0G01060 Chr7
           complement(267271..267300,267367..267663,267722..267919)
           [525 bp, 174 aa] {ON}  silenced copy of mating-type a1
           gene at HMR locus
          Length = 174

 Score = 90.5 bits (223), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 44/82 (53%), Positives = 61/82 (74%), Gaps = 3/82 (3%)

Query: 3   MSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIA 62
           M I L  E+    CK+ ++      +   +K LPKEA+ FLERVF+K+ +LNSKER+A+A
Sbjct: 96  MVIRLDPEA---TCKEPINPQTHVFTSSTRKQLPKEAKEFLERVFKKQHTLNSKEREAVA 152

Query: 63  KKCGLTPLQVRVWFINKRMRTK 84
           K+CG++P+QVRVWFINKRMR+K
Sbjct: 153 KQCGISPIQVRVWFINKRMRSK 174

>Kwal_33.12991 s33 complement(30624..30899) [276 bp, 91 aa] {OFF}
          YCR097W (HMRA1) - haploid specific gene repressor
          [contig 123] FULL
          Length = 91

 Score = 86.3 bits (212), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 58/87 (66%), Gaps = 8/87 (9%)

Query: 4  SIELTLESLQNACKDILS--------IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNS 55
          SI +TLES++ AC  +L         + ++ +   R+    K+ RLFLE VFEKK+S NS
Sbjct: 5  SILITLESIKKACGALLEPDVERRQEVCDKITVGQRRTLFSKDTRLFLESVFEKKKSPNS 64

Query: 56 KERDAIAKKCGLTPLQVRVWFINKRMR 82
          +ER AIA KCGLTP+QVRVWF N+R R
Sbjct: 65 RERKAIADKCGLTPVQVRVWFTNRRWR 91

>YCR097W Chr3 (293835..293939,293994..294239,294292..294321) [381
           bp, 126 aa] {ON}  HMRA1Silenced copy of a1 at HMR;
           homeobox corepressor that interacts with Alpha2p to
           repress haploid-specific gene transcription in diploid
           cells
          Length = 126

 Score = 84.3 bits (207), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 13  QNACKDILSIYNE---SSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTP 69
           +N   + L IY+      S   K  +  +AR FLE+VF +KQSLNSKE++ +AKKCG+TP
Sbjct: 52  KNISNNRLEIYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITP 111

Query: 70  LQVRVWFINKRMRTK 84
           LQVRVWFINKRMR+K
Sbjct: 112 LQVRVWFINKRMRSK 126

>ADL394C Chr4 complement(18058..18366) [309 bp, 102 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YCR097W (HMRA1)
          Length = 102

 Score = 83.2 bits (204), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 60/94 (63%), Gaps = 13/94 (13%)

Query: 4  SIELTLESLQNACKDILS-------IYNESSS------DHRKKFLPKEARLFLERVFEKK 50
          SIE T +++Q  C  +L        I   +S+        R+  LPKE + FLE VFE+K
Sbjct: 3  SIEETAQAIQAICSVLLGEVCVTSLIVIPASALLTGDKQRRRTVLPKETKEFLESVFERK 62

Query: 51 QSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          +  N+KER AIA+KCGLTP+Q+R+WF NKRMR+K
Sbjct: 63 RCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 96

>AFR643C Chr6 complement(1608340..1608648) [309 bp, 102 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YCR097W
          (HMRA1)
          Length = 102

 Score = 81.6 bits (200), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 58/94 (61%), Gaps = 13/94 (13%)

Query: 4  SIELTLESLQNACKDILSIYNESS-------------SDHRKKFLPKEARLFLERVFEKK 50
          SIE T +++Q  C  +L     +S                R+  LPKE + FLE VFE+K
Sbjct: 3  SIEETAQAIQAICSVLLGEVCVTSLIVIPAFALLTGDKQRRRTVLPKETKEFLESVFERK 62

Query: 51 QSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          +  N+KER AIA+KCGLTP+Q+R+WF NKRMR+K
Sbjct: 63 RWPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 96

>Kthe_YGOB_MATa1 Chr6 complement(282329..282664) [336 bp, 111 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 111

 Score = 79.7 bits (195), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 51/93 (54%), Gaps = 13/93 (13%)

Query: 3   MSIELTLESLQNACKDILSIY-------------NESSSDHRKKFLPKEARLFLERVFEK 49
           M +E   +S Q  C  I   Y                S   R+  L K+ RLFLE VFEK
Sbjct: 19  MLLEPNYKSRQEVCDKIYENYATLLQDAVVESKEKPRSGQQRRTLLSKDTRLFLESVFEK 78

Query: 50  KQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           K+S NS+ER AIA KCGLTP QVRVWF NKR R
Sbjct: 79  KRSPNSRERKAIADKCGLTPAQVRVWFANKRCR 111

>AER456W Chr5 (1512285..1512285,1512359..1512531) [174 bp, 57 aa]
          {ON} Non-syntenic homolog of Saccharomyces cerevisiae
          YCR097W (HMRA1); 1-intron
          Length = 57

 Score = 77.0 bits (188), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%)

Query: 35 LPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          LPKE + FLE VFE+K+  N+KER AIA+KCGLTP+Q+R+WF NKRMR+K
Sbjct: 2  LPKETKEFLESVFERKRCPNAKERRAIAEKCGLTPIQIRIWFTNKRMRSK 51

>KNAG0C00795 Chr3
           complement(141421..141450,141508..141732,141810..141878)
           [324 bp, 107 aa] {ON}  mating type gene MATa1 at MAT
           locus
          Length = 107

 Score = 74.7 bits (182), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%)

Query: 17  KDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWF 76
           KD+   Y+       +  + +  RLFLE+VF KKQ L  +ER  IA+KCG++PLQVR+WF
Sbjct: 40  KDLYETYSTIIEQKNRPVISRRTRLFLEKVFTKKQWLTKEERQLIARKCGISPLQVRIWF 99

Query: 77  INKRMRTK 84
           INKR R+K
Sbjct: 100 INKRARSK 107

>KNAG0C01625 Chr3 complement(322219..322248,322306..322698) [423 bp,
           140 aa] {ON}  putative silent copy of mating type a1
           gene equivalent to S. cerevisiae HMRa1
          Length = 140

 Score = 75.1 bits (183), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%)

Query: 13  QNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQV 72
           +   KD+   Y+       +  + +  RLFLE+VF KKQ L  +ER  IA+KCG++PLQV
Sbjct: 69  KGLLKDLYETYSTIIEQKNRPVISRRTRLFLEKVFTKKQWLTKEERQLIARKCGISPLQV 128

Query: 73  RVWFINKRMRTK 84
           R+WFINKR R+K
Sbjct: 129 RIWFINKRARSK 140

>NDAI0A00670 Chr1
          complement(124998..125033,125093..125308,
          125369..125404) [288 bp, 95 aa] {ON}
          Length = 95

 Score = 72.4 bits (176), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%)

Query: 35 LPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          + KE +L LE +F+KK  LN+KER+ +AK CG++ LQVRVWFINKRMRTK
Sbjct: 44 ISKENKLLLENIFQKKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288
          bp, 95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 72.4 bits (176), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%)

Query: 35 LPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          + KE +L LE +F+KK  LN+KER+ +AK CG++ LQVRVWFINKRMRTK
Sbjct: 44 ISKENKLLLENIFQKKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>TDEL0G00190 Chr7 complement(36313..36360,36422..36712) [339 bp, 112
           aa] {ON}  silenced copy of a1 gene at T. delbrueckii
           HMR-1 locus
          Length = 112

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 43/57 (75%)

Query: 26  SSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           +SS   +K L  E RL LER++E+K++LNSKER  +AK CGL+P QVRVWF NKR R
Sbjct: 48  TSSTVTRKRLSDEVRLLLERLYERKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>TDEL0C05820 Chr3 (1050752..1051042,1051104..1051151) [339 bp, 112
           aa] {ON} Anc_1.120 MATa1 gene at T. delbrueckii MAT
           locus
          Length = 112

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 43/57 (75%)

Query: 26  SSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           +SS   +K L  E RL LER++E+K++LNSKER  +AK CGL+P QVRVWF NKR R
Sbjct: 48  TSSTVTRKRLSDEVRLLLERLYERKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>TDEL0E00330 Chr5 complement(75774..75821,75883..76173) [339 bp, 112
           aa] {ON}  silenced copy of a1 gene at T. delbrueckii
           HMR-2 locus
          Length = 112

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 43/57 (75%)

Query: 26  SSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           +SS   +K L  E RL LER++E+K++LNSKER  +AK CGL+P QVRVWF NKR R
Sbjct: 48  TSSTVTRKRLSDEVRLLLERLYERKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>ZYRO0C18348g Chr3 (1436144..1436218,1436270..1436617) [423 bp, 140
           aa] {ON} some similarities with uniprot|Q06724
           Saccharomyces cerevisiae YCR097W
          Length = 140

 Score = 70.5 bits (171), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 39/48 (81%)

Query: 31  RKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFIN 78
           + K   KE+R FLERVFE+K++LNS+ER+A+A  CGLTP+QVR+W  N
Sbjct: 91  KNKAFSKESRNFLERVFERKRTLNSREREAVAANCGLTPIQVRIWVCN 138

>Suva_3.138 Chr3 (212009..212254) [246 bp, 82 aa] {ON} YCR097W
          (REAL)
          Length = 82

 Score = 68.6 bits (166), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 13 QNACKDILSIYN--ESSSDHR-KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTP 69
          +N   + L IY+  +   +H+ K  +  +AR FLE+VF++KQSLNSKE++ +AKKCG+TP
Sbjct: 17 KNISNNRLEIYHGIKKEKNHKGKSSISPQARAFLEQVFKRKQSLNSKEKEEVAKKCGITP 76

Query: 70 LQVRVW 75
          LQVRVW
Sbjct: 77 LQVRVW 82

>Suva_3.77 Chr3 (113778..114023) [246 bp, 82 aa] {ON} YCR097W
          (REAL)
          Length = 82

 Score = 68.6 bits (166), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 13 QNACKDILSIYN--ESSSDHR-KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTP 69
          +N   + L IY+  +   +H+ K  +  +AR FLE+VF++KQSLNSKE++ +AKKCG+TP
Sbjct: 17 KNISNNRLEIYHGIKKEKNHKGKSSISPQARAFLEQVFKRKQSLNSKEKEEVAKKCGITP 76

Query: 70 LQVRVW 75
          LQVRVW
Sbjct: 77 LQVRVW 82

>Skud_80.2 Chr80 complement(176..448,504..608) [378 bp, 125 aa] {ON}
           YCR097W (REAL)
          Length = 125

 Score = 68.6 bits (166), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%)

Query: 32  KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVW 75
           K  +  +AR FLE+VF KKQSLNSKE++ +AKKCG+TPLQVRVW
Sbjct: 74  KSSISPQARAFLEQVFRKKQSLNSKEKEEVAKKCGITPLQVRVW 117

>Smik_3.143 Chr3 (198230..198334,198389..198661) [378 bp, 125 aa]
           {ON} YCR097W (REAL)
          Length = 125

 Score = 67.0 bits (162), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 40/51 (78%)

Query: 32  KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           K  +  +AR FLE+VF +KQSLNSKE++ +AKKCG+TPLQVRVW    R++
Sbjct: 74  KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWVCIMRIK 124

>NCAS0A15350 Chr1
           (3019029..3019088,3019146..3019367,3019420..3019449)
           [312 bp, 103 aa] {ON} 
          Length = 103

 Score = 66.6 bits (161), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 40/53 (75%)

Query: 32  KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           K  + K+ ++ LE++F KK  LN KER  +A+KCGL+P QVRVWFINKR R+K
Sbjct: 51  KYIIDKDKKILLEQIFRKKHWLNKKERAFVAEKCGLSPRQVRVWFINKRTRSK 103

>NCAS0B08560 Chr2
           (1643716..1643775,1643833..1644054,1644107..1644136)
           [312 bp, 103 aa] {ON}  YCR097W
          Length = 103

 Score = 66.2 bits (160), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 40/53 (75%)

Query: 32  KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           K  + K+ ++ LE++F KK  LN KER  +A+KCGL+P QVRVWFINKR R+K
Sbjct: 51  KYIIDKDKKILLEQIFRKKHWLNKKERAFVAEKCGLSPRQVRVWFINKRTRSK 103

>Smik_88.2 Chr88 complement(174..446,501..761) [534 bp, 177 aa] {ON}
           YCR097W (REAL)
          Length = 177

 Score = 67.0 bits (162), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 35/38 (92%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVW 75
           +AR FLE+VF +KQSLNSKE++ +AKKCG+TPLQVRVW
Sbjct: 132 QARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVW 169

>SAKL0C03674g Chr3 complement(347672..348232) [561 bp, 186 aa] {ON}
           some similarities with uniprot|P01366 Saccharomyces
           cerevisiae YCR097W Silenced copy of a1 at HMR
          Length = 186

 Score = 66.6 bits (161), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%)

Query: 31  RKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVW 75
           ++  +PKE + FLE +FEKK+S NS+ER AIA KCGLTP+QVRVW
Sbjct: 131 KRTLIPKETKDFLESLFEKKRSPNSRERKAIADKCGLTPVQVRVW 175

>Kwal_YGOB_HMa1 s33 complement(22840..23093,23178..23241) [318 bp,
           105 aa] {ON} ANNOTATED BY YGOB - Sequence at 3
          Length = 105

 Score = 60.1 bits (144), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 8/73 (10%)

Query: 4   SIELTLESLQNACKDILS--------IYNESSSDHRKKFLPKEARLFLERVFEKKQSLNS 55
           SI +TLES++ AC  +L         + ++ +   R+    K+ RLFLE VFEKK+S NS
Sbjct: 31  SILITLESIKKACGALLEPDVERRQEVCDKITVGQRRTLFSKDTRLFLESVFEKKKSPNS 90

Query: 56  KERDAIAKKCGLT 68
           +ER AIA KCGL+
Sbjct: 91  RERKAIADKCGLS 103

>KLLA0C03135g Chr3 complement(279869..280555) [687 bp, 228 aa] {ON}
           highly similar to uniprot|Q9HG12 Kluyveromyces lactis
           KLLA0B14553g HMRA1 Mating-type protein A1
          Length = 228

 Score = 61.6 bits (148), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 30  HRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           +++ F+  E+R  LE++F+ KQ  N+ ER  IA+K  LTP QVR+WF NKRMR K
Sbjct: 157 YKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAK 211

>KLLA0B14553g Chr2 complement(1278622..1279308) [687 bp, 228 aa]
           {ON} uniprot|Q9HG12 Kluyveromyces lactis KLLA0B14553g
           HMRA1 Mating-type protein A1
          Length = 228

 Score = 61.6 bits (148), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 30  HRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           +++ F+  E+R  LE++F+ KQ  N+ ER  IA+K  LTP QVR+WF NKRMR K
Sbjct: 157 YKRSFIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAK 211

>KLTH0F00242g Chr6 complement(21856..22284) [429 bp, 142 aa] {ON}
           conserved hypothetical protein
          Length = 142

 Score = 60.1 bits (144), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/46 (60%), Positives = 34/46 (73%)

Query: 27  SSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQV 72
           S   R+  L K+ RLFLE VFEKK+S NS+ER AIA KCGLTP+ +
Sbjct: 56  SGQQRRTLLSKDTRLFLESVFEKKRSPNSRERKAIADKCGLTPIYI 101

>KAFR0G00180 Chr7 complement(60883..61254,61328..61351) [396 bp, 131
           aa] {ON}  mating type gene MATa1
          Length = 131

 Score = 59.7 bits (143), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            LE+V+  KQ L  +ER+ +AK+C +TPLQVR+WFINKR R+K
Sbjct: 89  LLEKVYATKQWLTKEERELVAKRCQITPLQVRIWFINKRSRSK 131

>CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 bp,
           130 aa] {ON} similar to uniprot|P09091 Saccharomyces
           cerevisiae YCR097w Mating-type protein a1
          Length = 130

 Score = 48.5 bits (114), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 32  KKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           +K LP +A+L L   F KK+ L   E+  +A +CG+T  QV++WF N+R R+K
Sbjct: 72  RKPLPAKAKLQLVETFSKKRYLTRCEKHQLAVQCGITTNQVQIWFANRRKRSK 124

>KNAG0C02770 Chr3 complement(539538..540503) [966 bp, 321 aa] {ON}
           Anc_5.567 YML027W
          Length = 321

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 36/56 (64%)

Query: 25  ESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKR 80
           E SS  +++   KE +  L++ FE+ ++ N +E+  +AKKC ++   ++VWF N+R
Sbjct: 211 EVSSKPKRRRTTKEQKDILKKAFERNKAPNKQEKLELAKKCNMSEKAIQVWFQNQR 266

>ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 497

 Score = 37.4 bits (85), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 35/66 (53%)

Query: 19  ILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFIN 78
           ++S  + SSS  ++     EA   L+R FE   +  S+ R  +++  GL    VR+WF N
Sbjct: 75  VISNSDNSSSKPKRTRARGEALDILKREFETNPNPTSQRRKKLSEMTGLPEKNVRIWFQN 134

Query: 79  KRMRTK 84
           +R + +
Sbjct: 135 RRAKLR 140

>TDEL0G02680 Chr7 complement(512112..513647) [1536 bp, 511 aa] {ON}
           Anc_2.337 YDL106C
          Length = 511

 Score = 37.4 bits (85), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 24  NESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRT 83
           N+  S  ++     EA  FL++ FE   +  S+ R  I++  GL    VR+WF N+R + 
Sbjct: 87  NKKGSKPKRTRATGEALDFLKKEFEANPNPTSQRRKKISELTGLPEKNVRIWFQNRRAKL 146

Query: 84  K 84
           +
Sbjct: 147 R 147

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 25  ESSSDHRKKFLPKEARLFLE---RVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRM 81
           E+   HR+  LPKE    L    R        + +E+  + K+ GL P+Q+  WFIN R 
Sbjct: 128 ETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRR 187

Query: 82  R 82
           R
Sbjct: 188 R 188

>KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 484

 Score = 35.8 bits (81), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           EA   L+R FE+  + N++ R  I++  GL    VR+WF N+R + +
Sbjct: 76  EALNILKREFEENPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHR 122

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 35.0 bits (79), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 26  SSSDHRKKFLPKEARLFLE---RVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           +   HR+  LPKE    L    R        + +E+  + K+ GL P+Q+  WFIN R R
Sbjct: 221 TKKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 280

>TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa]
           {ON} Anc_2.337 YDL106C
          Length = 645

 Score = 34.7 bits (78), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 32/61 (52%)

Query: 24  NESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRT 83
           N ++   ++     EA   L++ F+   + NSK R  +++  GL    VR+WF N+R + 
Sbjct: 122 NTNTHRQKRTRATGEALDLLKQEFKLNPNPNSKRRKMLSESTGLPEKNVRIWFQNRRAKV 181

Query: 84  K 84
           +
Sbjct: 182 R 182

>KLLA0D10043g Chr4 (849549..851015) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q755L6 Ashbya gossypii AFL202C AFL202Cp and
           weakly similar to YDL106C uniprot|P07269 Saccharomyces
           cerevisiae YDL106C PHO2 Homeobox transcription factor
           regulatory targets include genes involved in phosphate
           metabolism binds cooperatively with Pho4p to the PHO5
           promoter phosphorylation of Pho2p facilitates
           interaction with Pho4p
          Length = 488

 Score = 34.7 bits (78), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           EA   L+R F+   S N++ R  I++  GL    VR+WF N+R +
Sbjct: 107 EALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSK 151

>Kwal_23.3494 s23 complement(318582..319982) [1401 bp, 466 aa] {ON}
           YDL106C (PHO2) - Homeobox-domain containing
           transcription fractor which is a positive regulator of
           PHO5 and other genes. [contig 252] FULL
          Length = 466

 Score = 34.7 bits (78), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           EA   L+R F++  + N++ R  I++  GL    VR+WF N+R + +
Sbjct: 63  EALNVLKREFDQNPNPNAQNRKRISELTGLPEKNVRIWFQNRRAKHR 109

>KAFR0C05600 Chr3 complement(1115478..1116632) [1155 bp, 384 aa]
           {ON} Anc_5.567 YML027W
          Length = 384

 Score = 34.3 bits (77), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F+K  + + KER  +A +C +T   V++WF NKR   K
Sbjct: 168 ILQASFDKCPTPDKKERLELADRCNMTEKAVQIWFQNKRQAVK 210

>AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL106C
           (PHO2)
          Length = 481

 Score = 34.3 bits (77), Expect = 0.017,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           EA   L++ F+   + N++ R  I+++ GL    VR+WF N+R + +
Sbjct: 70  EALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYR 116

>Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}
           similar to Ashbya gossypii AFL202C
          Length = 491

 Score = 33.9 bits (76), Expect = 0.021,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           EA   L++ F+   + N++ R  I+++ GL    VR+WF N+R + +
Sbjct: 79  EALELLKKEFDINPNPNAQNRKRISEQTGLPEKNVRIWFQNRRAKYR 125

>TBLA0D01390 Chr4 (348236..349096) [861 bp, 286 aa] {ON} Anc_5.567
           YML027W
          Length = 286

 Score = 33.1 bits (74), Expect = 0.040,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 25  ESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           E     R++   KE  + L   F K  + N  +R  ++++C +T   V++WF N+R   K
Sbjct: 187 EKPKSKRRRTTTKEWNILLNE-FNKNPNPNKIKRIQLSQQCNMTEKTVQIWFQNRRQANK 245

>Ecym_4103 Chr4 complement(207513..208808) [1296 bp, 431 aa] {ON}
           similar to Ashbya gossypii AER314W
          Length = 431

 Score = 32.3 bits (72), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKR--MRTK 84
            L++ FEK ++ + + R  +A +C +T   V++WF NKR  MR K
Sbjct: 215 ILQQEFEKCRAPSKERRMQLAPRCNMTEKAVQIWFQNKRQGMRKK 259

>Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON}
           (47321..48904) [1584 nt, 528 aa]
          Length = 527

 Score = 32.3 bits (72), Expect = 0.087,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           EA   L+  F    +  SK R  +++  GL+  +VR+WF N+R + +
Sbjct: 131 EALDILKSEFNLNPNPTSKRRKVLSELTGLSEKKVRIWFQNRRAKVR 177

>NDAI0C00850 Chr3 (166280..167653) [1374 bp, 457 aa] {ON} Anc_5.567
           YDR451C
          Length = 457

 Score = 32.0 bits (71), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 41  LFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           L L+  FE+  + N K+R  +A+ C ++   V++WF NKR   K
Sbjct: 222 LILQTEFERCPTPNKKKRLELAEICKMSDKSVQIWFQNKRQSVK 265

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
            LE +     ++  K RD +AK  GLT LQ+  WFIN R R
Sbjct: 211 LLEHIHNPYPTVQEK-RDLLAK-TGLTKLQISNWFINARRR 249

>NCAS0H02770 Chr8 complement(542783..544024) [1242 bp, 413 aa] {ON}
           Anc_5.567 YDR451C
          Length = 413

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FEK  + + + R  +AK+C +T   V++WF NKR   K
Sbjct: 197 ILQAEFEKCSTPSKQVRLELAKRCSMTDKAVQIWFQNKRQSMK 239

>Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {ON}
           YDR451C (REAL)
          Length = 357

 Score = 31.2 bits (69), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F++  + N  +R  ++++C ++   V++WF NKR   K
Sbjct: 189 ILQTAFDECPTPNKTKRTELSEQCNMSEKSVQIWFQNKRQAAK 231

>KNAG0A05600 Chr1 complement(833013..834893) [1881 bp, 626 aa] {ON}
           Anc_2.337 YDL106C
          Length = 626

 Score = 31.2 bits (69), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 26  SSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           S +  ++K    E    LE+ FE   S +  +R  IAK   +    V +WF N+R + K
Sbjct: 76  SHARAKRKRAKGETLDILEKEFETNPSPSIDQRKVIAKMIDMPMKNVTIWFQNRRAKFK 134

>SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} similar
           to uniprot|Q755L6 Ashbya gossypii AFL202C AFL202Cp and
           weakly similar to YDL106C uniprot|P07269 Saccharomyces
           cerevisiae YDL106C PHO2 Homeobox transcription factor
           regulatory targets include genes involved in phosphate
           metabolism binds cooperatively with Pho4p to the PHO5
           promoter phosphorylation of Pho2p facilitates
           interaction with Pho4p
          Length = 491

 Score = 30.8 bits (68), Expect = 0.24,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 24  NESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           N+     ++     EA   L+R F+   + N++ R  I+    L    VR+WF N+R +
Sbjct: 67  NDGKPKTKRTRATGEALAILKREFDVNPNPNAQNRKRISDMTNLPEKNVRIWFQNRRAK 125

>KAFR0E04495 Chr5 (914267..915091) [825 bp, 274 aa] {ON}
          Length = 274

 Score = 30.8 bits (68), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 32/50 (64%)

Query: 18  DILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGL 67
           D+LS  +  ++D +KK++ + +RL L +  E++Q +N+  RD + +  GL
Sbjct: 155 DMLSKIDGKTTDEKKKWVDRCSRLLLGKSQEEEQLVNTFSRDQVNRYEGL 204

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 30.8 bits (68), Expect = 0.27,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           +E+  +  K GLT LQ+  WFIN R R
Sbjct: 223 QEKRELLAKTGLTKLQISNWFINARRR 249

>NCAS0B05980 Chr2 (1131961..1133442) [1482 bp, 493 aa] {ON}
           Anc_2.337
          Length = 493

 Score = 30.8 bits (68), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%)

Query: 31  RKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           R+K    E    L+  FE   + +++ER  I+   G+    VR+WF N+R + K
Sbjct: 96  RRKRAKGEELNILKSHFELNPNPSNEERKKISNLVGMPEKSVRIWFQNRRAKVK 149

>TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa]
          {ON} Anc_2.337 YDL106C
          Length = 548

 Score = 30.8 bits (68), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 38 EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          EA   L+  F K  + +SK R  +++  GL+  ++R+WF N+R + +
Sbjct: 48 EALDVLKAEFLKNTNPSSKRRKVLSEVTGLSEKKIRIWFQNRRAKMR 94

>KNAG0B03460 Chr2 (669607..670956) [1350 bp, 449 aa] {ON} Anc_5.567
           YML027W
          Length = 449

 Score = 30.8 bits (68), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FE   + N ++R  +A++C ++   V++WF NKR   K
Sbjct: 213 ILQAGFEICPTPNRQQRAELAERCDMSEKAVQIWFQNKRQSIK 255

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 30.4 bits (67), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 25  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 80
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 30.4 bits (67), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 25  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 80
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 30.4 bits (67), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 57  ERDAIAKKCGLTPLQVRVWFINKRMR 82
           E++ + K+ GLT +Q+  WFIN R R
Sbjct: 300 EKNELLKQTGLTKIQLSNWFINVRRR 325

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 30.4 bits (67), Expect = 0.35,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           +E+  +  K GLT LQ+  WFIN R R
Sbjct: 225 QEKRELLAKTGLTKLQISNWFINARRR 251

>CAGL0G07249g Chr7 complement(688189..689226) [1038 bp, 345 aa] {ON}
           similar to uniprot|P34161 Saccharomyces cerevisiae
           YML027w YOX1 homoeodomain protein
          Length = 345

 Score = 30.4 bits (67), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKR 80
            L+  F++  + + + R  +A++C +T   V+VWF NKR
Sbjct: 168 ILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKR 206

>Skud_13.124 Chr13 (207585..208745) [1161 bp, 386 aa] {ON} YML027W
           (REAL)
          Length = 386

 Score = 30.4 bits (67), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FEK  + + ++R  +A  C +T   +++WF NKR   K
Sbjct: 190 ILQGEFEKCPAPSKEKRTELADSCHMTEKAIQIWFQNKRQAVK 232

>Skud_4.148 Chr4 complement(265683..267374) [1692 bp, 563 aa] {ON}
           YDL106C (REAL)
          Length = 563

 Score = 30.4 bits (67), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           EA   L+R FE   + +  ER  I+   G+    VR+WF N+R +
Sbjct: 90  EALDVLKRKFEVNPTPSLVERKKISDLVGMPEKNVRIWFQNRRAK 134

>Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {ON}
           YDR451C (REAL)
          Length = 346

 Score = 30.4 bits (67), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F++  + N  +R  ++++C ++   V++WF NKR   K
Sbjct: 178 ILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAK 220

>YML027W Chr13 (221406..222563) [1158 bp, 385 aa] {ON}
           YOX1Homeodomain-containing transcriptional repressor,
           binds to Mcm1p and to early cell cycle boxes (ECBs) in
           the promoters of cell cycle-regulated genes expressed in
           M/G1 phase; expression is cell cycle-regulated;
           potential Cdc28p substrate
          Length = 385

 Score = 30.4 bits (67), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FEK  + + ++R  +A+ C +T   V++WF NKR   K
Sbjct: 190 ILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVK 232

>Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {ON}
           YDR451C (REAL)
          Length = 348

 Score = 30.0 bits (66), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F++  + N  +R  ++++C ++   V++WF NKR   K
Sbjct: 184 ILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAK 226

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 30.0 bits (66), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 26  SSSDHRKKFLPKEARLFLER---VFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           SS  +++  LPKE    L             + +E+  +  K GL P+Q+  WFIN R R
Sbjct: 204 SSPSNKRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRR 263

>TPHA0K00360 Chr11 (71970..72971) [1002 bp, 333 aa] {ON} Anc_5.567
           YML027W
          Length = 333

 Score = 30.0 bits (66), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L   F+  Q++    R  +A KC ++   V++WF NKR   K
Sbjct: 152 ILNEQFKLSQTIGRTTRMELANKCSMSEKAVQIWFQNKRQAIK 194

>CAGL0L07436g Chr12 (820507..822054) [1548 bp, 515 aa] {ON}
          similar to uniprot|P07269 Saccharomyces cerevisiae
          YDL106c GRF10 homeodomain protein
          Length = 515

 Score = 30.0 bits (66), Expect = 0.47,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 27/47 (57%)

Query: 38 EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          E+   L+  F+   + + +ER+ I++  G+    VR+WF N+R + +
Sbjct: 15 ESLDILKSSFQLNPNPSLQERNRISELTGMPEKNVRIWFQNRRAKVR 61

>Suva_4.140 Chr4 complement(258729..260402) [1674 bp, 557 aa] {ON}
           YDL106C (REAL)
          Length = 557

 Score = 30.0 bits (66), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           EA   L+R FE   + +  ER  I+   G+    VR+WF N+R +
Sbjct: 86  EALDVLKRKFEMNPTPSLVERKKISDLIGMPEKNVRIWFQNRRAK 130

>Smik_13.124 Chr13 (210178..211335) [1158 bp, 385 aa] {ON} YML027W
           (REAL)
          Length = 385

 Score = 30.0 bits (66), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FEK  + + ++R  +A  C +T   V++WF NKR   K
Sbjct: 190 ILQAEFEKCPAPSKEKRIELADSCHMTEKAVQIWFQNKRQAVK 232

>YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}
           YHP1One of two homeobox transcriptional repressors (see
           also Yox1p), that bind to Mcm1p and to early cell cycle
           box (ECB) elements of cell cycle regulated genes,
           thereby restricting ECB-mediated transcription to the
           M/G1 interval
          Length = 353

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F++  + N  +R  ++++C ++   V++WF NKR   K
Sbjct: 187 ILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAK 229

>AER314W Chr5 (1218410..1219705) [1296 bp, 431 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML027W (YOX1) and
           YDR451C (YHP1)
          Length = 431

 Score = 30.0 bits (66), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%)

Query: 21  SIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKR 80
           SI N   +  +++   K     L++ F++ ++ + ++R  +A +C +T   V++WF NKR
Sbjct: 190 SIDNAPLARRKRRRTSKHELTILQQEFDQCRTPSKEKRIELATRCNMTEKAVQIWFQNKR 249

Query: 81  MRTK 84
              K
Sbjct: 250 QSMK 253

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 29.6 bits (65), Expect = 0.61,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           +E+  +  + GLT LQ+  WFIN R R
Sbjct: 225 QEKRELLAQTGLTKLQISNWFINARRR 251

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 29.6 bits (65), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 55  SKERDAIAKKCGLTPLQVRVWFINKRMR 82
           ++E+  + K+ GLT +Q+  WFIN R R
Sbjct: 335 TQEKKELLKQTGLTKIQLSNWFINVRRR 362

>Suva_13.132 Chr13 (211462..212616) [1155 bp, 384 aa] {ON} YML027W
           (REAL)
          Length = 384

 Score = 29.6 bits (65), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FEK  +   ++R  +A +C +T   +++WF NKR   K
Sbjct: 190 ILQAEFEKCPAPTKEKRIELADRCHMTEKAIQIWFQNKRQAVK 232

>Smik_4.130 Chr4 complement(246835..248517) [1683 bp, 560 aa] {ON}
           YDL106C (REAL)
          Length = 560

 Score = 29.6 bits (65), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           EA   L+R FE   + +  ER  I+   G+    VR+WF N+R +
Sbjct: 88  EALDVLKRKFELNPTPSLVERKKISDLIGMPEKNVRIWFQNRRAK 132

>YDL106C Chr4 complement(270222..271901) [1680 bp, 559 aa] {ON}
           PHO2Homeobox transcription factor; regulatory targets
           include genes involved in phosphate metabolism; binds
           cooperatively with Pho4p to the PHO5 promoter;
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 559

 Score = 29.6 bits (65), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 38  EARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           EA   L+R FE   + +  ER  I+   G+    VR+WF N+R +
Sbjct: 87  EALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAK 131

>TBLA0A01080 Chr1 complement(241869..246641) [4773 bp, 1590 aa] {ON}
            Anc_7.154 YER008C
          Length = 1590

 Score = 29.6 bits (65), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 15/71 (21%)

Query: 5    IELTLESLQNACKDILSIYNESSSD----------HRKKFLPKEARLFLERVFEK----- 49
            IEL L+SL NA K I    NE + D          +R+K   K  ++FL++V        
Sbjct: 1005 IELQLQSLYNALKAIKGDENEKTKDYDLGEMNALKYRRKTYEKVTKVFLKKVVNDLDAKF 1064

Query: 50   KQSLNSKERDA 60
              SLNS + DA
Sbjct: 1065 DSSLNSAKSDA 1075

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 29.6 bits (65), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 5   IELTLESLQNACKDILSIYNESSSDHRKKFLPKE-ARLFLERVFEKKQSLNSKER-DAIA 62
           IE TL+S+ N  KD+L         H   +LP +  RL+L     K   LN+KE  D +A
Sbjct: 155 IETTLDSIYNRIKDLL-------YKHEDPYLPYDLLRLYLNLFANKDSQLNNKEAIDVLA 207

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 29.6 bits (65), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           +E+  + K+ GLT +Q+  WFIN R R
Sbjct: 187 QEKKELLKQTGLTKIQLSNWFINVRRR 213

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 29.3 bits (64), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 8   TLESLQNACKDILSIYNESSSDHRKKFLPKEA----RLFLERVFEKKQSLNSKERDAIAK 63
           T+E+L N    I S   +S S   +  LPKE       +L          + ++RD + K
Sbjct: 50  TIEALLNESSPI-SNSMDSKSRQSRSNLPKETIQILNAWLLNHLHNPYPTSQEKRDLLIK 108

Query: 64  KCGLTPLQVRVWFINKRMR 82
             GLT +Q+  WFIN R R
Sbjct: 109 -TGLTKIQLSNWFINVRRR 126

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 29.3 bits (64), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 30  HRKKFLPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           HR   LP E    LE  F +   K  LN +    +  +  L+P+Q++ W  N+R + K
Sbjct: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213

>SAKL0G05896g Chr7 complement(480608..481768) [1161 bp, 386 aa] {ON}
           similar to uniprot|P34161 Saccharomyces cerevisiae
           YML027W YOX1 Homeodomain-containing transcriptional
           repressor binds to Mcm1p and to early cell cycle boxes
           (ECBs) in the promoters of cell cycle-regulated genes
           expressed in M/G1 phase expression is cell
           cycle-regulated potential Cdc28p substrate
          Length = 386

 Score = 29.3 bits (64), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FE   + + ++R  +A++C ++   V++WF NKR   K
Sbjct: 183 ILQAEFEACSTPDKQKRIELAQRCSMSEKAVQIWFQNKRQSVK 225

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 31  RKKFLPKEA-RLFLERVFEKKQSL--NSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           R+  LPKE  R+    +    Q+    S+E+  +  K GLT +Q+  WFIN R R
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRR 320

>ZYRO0D13596g Chr4 complement(1138485..1139834) [1350 bp, 449 aa]
           {ON} similar to uniprot|P34161 Saccharomyces cerevisiae
           YML027W YOX1 Homeodomain-containing transcriptional
           repressor binds to Mcm1p and to early cell cycle boxes
           (ECBs) in the promoters of cell cycle-regulated genes
           expressed in M/G1 phase expression is cell
           cycle-regulated potential Cdc28p substrate
          Length = 449

 Score = 28.9 bits (63), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FE   + + K+R  +A++C ++   V++WF N+R   K
Sbjct: 183 ILQAEFELCSAPDKKKRQELAERCNMSEKAVQIWFQNRRQAIK 225

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 28.9 bits (63), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 26  SSSDHRKKF---LPKEARLFLERVFEK---KQSLNSKERDAIAKKCGLTPLQVRVWFINK 79
           SS   RK+    LPK+  L L R            S+E+  +  K GL+ +Q+  WFIN 
Sbjct: 171 SSGRDRKQSRYNLPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINV 230

Query: 80  RMR 82
           R R
Sbjct: 231 RRR 233

>TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON}
           Anc_5.567 YML027W
          Length = 330

 Score = 28.5 bits (62), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F    + + ++R  +A++C ++   V++WF NKR  +K
Sbjct: 175 ILQAEFNACPAPDKRKRQELAERCNMSEKAVQIWFQNKRQASK 217

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 28.5 bits (62), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 17/69 (24%)

Query: 14  NACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVR 73
           N  KD + I N+   DH     P +                 +E+  +  K GLT +Q+ 
Sbjct: 81  NLPKDTIQILNQWLLDHIHNPYPTQ-----------------QEKRDLLIKTGLTKIQLS 123

Query: 74  VWFINKRMR 82
            WFIN R R
Sbjct: 124 NWFINVRRR 132

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 55  SKERDAIAKKCGLTPLQVRVWFINKRMR 82
           S+E+  +  K GLT +Q+  WFIN R R
Sbjct: 156 SQEKRELLIKTGLTKVQLSNWFINVRRR 183

>KAFR0A06770 Chr1 (1369670..1370845) [1176 bp, 391 aa] {ON}
          Anc_2.337 YDL106C
          Length = 391

 Score = 28.1 bits (61), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 42 FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
          FL++ F+   S + ++R  IAK   L    V +WF N+R + K
Sbjct: 34 FLKQQFKSNPSPSVQQRREIAKLIDLPEKTVTIWFQNRRAKLK 76

>NDAI0B03290 Chr2 (841165..842952) [1788 bp, 595 aa] {ON} Anc_2.337
           YDL106C
          Length = 595

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 43  LERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
           L++ F++    + +ER  I+K   +    VR+WF N+R + K
Sbjct: 110 LKQYFDQNPIPSLQERKNISKLTNMPEKNVRIWFQNRRAKLK 151

>NDAI0G02640 Chr7 complement(604606..605268) [663 bp, 220 aa] {ON}
           Anc_8.315 YLR119W
          Length = 220

 Score = 27.7 bits (60), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 4   SIELTLESLQNACKDI-LSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLN 54
           ++E+ L+ L N C ++ +S+Y+    D  K     +  LF++   EK+Q  +
Sbjct: 152 NVEMYLKRLDNECTNLEVSMYDTQGQDGMKNIDMNQLNLFVKEYLEKRQKFH 203

>Kpol_1004.50 s1004 complement(106081..107316) [1236 bp, 411 aa]
           {ON} complement(106081..107316) [1236 nt, 412 aa]
          Length = 411

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  F K  + + ++R  +A++C ++   V++WF N+R   K
Sbjct: 200 ILQNEFAKDATPDKQKRIYLAERCKMSEKAVQIWFQNRRQAEK 242

>KLTH0G04686g Chr7 complement(371252..372379) [1128 bp, 375 aa] {ON}
           similar to uniprot|P34161 Saccharomyces cerevisiae
           YML027W YOX1 Homeodomain-containing transcriptional
           repressor binds to Mcm1p and to early cell cycle boxes
           (ECBs) in the promoters of cell cycle- regulated genes
           expressed in M/G1 phase expression is cell
           cycle-regulated potential Cdc28p substrate
          Length = 375

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 42  FLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK 84
            L+  FE   + + ++R  ++K+C ++   +++WF NKR   K
Sbjct: 176 ILQSEFEICPTPDKQKRAELSKRCCMSEKAIQIWFQNKRQSVK 218

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 24  NESSSDHRKKFLPKEA-----RLFLERVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFIN 78
           ++ S   R+  LPKE      R  L+ +     +   K RD + K  GLT +Q+  WFIN
Sbjct: 73  HKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEK-RDLLIK-TGLTKIQLSNWFIN 130

Query: 79  KRMR 82
            R R
Sbjct: 131 VRRR 134

>Skud_7.246 Chr7 complement(427922..429340) [1419 bp, 472 aa] {ON}
          YGL038C (REAL)
          Length = 472

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 9/57 (15%)

Query: 8  TLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLERVFEKKQSLNSKERDAIAKK 64
          +L S   + K +LS ++ S SD++K  LP  + L         Q LN +++ A+ KK
Sbjct: 26 SLLSFHLSNKRLLSQFHPSKSDYKKTLLPTTSHL---------QDLNLRKQSAVGKK 73

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 27.7 bits (60), Expect = 3.5,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 54  NSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           N +E+  + +  GLT +Q+  WFIN R R
Sbjct: 209 NVQEKKLLLELTGLTKVQLSNWFINVRRR 237

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 27.7 bits (60), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 28  SDHRKKFLPKEARLFLERVFE---KKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMR 82
           S+ R+  LPKE    L        +      +E+  +  K GLT +Q+  WFIN R R
Sbjct: 129 SNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRR 186

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 27.7 bits (60), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 61  IAKKCGLTPLQVRVWFINKRMR 82
           + +K GL P+Q+  WFIN R R
Sbjct: 285 LLEKTGLNPVQLSNWFINVRRR 306

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 27.3 bits (59), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 15  ACKDILSIYNESSSDHRKKFLPKEARLFLERVFE---KKQSLNSKERDAIAKKCGLTPLQ 71
             +D++++ N +   +R     KE    LER +     +  LN +  + +  K GL+ +Q
Sbjct: 119 VTQDMMNL-NRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQ 177

Query: 72  VRVWFINKRMRTK 84
           ++ W  N+R + K
Sbjct: 178 IKNWVSNRRRKEK 190

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 27.3 bits (59), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           +E+  ++ K GLT +Q+  WFIN R R
Sbjct: 192 QEKMELSLKTGLTKIQLSNWFINVRRR 218

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 27.3 bits (59), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 64  KCGLTPLQVRVWFINKRMR 82
           K GLT +Q+  WFIN R R
Sbjct: 189 KTGLTKIQLSNWFINVRRR 207

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 27.3 bits (59), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 64  KCGLTPLQVRVWFINKRMR 82
           K GLT +Q+  WFIN R R
Sbjct: 201 KTGLTKIQLSNWFINVRRR 219

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 27.3 bits (59), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 64  KCGLTPLQVRVWFINKRMR 82
           K GLT +Q+  WFIN R R
Sbjct: 190 KTGLTKIQLSNWFINVRRR 208

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 26.9 bits (58), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 13/19 (68%)

Query: 64  KCGLTPLQVRVWFINKRMR 82
           K GLT +Q+  WFIN R R
Sbjct: 187 KTGLTKIQLSNWFINVRRR 205

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 26.9 bits (58), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           KE++ + +  GL+ +Q+  WFIN R R
Sbjct: 184 KEKEELLELTGLSKIQLSNWFINVRRR 210

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 26.6 bits (57), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 56  KERDAIAKKCGLTPLQVRVWFINKRMR 82
           KE+  +    GLT +Q+  WFIN R R
Sbjct: 206 KEKSELLVLTGLTKIQLSNWFINVRRR 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,711,574
Number of extensions: 262896
Number of successful extensions: 1432
Number of sequences better than 10.0: 126
Number of HSP's gapped: 1426
Number of HSP's successfully gapped: 126
Length of query: 84
Length of database: 53,481,399
Length adjustment: 56
Effective length of query: 28
Effective length of database: 47,060,103
Effective search space: 1317682884
Effective search space used: 1317682884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)