Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E040401.3ON35735717250.0
Suva_3.1501.3ON36133711921e-164
NCAS0B091301.3ON36734311771e-161
YCL064C (CHA1)1.3ON36033611691e-160
KNAG0C001801.3ON35933711601e-159
Skud_3.11.3ON36033711601e-159
Smik_3.121.3ON36033711501e-157
Kpol_2002.61.3ON35033911441e-156
NDAI0A001201.3ON37735311071e-150
KAFR0D001101.3ON36534410781e-146
CAGL0B00286g1.3ON36033810661e-144
TBLA0A049201.3ON36033510491e-142
KAFR0I00130singletonON3443449971e-134
KAFR0F04430singletonON3433429911e-133
SAKL0C00418g1.3ON3643309651e-129
ZYRO0F15774gsingletonON4103349641e-128
NCAS0A15330singletonON3473469551e-128
NDAI0K02950singletonON3343298501e-112
AFR747W1.3ON4263418541e-111
KLLA0C00440g1.3ON3773568321e-109
Ecym_10061.3ON3643478161e-107
ZYRO0F18524g1.3ON3353308081e-106
KLTH0F00440g1.3ON3413357921e-103
KNAG0D05380singletonON3343277871e-103
SAKL0C13904gsingletonON3393327741e-101
Smik_9.2na 1ON3383237522e-97
Skud_9.2na 1ON3393237304e-94
Scer_YGOB_SDL1 (SDL1)na 1ON3373237218e-93
TDEL0D06540singletonON3373247079e-91
KLLA0E01805gsingletonON3223326981e-89
KNAG0A01150singletonON2312295241e-64
YIL167W (SDL1)singletonOFF2101894873e-59
YIL168WsingletonOFF1271202546e-26
SAKL0F11858g7.367ON5622651889e-15
KLLA0E19779g7.367ON5672871585e-11
SAKL0A10626gsingletonON3203171566e-11
TDEL0C018007.367ON5692701578e-11
YKL218C (SRY1)na 2ON3263191531e-10
NCAS0A142307.367ON5692701542e-10
TPHA0F031307.367ON5682701523e-10
Ecym_47087.367ON5702911514e-10
Kpol_530.167.367ON5662651515e-10
Suva_5.1997.367ON5762651481e-09
KAFR0K017007.367ON5792651462e-09
KNAG0C036907.367ON5772701453e-09
Skud_11.2na 2ON3263191423e-09
Smik_5.2257.367ON5762651443e-09
ACR232C7.367ON5602611434e-09
YER086W (ILV1)7.367ON5762651425e-09
Skud_5.2057.367ON5762651418e-09
TBLA0C050707.367ON5752861382e-08
ZYRO0B02772g7.367ON5692651382e-08
CAGL0I05126g7.367ON5712701363e-08
NDAI0A018107.367ON5702651338e-08
KLTH0B04884g7.367ON5732951283e-07
Kwal_33.148227.367ON5622951123e-05
Smik_11.3na 2ON269232950.002
Suva_8.2446.97ON1166117750.87
KLLA0C18029g4.148ON384157731.2
Kpol_1013.437.529ON20172721.4
NCAS0C056204.69ON50241703.0
CAGL0F08789g4.148ON389166703.2
KNAG0J026704.69ON50026686.3
ZYRO0G07568g4.4ON63136686.5
NCAS0I011203.357ON15997658.5
NCAS0H013906.123ON81666679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04040
         (357 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   669   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   463   e-164
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    457   e-161
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   454   e-160
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   451   e-159
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   451   e-159
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   447   e-157
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   445   e-156
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   431   e-150
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   419   e-146
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   415   e-144
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   408   e-142
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   388   e-134
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              386   e-133
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   376   e-129
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   375   e-128
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            372   e-128
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             332   e-112
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   333   e-111
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   325   e-109
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   318   e-107
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   315   e-106
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   309   e-103
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   307   e-103
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   302   e-101
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      294   2e-97
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      285   4e-94
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   282   8e-93
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            276   9e-91
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   273   1e-89
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   206   1e-64
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   192   3e-59
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   102   6e-26
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    77   9e-15
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    65   5e-11
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    65   6e-11
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    65   8e-11
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    64   1e-10
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    64   2e-10
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    63   3e-10
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    63   4e-10
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    63   5e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    62   1e-09
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    61   2e-09
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    60   3e-09
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    59   3e-09
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    60   3e-09
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    60   4e-09
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    59   5e-09
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    59   8e-09
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    58   2e-08
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    58   2e-08
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    57   3e-08
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    56   8e-08
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    54   3e-07
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    48   3e-05
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    41   0.002
Suva_8.244 Chr8 (436751..440251) [3501 bp, 1166 aa] {ON} YOR188W...    33   0.87 
KLLA0C18029g Chr3 complement(1601829..1602983) [1155 bp, 384 aa]...    33   1.2  
Kpol_1013.43 s1013 complement(97761..98366) [606 bp, 201 aa] {ON...    32   1.4  
NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON} Anc_4...    32   3.0  
CAGL0F08789g Chr6 (868002..869171) [1170 bp, 389 aa] {ON} simila...    32   3.2  
KNAG0J02670 Chr10 (497838..499340) [1503 bp, 500 aa] {ON} Anc_4....    31   6.3  
ZYRO0G07568g Chr7 complement(596422..598317) [1896 bp, 631 aa] {...    31   6.5  
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    30   8.5  
NCAS0H01390 Chr8 complement(265088..267538) [2451 bp, 816 aa] {O...    30   9.4  

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/357 (92%), Positives = 329/357 (92%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
           EVF               KMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        EKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
           NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKENYSIFHSLRFQLTLNN 357
           LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKENYSIFHSLRFQLTLNN
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKENYSIFHSLRFQLTLNN 357

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  463 bits (1192), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 259/337 (76%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLLR  FPGK+L Q +LKYEC QPSGSFKSRGIGNLI   ++ IQKN K+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
           +VF               + LSLPCTVVVPTATK RMVEKI+ TGA VIV G  WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           YLKTNV++ ID + +EPIYVHPFDN  IWEGH++M+DEIV+    Q +P+EKVK IVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        E+H LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
           NISNQTFEYA+KYNTKS+VV+D  V+ETCLK++   NMV EPACGAALH+GY+ DILE +
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337
           L  KLA DDIVLIIACGGSSNTVQ+LE +L  +K + 
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEG 337

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  457 bits (1177), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 264/343 (76%), Gaps = 6/343 (1%)

Query: 1   MSQVYNKTPLLRHLFPG------KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54
           MS VYNKTPLLR  FP        ++PQ FLKYEC QPSGSFKSRGIGNLI   ++ I+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  NSKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114
           +  KSP+VF               + LSLPCTVVVPTATK RMVEKI+ATGANVI+ G H
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174
           WKEADTYLK++V+++ID    EPIYVHPFDN  IWEGH+TM+DEIV+T  +Q+I + K+K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234
            IVCSV             EKH LA KIP+VGVET GCHVFNTSLK+GK I+F KI +IA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294
           TSLGTA+IS+QTFEYAKKY+T+S+VV+D  V+ETCLK+T+D NMVAEPACGA+LH+ YN 
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337
           +ILE +LG KL++DDI+L+IACGGSSNTVQ+LE +L  L+ K+
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  454 bits (1169), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/336 (63%), Positives = 258/336 (76%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLLR  FPGK   Q FLKYEC QPSGSFKSRGIGNLI  +++ IQK+ K+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
           +VF               + LSLPCTVVVPTATK RMV+KI+ TGA VIV G +WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LKTNV++ ID ++IEPIYVHPFDN  IWEGH++MIDEIV+    QHI + KVK IVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        E++ LA +IP+VGVET GCHVFNTSLK+G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            ISNQTFEYA+KYNT+S+V++D  V+ETCLK+T   NMV EPACGAALH+GYN  ILE +
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336
           LG KLA DDIV+IIACGGSSNT+++LE +L  ++ K
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  451 bits (1160), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 219/337 (64%), Positives = 252/337 (74%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLLR  FPGKNLPQ+FLKYEC QPSGSFKSRGIGNLI   ++ IQK  ++  
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
            VF               + LSLPCTVVVPTATK RMVEKI+ TGA VIV G HWKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LK  V+S ID K  EPIYVHPFDN  IWEGHAT++DEI+ET   Q I  E VK IVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        EKH LA KIP+VGVET GCHV NTSL + K I+FEKI +IATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
           +IS QTFE AKKYNT+S+VVDD KV+ETCLK+TRD NMVAEPACGAALH+ YN+DILEK+
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337
           LG  L  +D++L+IACGGSSNT+++LE +L  L +KS
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKS 337

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  451 bits (1160), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 258/337 (76%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLLR  FP K+  Q FLKYEC QPSGSFKSRGIGNLI   ++ IQK+ ++SP
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
           +VF               + LSLPCTVVVPTATK RMVEKI+ TGA VIV G +WKEADT
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LK N+++ ID +++EPIYVHPFDN  IWEGH++M+DEIV+    Q I + KVK IVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        E++ LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            ISNQTFEYA KYNTKS+V++D  V+ETCLK+T   NMVAEPACGAALH+GY+ +ILEK+
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337
           LG KLA DDIV+IIACGGSSNTVQ+LE +L +LK + 
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQG 337

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  447 bits (1150), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 208/337 (61%), Positives = 257/337 (76%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLLR  FPGK+  Q FLKYEC QPSGSFKSRGIGNLI  +++ IQK+ KKSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
           ++F               + LSLPCTVVVPTATK RMVEKI+ TGA VIV G +WKEADT
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LK +V+  ID +++EPIYVHPFDN  IWEGH++M+DE+V+    Q I + KVK IVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        E++ LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            ISNQTF+YA+KYNT+S+V++D  V++TCLK+T   NMV EPACGAALH+GYN +ILE++
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337
           LG KLA DDIV+IIACGGSSNT+Q+LE +L     +S
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  445 bits (1144), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 224/339 (66%), Positives = 262/339 (77%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           MS VYNKTPLL+H FPGKNLPQ +LKYE  QPSGSFKSRGIGNLI   ++ I+K + K P
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
            VF               + LSLPCTVVVPTATK RMV+KI+ATGANVI+KGNHWKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LK N+++ I+K  IEPIYVHPFDN  IWEGH+TM+DEI+ETF QQ   I+ +KAIVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        EK++LA KIPVVGVET GCHVFNTSLK+ K ++F KI+TIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
           NISNQ F+YAKKYNTKS+VV+D  VVETCLKFT D NMV EPACGAA+H+GY+ D+LE +
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNE 339
           LG KL  DD VLI+ACGGSSNTV+ELE +L EL  KS +
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQK 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  431 bits (1107), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 210/353 (59%), Positives = 258/353 (73%), Gaps = 13/353 (3%)

Query: 1   MSQVYNKTPLLRHLFPGK-----------NLPQVFLKYECFQPSGSFKSRGIGNLIQSTS 49
           MS VYNKTPLLR  F                PQ F+KYEC QPSGSFKSRGIGNLI  ++
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  LEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVI 109
           + I K  +K+P+VF               + LSLPCTVVVPTATK RMVEKIK+TGANVI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VKGNHWKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIP 169
           + G HWKEAD +LK ++++ ID   IEPIYVHPFDN  IWEGHATM+DEI+++   Q+IP
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 IEKVKAIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEK 229
           I KVK IVCSV             +K++LA KIP+VGVET GCHVFNTSLK+ K I+F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 INTIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALH 289
           I +IATSLGTANIS +TFEYA+KY T+S+V++D  V+ETCLK+T+D NMV EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 MGYNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKEN 342
           + Y+ DILEKSLG KL +DDI+L+IACGGSSNT  +LE+ L  L  K++EK+N
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL--LNMKADEKQN 351

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/344 (58%), Positives = 249/344 (72%), Gaps = 6/344 (1%)

Query: 1   MSQVYNKTPLLRHLFPG------KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54
           MS VYNKTPLLR  FPG       +LPQ FLKYEC QPSGSFKSRGIGNLI   +++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  NSKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114
              K PEVF               + LSLPCTVVVPTATK RM+EKIK TGANVI+ G  
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174
           WKEAD YLK +V++ I+K  I+PIYVHPFDN  IWEGH++++DEI++T  +Q +    +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234
            IVCSV             E+H L  KIPVVGVET GCHVFNTSLK+GK ++FEKI +IA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294
           TSL TA+IS +TFE A KY T+S++V D  V+ETCLK+T+D NMV EPACGA++H+ YN+
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338
           DILE +LG KL  DD V++IACGGSSNT+Q++E +L  L+++ N
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEEN 344

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/338 (59%), Positives = 251/338 (74%), Gaps = 5/338 (1%)

Query: 4   VYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNS-KKSPEV 62
           VYNKTPL+R +FP  ++PQ++LK+ECFQPSGSFKSRGIG+LI   S  I  N   K P V
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  FXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYL 122
           F               K L+LPCTVV+PTATK RM +KI+ATGANVIV GN WKEAD YL
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KTNVLSNIDK--KLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           K N+LS +++  K +EPIYVHPFDN  IWEGHA+M+DEIVE F  + IP+ K+KAIVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        EK++LA KIP+VGVET GCHVFNTSL+M KV+ F+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
           +IS + F+YAK+Y TKS+V+ D  VV+TCL++T D NMV EPACGAA+H+ Y+ +ILEK 
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338
           LG KL  DDIVL++ACGGSSNTV+++E+ L  L  + N
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEEN 338

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  408 bits (1049), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/335 (59%), Positives = 243/335 (72%), Gaps = 1/335 (0%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEI-QKNSKKS 59
           MS VYNKTPLLR  F G  +PQ FLKYEC QPSGSFKSRGIGNLI  +  +I   N  K 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEAD 119
           P+VF               + LS+PCTVVVPTATK RMV KIK TGA VIV G HW EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 TYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCS 179
            YL+ +V++ ID   IEPIYVHPFDN  IWEGH+TMIDEI+E+  +Q+I I  VKAI CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGT 239
           +             EK++LA+KIP++GVET GC VFNTSLK+ K+++F KINTIATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 ANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEK 299
           + IS +TFE A KYNTKS+VVD++ V++TCL++T D N VAEPACGAALH+ YN  ++E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 SLGKKLATDDIVLIIACGGSSNTVQELEASLTELK 334
           +L   L  DDI+++IACGGSSNTVQELE +L + K
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/344 (53%), Positives = 249/344 (72%), Gaps = 6/344 (1%)

Query: 1   MSQVYNKTPLLRHLFPG------KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54
           M  VYNKTPL+   FPG       +LPQV +KYE  QPSGSFKSRGIGNL+   +L+IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  NSKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114
           NS K+PEVF               + LSLPCTVVVP ATK RM+EKI++TGA V + G  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174
           WK AD Y+K +VL+ I+ + +EPIYVHP D+  IWEG++ ++DE++E+  +Q I   KVK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234
           AIVCSV             E++ LA KIP+VGVET G HVFNT LK GK I+FEKI+T+A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294
           TSLG+A+I+ +TFEYA KY  + ++V D++V+ETCL++T+D NM+ EPACGAA+H+ Y++
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338
           DILEK+L  +L  DD+V+IIACGGSSN++ ++E +L ++K++S 
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSESQ 344

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/342 (52%), Positives = 248/342 (72%), Gaps = 6/342 (1%)

Query: 1   MSQVYNKTPLLRHLFPGKNL------PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK 54
           M  VYNKTPLLR  F   N       PQVF KYE FQP  SFKSRGIGNLI   + ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  NSKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNH 114
              K+ EVF               + LS+PCTVVVP++TK+RMVEKI++TGA VIV GN 
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVK 174
           WKEAD YL+ +V++ +D   +EP+YVHPFD+  IWEGH+T+IDEIVE+   +++   KVK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIA 234
            +VCS+             E+H LA KIPV+ VET GCHVFNT L++GK ++FEKI++IA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNM 294
           TSLG+ +IS +TFEYA+KY++K +V+ D+ V+ETCL+++ DSNM+ EPAC A++H+ YN+
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 DILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336
           DILE++L KKL+ DD+++IIACGGS+ T+Q+++ SL +LK K
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIK 342

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  376 bits (965), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 223/330 (67%), Gaps = 3/330 (0%)

Query: 1   MSQVYNKTPLLRHLFPGKNL---PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57
           M+  Y+KTPLLR +FP   L   PQ  +KYE FQPSGSFKSRGIG+LI  ++  I+    
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  KSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117
           K+  VF               +  SLPCTVVVPT T LRMV KI+ TGA+VIV GNHW +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIV 177
           AD YL  +V+  ID    EP+Y HPFDN  IWEGH+T++DEIVE+  +Q IP  +VK IV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSL 237
           CS+             EKHDLAT IP++GVET GC VF+ SLK GK + F+KI ++ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDIL 297
           GTA I  +T E A KYNTKS+V+ D  VV TCL F  D+N+V EPACGA+LH GYN  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 EKSLGKKLATDDIVLIIACGGSSNTVQELE 327
           E +LG  L  +DI+++IACGGSS TVQ+L+
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQ 330

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  375 bits (964), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 243/334 (72%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           M  +YNKTPLL+ +F      QVF+KYEC QPSGSFKSRGIG+LI   + +IQ + +KSP
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
            VF               + L+LPCTVV+PT TK RM +KI+  GANV+V+G+HWKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           +LK  + + ++  ++EPIYVHPFDN  IWEGHA+++DEI+ +   ++  + +VK IVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        EK++LA KIP++ VET GCHV NTSL++G+ ++F K+N++ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            IS++T +Y +KY +KSIV++D +V++TCLK+  + NM+ EPACGA+LH+GY+  ++E++
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELK 334
           LGK L  DD++++IACGGSSNT+ +LE SL +L+
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKLE 380

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  372 bits (955), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (69%), Gaps = 5/346 (1%)

Query: 1   MSQVYNKTPLLRHLFPG----KNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNS 56
           MS VYNKTPLLR +FP      + PQ+++KYE  QPSGSFKSRGIG+LI   +L +Q+  
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  KKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWK 116
            KS  VF               + L LPCTVVVPT+TK RMVEKI+  G  VIVKG+HWK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAI 176
           EAD++LK +V+ ++D+ + EPIYVHPFD+  +WEGH+TM+DEIV+TF  Q++ + KVKAI
Sbjct: 121 EADSFLKNSVIPSVDR-IEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATS 236
           VCSV             EK+ LA KIPV+ +ET GC+ FN  LK  K ++  KI ++ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDI 296
           LG   ++ + FE  ++Y + S+V+ D+ VV TCLK+  D N++ EPACGA+LHM YN  +
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKEN 342
           +EK+LGKKL +DDI++IIACGGS+NT+++L+ S  +L  ++N K+N
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEANTKKN 345

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  332 bits (850), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 163/329 (49%), Positives = 220/329 (66%), Gaps = 2/329 (0%)

Query: 1   MSQVYNKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKS 59
           MS +YNKTPLLR  F    + P++FLKYE  QPSGSFKSRGIG LI     +++++  K+
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEAD 119
             VF               + L +PCTVVVP +TK RMV KI+ TGA+V++KG+HWKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 TYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCS 179
            +L+ + +  +D    +PIYVHPFD+  IWEGH+T+IDEIV+T   + I IEKVK I+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGT 239
           V             E+H+LA  IPV+ VET GC V N SLK G  +Q  KI ++ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 ANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEK 299
             IS+  FE A KYN++SI ++D  V+ETCLK+  D +M  EPACGA++H+ YN  I+E 
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 SLGKKLATDDIVLIIACGGSSNTVQELEA 328
           +LG  L+  DIV+++ CGGSS T+ +LE+
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLES 328

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  333 bits (854), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 224/341 (65%), Gaps = 7/341 (2%)

Query: 1   MSQVYNKTPLLRHLFPGKNL-----PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55
           M+  Y KTPL+RH+F  +N+     P++ LKYE FQPSGSFKSRGIGNLI     +I++N
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  SKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115
           S   P VF               + L LPCTVVVP  T+ RMVE+I++TGA+VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKA 175
           KE+D YL++ ++ N++ + + PIY HPFDN  IWEGHATM+DE+VE    Q + +E VK 
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIAT 235
           IVCSV             EKH LA  IPVV VET GC V + SL +G+ +      ++AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMD 295
           SL T+ +++ T  YA+KY TKS+V+D L VV+TCL F  +SN+V EPACGAALH+GY+ +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336
           ILE+ LG  L   D+V++IACGGS+  + +L+ S  +L+ K
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  325 bits (832), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 232/356 (65%), Gaps = 7/356 (1%)

Query: 2   SQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNS-KKSP 60
           +Q+++KTPLL+H F     PQV LKYE  QPSGSFKSRGIG+LI +   EI+K+S +K  
Sbjct: 22  AQLFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIG 81

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
            VF                 L++PCTVVV  AT+ R++EKI++ GA+V+V GNHWKEAD+
Sbjct: 82  HVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADS 141

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           ++K +++  +D    EPIY HPFDN  IWEGH+ M+DEI++      IPI K+K IVCS 
Sbjct: 142 FMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSF 201

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        ++++LA KIP+V VET G  V + SL++G  ++FEKI++ ATSLGTA
Sbjct: 202 GGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTA 261

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            IS   ++  K++ +KS V+ D +V+ TCL+F+ D+N+VAEP CGA L+ GYN+D L+  
Sbjct: 262 TISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNI 321

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELE--ASLT----ELKNKSNEKENYSIFHSLR 350
           LG  +  DD V++I CGGSS ++++L+  +S T    EL +    + N    H+L+
Sbjct: 322 LGSDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFELPSTGVSRLNSHSLHTLQ 377

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 163/347 (46%), Positives = 226/347 (65%), Gaps = 14/347 (4%)

Query: 1   MSQVYNKTPLLRHLFPGKNL-----PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55
           MS +Y KTPLLR  F   N+     PQ  +KYE FQPSGSFKSRGIGNLI +   EI+++
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 56  SKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115
             K P VF               + + +PCTVVVPT+T+ R++EKI ATGA +I +G+++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 116 KEADTYLKTNVLSNIDKKLIE----PIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIE 171
            EAD+YLK  +    +K   +    PIYVHPF++  IW GH+ +++EI+E+   ++IP  
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 172 KVKAIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKIN 231
           +VK IVCSV             E+H LA  IP++GVET GC V + SL  GK+I F+K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 232 TIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMG 291
           ++ATSL    I+ +T  YA+KY TKS+V+ + +V++TCL+FT +SN+V EPACGA LH+G
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 292 YNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338
           Y+  IL K LG  L+++DIV++IACGGS+ T+    A L ELK K N
Sbjct: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTL----ADLRELKLKYN 342

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  315 bits (808), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 214/330 (64%), Gaps = 9/330 (2%)

Query: 1   MSQVYNKTPLLRHLFPGKN---LPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57
           M+  Y KTPLLR +   K    LPQ+F+KYE  QP GSFKSRGIGNLI   SL+ +    
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI---SLKSENGLV 57

Query: 58  KSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117
           KS  V                K + LPCTVVVPT+TK RMV+KIK +GA VI++G+HWKE
Sbjct: 58  KS-HVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKE 116

Query: 118 ADTYLKTNVLSNI-DKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAI 176
           AD YL+ N + +  +    +P+YVHPFD+ K+WEGH+TM+ EI++   +Q+I +E V+ I
Sbjct: 117 ADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGI 176

Query: 177 VCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATS 236
           VCSV             E H LA KIPV+ VET GC+V N SL  G+ +  +KI ++ATS
Sbjct: 177 VCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATS 236

Query: 237 LGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDI 296
           LG+  I    FE A +Y  KS+V++D  V+ETCL++  D   + EPACGA+LH+GY+ ++
Sbjct: 237 LGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPEL 296

Query: 297 LEKSLGKKLATDDIVLIIACGGSSNTVQEL 326
           LE  LG   + DDI++IIACGGS+ T ++L
Sbjct: 297 LENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  309 bits (792), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/335 (44%), Positives = 215/335 (64%), Gaps = 6/335 (1%)

Query: 1   MSQVYNKTPLLRHLFPGK-----NLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55
           M   + KTPLL H F        N PQ  LK E  QPSGSFKSRGIG +I   +++I+  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  SKKSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115
             K P VF               + LS+PC+VVVP +T  RMV+KI   GA V V G +W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKA 175
           KEAD +LK +++S  +    + IY HPFD+  IWEGH++++DEI+++  +Q I ++ +KA
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIAT 235
           IVCSV              +H L  KIP++GVE+ GC VFN+SLK+GK+ +FE I +IAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMD 295
           S+GT +IS +T E A +Y+TKS+V+ D +++ TCL+F  ++N++ EPACGAALH+GY  D
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILEKSLGKKLATDDIVLIIACGGSSNTVQELEASL 330
           IL ++L      +D++++I CGGS+ +  +L ASL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL-ASL 334

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 153/327 (46%), Positives = 205/327 (62%), Gaps = 2/327 (0%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           M  +YNKTPLL     G + P    KYE  QP GSFK RG+ +LI+    +I+   KK P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  EVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120
            VF                +LS+PCTVVVPT TK RMVEKI+   A VIVKG++WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180
           YL+  V+++     ++PIYV+PFD+  +WEGH+TMIDEI+    Q++I ++ VK IVCSV
Sbjct: 121 YLRGTVIAS--NNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 XXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240
                        E H LA  IPVV VET GC V   SL   K ++  KI++IATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300
            +S Q F+ A K+ ++S+V+ D  V+ TC ++  D N + EPACGA +H  Y+  ILEK+
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGKKLATDDIVLIIACGGSSNTVQELE 327
           LG+KL   DI++II CGGS  T+Q+LE
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLE 325

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  302 bits (774), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/332 (44%), Positives = 210/332 (63%), Gaps = 1/332 (0%)

Query: 5   YNKTPLL-RHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           YNKTPLL R L      P+ FLKYE  QP GSFKSRGIG L++ +  + +++  KS  VF
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                          +  S+ CTVVVP  TK RMVEKI+ TGA V+V G HW  AD YL+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 TNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXX 183
             V+  +D   + P+YVHPFDN  IW+GH+T++DE+V    ++++ I+KVKAIVCSV   
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 XXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANIS 243
                     E H LA +IP++ +ET GC V N SL  G  +  E + ++A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGK 303
            + FE A+KY +KSI++ D +V+ETCL F  D+ +V EPACGA+L+  Y+ ++L   +GK
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLATDDIVLIIACGGSSNTVQELEASLTELKN 335
           +L  DD++++IACGGS+ T ++LE    EL +
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLEYMKKELGD 339

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  294 bits (752), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 206/323 (63%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLRHLFP-GKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           Y KTPL+R +F  GK  P  ++K++  QP GSFKSRGIG+LI+  + E          VF
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                          ++++L CTVVVP  TK RMV+KI++ GA VI+ G+HW EAD YLK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 TNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXX 183
             V++   +   + +YVHPFD++ IWEGH+T++DEI++   ++ I   +VK +VCSV   
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 XXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANIS 243
                     E++ LA KIP+V VET GC V N SLK G  +  E++ ++ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGK 303
              FE    Y  KS+V+ D  V++TCL++  D N + EPACGA+LH+ Y+ +ILEK+LG+
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLATDDIVLIIACGGSSNTVQEL 326
           KL+ DD+V+IIACGGS  T ++L
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDL 328

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  285 bits (730), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 206/323 (63%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLRHLFP-GKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           Y +TPL+  +F  G+  P++++K+E  QP GSFKSRGIG+LI  ++ E   +      VF
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                            ++L CTVVVP  TK RM++KI+  GA VI+ G+HW EAD YL+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 TNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXX 183
             ++    +   + +YVHPFD+++IWEGH+T++DE+++   +++I + ++KA+VCSV   
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 XXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANIS 243
                     E+++LA KI V+ VET+GC V N SL  G  I  E++++IATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGK 303
              FE    Y  KS+V+ D  V+ TCL++  D N + EPACGA+LH+ Y+ +ILE +L +
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLATDDIVLIIACGGSSNTVQEL 326
           KL+ DDIV+IIACGGS  T ++L
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDL 328

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  282 bits (721), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 200/323 (61%), Gaps = 2/323 (0%)

Query: 5   YNKTPLLRHLFP-GKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           Y KTPL+R     GK     ++K+E  QP GSFKSRGIG+LI+ ++ E          VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                          + ++L C+VVVP  TK RMV+KI++ GA VI+ G+HW EAD YL+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 TNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXX 183
            + ++   +   + +YVHPFDN+ IWEGH+T++DEI+E   +  I + +VKA+VCSV   
Sbjct: 126 -HEMAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 XXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANIS 243
                     +++ LA KIPVV VET GC V N SLK G  +  EK+ ++ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGK 303
           +  FE   KY  KS+V+ D  V+ TCL++  D N + EPACGA+LH+ Y+ +ILE  L +
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLATDDIVLIIACGGSSNTVQEL 326
           K+  DDIV+IIACGGS  T ++L
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDL 327

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  276 bits (707), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 196/324 (60%), Gaps = 3/324 (0%)

Query: 6   NKTPLLRHLF--PGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           +K+PLL   F    K+ PQ FLKYE  QPSGSFKSRGIG LI S + E +        VF
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                          K+L+L CTVVVP  TK  M+++I+  G+ VIV G HW  ADTYLK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 TNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXX 183
             V+  +    +EP+YVHPFD+  +WEGH+ MIDEIVE   +Q   +  VK I+CSV   
Sbjct: 125 EVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 XXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANIS 243
                     E+H  A KIP++ VET+G      SL  GK ++  ++ +IA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGK 303
             +FE A +Y T+S V  D + V T L+F +++N++ EPAC A++ + Y++D L K L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLATDDIVLIIACGGSSNTVQELE 327
           KL++ DIV++I CGGS+ T+ +LE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  273 bits (698), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 199/332 (59%), Gaps = 16/332 (4%)

Query: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60
           M Q+  KTPLL    P    P   LKYE  QP GSFKSRGI +LI++T      +S   P
Sbjct: 1   MDQLTIKTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTT-----MDSISDP 55

Query: 61  E----VFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWK 116
           E    V+                 L +PCTV+VP +TK RM++KI++ GA V++ G+HWK
Sbjct: 56  ENELAVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWK 115

Query: 117 EADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAI 176
           EADTYL+  V+          +YVHPFDN  IW+GH+TMIDEI+E   + H  I  VK I
Sbjct: 116 EADTYLREYVMRQ--SSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGI 173

Query: 177 VCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATS 236
           VCSV             E+H LA  IPV  +ET GC V + SL  G+ +  ++I++IATS
Sbjct: 174 VCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATS 233

Query: 237 LGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDI 296
           LG+  I   +F+ A K+++KSIV+DD  VV+TCL+F  +++++ EPACGA+LH  Y  ++
Sbjct: 234 LGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPEL 293

Query: 297 LEKSLGKKLATDDIVLIIACGGSSNTVQELEA 328
           L       L  DDIV++I CGGS NT  +L++
Sbjct: 294 L-----GPLGPDDIVVVILCGGSCNTYDDLKS 320

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  206 bits (524), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 151/229 (65%), Gaps = 2/229 (0%)

Query: 108 VIVKGNHWKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQH 167
           V V   + KEAD YL+ NV+ ++ K  ++PIYV+PFD+  IWEGH+T+IDEI+ T  Q++
Sbjct: 5   VFVHVANLKEADYYLQ-NVVIDLYKD-VQPIYVNPFDDPLIWEGHSTIIDEILNTLTQEN 62

Query: 168 IPIEKVKAIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQF 227
           I +  VK I+CS              EK+DLA  IPVV VET GC V N SL   K +Q 
Sbjct: 63  IEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQL 122

Query: 228 EKINTIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAA 287
           + I +IA SLG++ +S + F+   KY++KS+V++D   ++TC K+  D   V EPACGA+
Sbjct: 123 DSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGAS 182

Query: 288 LHMGYNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336
           +H  Y+ ++LE++L +KL  DD+++IIACGGS  T Q+LE +  +L NK
Sbjct: 183 VHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGNK 231

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  192 bits (487), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 126/189 (66%)

Query: 138 IYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHD 197
           +YVHPFDN+ IWEGH+T++DEI+E   +  I + +VKA+VCSV             +++ 
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKS 257
           LA KIPVV VET GC V N SLK G  +  EK+ ++ATSL +  I++  FE   KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 IVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKSLGKKLATDDIVLIIACG 317
           +V+ D  V+ TCL++  D N + EPACGA+LH+ Y+ +ILE  L +K+  DDIV+IIACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTVQEL 326
           GS  T ++L
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  102 bits (254), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 5   YNKTPLLRHLFP-GKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVF 63
           Y KTPL+R     GK     ++K+E  QP GSFKSRGIG+LI+ ++ E          VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLK 123
                          + ++L C+VVVP  TK RMV+KI++ GA VI+ G+HW EAD YL+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 109/265 (41%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I          S+K+  V                K L+
Sbjct: 81  VQLKREDLLPVFSFKLRGAYNMIAKLD-----ESQKTQGVIACSAGNHAQGVAYASKHLN 135

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 136 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTNIP------- 188

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H    K+KA+ C+V             ++  +
Sbjct: 189 ---PFDHPYVIAGQGTIAMEILR---QVH-NASKIKAVFCAVGGGGLITGVGAYLKR--I 239

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      +TSLK GK +    + T A       I  +TF  AK    + +
Sbjct: 240 APHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVV 299

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 300 LVNTDEICAAVKDIFEDTRSIVEPS 324

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 117/287 (40%), Gaps = 18/287 (6%)

Query: 3   QVYNKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPE 61
           +V  +TP+ R +     L   V LK E   P  SFK RG  N+I     E QKN+     
Sbjct: 65  EVIEETPISRAVSLSSRLNTNVKLKREDLLPVFSFKLRGAYNMIAKLD-ETQKNAG---- 119

Query: 62  VFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTY 121
           V                  +++P T+V+P +T     + +   GA V++ G+ + EA   
Sbjct: 120 VIACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK-- 177

Query: 122 LKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVX 181
           L+   L+  ++ + +   + PFD+  +  G  T+  EI+            + A+ C+V 
Sbjct: 178 LECARLAE-ERGMTD---IPPFDHPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVG 229

Query: 182 XXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTAN 241
                       ++  +A  I V+GVET      + SLK GK      + T A       
Sbjct: 230 GGGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRL 287

Query: 242 ISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           I  +TF   +    + I+V+  ++         D+  + EP+   A+
Sbjct: 288 IGEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPSGALAV 334

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 120/317 (37%), Gaps = 36/317 (11%)

Query: 6   NKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFX 64
           NKTP+L        L  +V+ K E FQ  G+FK RG  N +   + E     +++  V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQE-----QRAAGVVA 75

Query: 65  XXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKT 124
                         K+L +P T+V+P       V      GAN++         D Y  T
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIV-------RYDRY--T 126

Query: 125 NVLSNIDKKLIEP---IYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVX 181
                I + L E      V P+D+  +  G  T   E++E  G+  +           V 
Sbjct: 127 EDREQIGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIEEVGELDL---------LFVP 177

Query: 182 XXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTAN 241
                           L+ +  ++GVE    +    SL+ G ++  +   TIA    T +
Sbjct: 178 LGGGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQH 237

Query: 242 ISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEP-ACGAALHMGYNMDILEKS 300
           +   TFE         +   D ++V++   F     +V EP  C     +G+     +K+
Sbjct: 238 LGQYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC-----LGFAAARAQKA 292

Query: 301 LGKKLATDDIVLIIACG 317
              KLA   + +I++ G
Sbjct: 293 ---KLAGKRVGIIVSGG 306

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 106/270 (39%), Gaps = 25/270 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+K+  V                K +S
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIAKLD-----DSQKNQGVIACSAGNHAQGVAFAAKHMS 142

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEAD---TYL-KTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA    T L +   L+NI        
Sbjct: 143 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTRLSEERGLTNIP------- 195

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+           K+ A+                 ++  +
Sbjct: 196 ---PFDHPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--I 246

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET      +TSLK GK      + T A       I  +TF  A+    + +
Sbjct: 247 APHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVV 306

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           +V   ++         D+  + EP+   A+
Sbjct: 307 LVGTDEICAAIKDIFEDTRGIVEPSGALAV 336

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 127/319 (39%), Gaps = 37/319 (11%)

Query: 6   NKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFX 64
           NKTP+L        L  Q++ K E FQ  G+FK RG  N +   S E     K+S  V  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLSDE-----KRSKGVIA 75

Query: 65  XXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKT 124
                         K+L++P T+V+P       V      GA+ I++ N + E    +  
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAH-IIRYNRYTEDREQIGR 134

Query: 125 NVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXX 184
            + +     LI      P+D+  +  G  T   E++E  GQ       + A+   V    
Sbjct: 135 QLAAEHGFALIP-----PYDHPDVIAGQGTSAKELLEEVGQ-------LDALF--VPLGG 180

Query: 185 XXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISN 244
                        L+    + GVE    +    S + G ++      TIA    T ++  
Sbjct: 181 GGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQHLGE 240

Query: 245 QTFEYAKKYNTKSIVVDDLKVVETCLKFTRDS-NMVAEP-ACGAALHMGYNMDILEKS-- 300
            TF   ++     + V D ++V+ C+ F  +   +V EP AC     +G+   +L+K   
Sbjct: 241 YTFAIIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTAC-----LGFAGALLKKEEL 294

Query: 301 LGKKLATDDIVLIIACGGS 319
           +GKK+       II  GG+
Sbjct: 295 VGKKVG------IILSGGN 307

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 107/270 (39%), Gaps = 25/270 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L 
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAYAAKHLG 142

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 143 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------- 195

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H    K+ A+   V             ++  +
Sbjct: 196 ---PFDHPYVIAGQGTVAMEILR---QVH-NANKIGAVFVPVGGGGFIAGVGAYLKR--I 246

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      +TSLK  K      + T A       I  +TF  A++   + +
Sbjct: 247 APHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVV 306

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           +V+  ++         D+  + EP+   A+
Sbjct: 307 LVNTDEICAAVKDIFEDTRSIVEPSGALAV 336

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 109/270 (40%), Gaps = 25/270 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK +   P  SFK RG  N++         +++K+  V                K L 
Sbjct: 87  VQLKRDDLLPVFSFKLRGAYNMMAKLD-----DTQKNQGVIACSAGNHAQGVAYAAKHLK 141

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 142 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTNIP------- 194

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H+   K+ A+   V             ++  +
Sbjct: 195 ---PFDHPYVIAGQGTVAMEILR---QVHMS-SKIGAVFVPVGGGGLIAGVGTYLKR--I 245

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET       TSL+ GK    E + + A       +  +TF  A++   + +
Sbjct: 246 APHIKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVV 305

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           +V+  ++         D+  + EP+   A+
Sbjct: 306 LVNTDEICAGIKDIFEDTRSIVEPSGALAV 335

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 121/291 (41%), Gaps = 21/291 (7%)

Query: 2   SQVY---NKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57
           S VY   N++P+ R  F    L   V LK E   P  SFK RG  N+I     ++QK   
Sbjct: 64  SNVYDIINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISHLD-DVQKKCG 122

Query: 58  KSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117
               V                K L +P T+V+P +T     + +   GA V++ G+++  
Sbjct: 123 ----VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDA 178

Query: 118 ADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIV 177
           A   ++ + LS  +K L +   + PFD+  +  G  T+  EI++          K+ A+ 
Sbjct: 179 AK--VECSRLSE-EKGLYD---IPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVF 228

Query: 178 CSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSL 237
           C+V             ++   A  I V+GVET      +TS++        ++   A   
Sbjct: 229 CAVGGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGT 286

Query: 238 GTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
               I  ++F  A++   + I+V+  ++         D+  V EP+   A+
Sbjct: 287 SVRLIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 107/265 (40%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N++         +S+K+  V                K L+
Sbjct: 85  VQLKREDLLPVFSFKLRGAYNMMAKLD-----DSQKNQGVIACSAGNHAQGIAYAAKHLN 139

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 140 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTNIP------- 192

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H    K+ A+   V             ++  +
Sbjct: 193 ---PFDHPYVIAGQGTVAMEILR---QVH-KANKIGAVFVPVGGGGLIAGVGAYLKR--I 243

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET   +   TSL+ GK +    + T A       I  +TF   ++   + +
Sbjct: 244 APHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVV 303

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 304 LVNTDEICAAVKDVFEDTRSIVEPS 328

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 104/265 (39%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P  T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTNIP------- 202

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    +Q   + K+ A+   V             ++  +
Sbjct: 203 ---PFDHPYVIAGQGTVAMEIL----RQVRTVNKIGAVFVPVGGGGLIAGIGAYLKR--I 253

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      + SL+  +      + T A       I  +TF  A++   + +
Sbjct: 254 APHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVV 313

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 314 LVNTDEICAAVKDVFEDTRSIVEPS 338

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 105/265 (39%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I      ++        V                K L 
Sbjct: 98  VQLKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLG 152

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 153 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEERGLTNIP------- 205

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H    K+ A+   V             ++  +
Sbjct: 206 ---PFDHPYVIAGQGTVAMEILR---QVH-NANKINAVFVPVGGGGLIAGVGAYLKR--I 256

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      +TSL+ GK  +  K+ T A       I  +TF  A++   + +
Sbjct: 257 APHIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIV 316

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 317 LVNTDELCAAIKDVFEDTRSILEPS 341

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 107/270 (39%), Gaps = 25/270 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N++         +++K+  V                K L 
Sbjct: 96  VQLKREDLLPVFSFKLRGAYNMMAKLD-----DTQKNQGVIACSAGNHAQGVAFAAKHLD 150

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        K   L+NI        
Sbjct: 151 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKERGLTNIP------- 203

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q HI   K+ A+   V             ++  +
Sbjct: 204 ---PFDHPYVIAGQGTVAMEILR---QVHIA-NKIGAVFVPVGGGGLVAGVGAYLKR--I 254

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET       TSL+ G+      + T A       I  +TF  ++    + +
Sbjct: 255 APHIKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVV 314

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           +V+  ++         D+  + EP+   A+
Sbjct: 315 LVNTDEICAAVKDIFEDTRSIVEPSGALAV 344

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 127/319 (39%), Gaps = 37/319 (11%)

Query: 6   NKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFX 64
           NKTP+L        L  +V+ K E +Q  G+FK RG  N +   S    K  KK   V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLS---DKERKKG--VIA 75

Query: 65  XXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKT 124
                         K+ ++P T+++P       V      GA++I K N + E   ++  
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHII-KYNRYTEDREHIGR 134

Query: 125 NVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXX 184
            + +     LI P     +D+  +  G  T   E+ E  G+       + A+   V    
Sbjct: 135 QLAAKHGYVLIPP-----YDHPDVIAGQGTSAKELFEEVGE-------LDALF--VPLGG 180

Query: 185 XXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISN 244
                        L+    V GVE    +    S K G ++  +  +TIA    T ++  
Sbjct: 181 GGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQHLGE 240

Query: 245 QTFEYAKKYNTKSIVVDDLKVVETCLKFTRDS-NMVAEP-ACGAALHMGYNMDILEKS-- 300
            T+   ++     + V D ++VE C+ F  +   +V EP AC     +G+   +L+K   
Sbjct: 241 YTYAVIRENVDDILTVSDEELVE-CMHFLAERMKLVVEPTAC-----LGFAGALLKKREL 294

Query: 301 LGKKLATDDIVLIIACGGS 319
           +GKK+       II  GG+
Sbjct: 295 VGKKVG------IILSGGN 307

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 103/265 (38%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P  T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------- 202

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    +Q     K+ A+   V             ++  +
Sbjct: 203 ---PFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--V 253

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      + SL+  +      + T A       I  +TF  A++   + +
Sbjct: 254 APHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVV 313

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 314 LVNTDEICAAVKDIFEDTRSIVEPS 338

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 103/261 (39%), Gaps = 17/261 (6%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I +         +KS  V                + L 
Sbjct: 80  VCLKREDLLPVFSFKLRGAYNMISNLD-----EYQKSAGVIACSAGNHAQGVAFSARELG 134

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKTNVLSNIDKKLIEPIYVHP 142
           +   +V+PT+T       + A GA V++ G  + EA    +   L+ + K    P    P
Sbjct: 135 IRAMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKA--ECARLAQLHKLTDIP----P 188

Query: 143 FDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDLATKI 202
           FD+  +  G  T+  EI+    Q H    ++ A+ C V             ++  +A  I
Sbjct: 189 FDHPYVIAGQGTIATEILR---QVH-NASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHI 242

Query: 203 PVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSIVVDD 262
            ++GVET      +T+LK G+      +   A       +  +TF  A+    + ++V+ 
Sbjct: 243 KIIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNT 302

Query: 263 LKVVETCLKFTRDSNMVAEPA 283
            ++         D+  + EP+
Sbjct: 303 DELCAAIKDIFEDTRAIVEPS 323

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 103/265 (38%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P  T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------- 202

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    +Q     K+ A+   V             ++  +
Sbjct: 203 ---PFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--V 253

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET      + SL+  +      + T A       I  +TF  A++   + +
Sbjct: 254 APHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVV 313

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 314 LVNTDEICAAVKDIFEDTRSIVEPS 338

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 103/265 (38%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L 
Sbjct: 95  VILKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAFAAKHLK 149

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P  T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 150 IPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------- 202

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    +Q     K+ A+   V             ++  +
Sbjct: 203 ---PFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--V 253

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I V+GVET      + SL+  +      + + A       I  +TF  A++   + +
Sbjct: 254 APHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVV 313

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 314 LVNTDEICAAVKDVFEDTRSIVEPS 338

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 110/286 (38%), Gaps = 26/286 (9%)

Query: 3   QVYNKTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPE 61
           +V N++P+ + +     L  Q+ LK E   P  SFK RG  N++          +++   
Sbjct: 68  EVINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAKLD-----ETQRKQG 122

Query: 62  VFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWK----E 117
           V                K L +P T+V+P +T     E +   G+ V++ GN +     E
Sbjct: 123 VIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGE 182

Query: 118 ADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIV 177
            +   +   L NI           PFD+  +  G  T+  EI+           K+ A+ 
Sbjct: 183 CERLCEERGLVNIP----------PFDHPYVIAGQGTVAMEILRQVKNS----AKIGAVF 228

Query: 178 CSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSL 237
             V             ++  +A  I +VGVET       TSL  GK  +   + T A   
Sbjct: 229 VPVGGGGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGT 286

Query: 238 GTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPA 283
               I  +TF  +K    + ++V+  ++         D+  + EP+
Sbjct: 287 AVKMIGEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPS 332

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 107/265 (40%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I     E QKN      V                + ++
Sbjct: 88  VQLKREDLLPVFSFKLRGAYNMIAKLD-ENQKNQG----VIACSAGNHAQGVAYAARHMN 142

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 143 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP------- 195

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H  + K+ A+   V             ++  +
Sbjct: 196 ---PFDHPYVIAGQGTVAMEILR---QVHNSL-KIGAVFVPVGGGGLIAGIGAYLKR--I 246

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I +VGVET      + S+K GK    + + + A       I  +TF  +++   + +
Sbjct: 247 APHIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIV 306

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 307 LVNTDEICAAVKDIFEDTRSIIEPS 331

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 106/270 (39%), Gaps = 25/270 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +++++  V                + L 
Sbjct: 90  VQLKREDLLPVFSFKLRGAYNMIAKLD-----DTQRNQGVIACSAGNHAQGVAYAARHLD 144

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 145 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------- 197

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    +Q     K+ A+   V             ++  +
Sbjct: 198 ---PFDHPYVIAGQGTVAMEIL----RQVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--V 248

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
              I ++GVET      +TSL+  K      + T A       I  +TF  A++   + +
Sbjct: 249 TPHIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIV 308

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           +V+  ++         D+  + EP+   A+
Sbjct: 309 LVNTDEICAAVKDVFEDTRSIVEPSGALAV 338

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 105/265 (39%), Gaps = 25/265 (9%)

Query: 23  VFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPEVFXXXXXXXXXXXXXXXKMLS 82
           V LK E   P  SFK RG  N+I         +S+++  V                K L+
Sbjct: 89  VQLKREDLLPVFSFKLRGAYNMIAKLD-----DSQRNQGVIACSAGNHAQGVAFAAKHLN 143

Query: 83  LPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT----YLKTNVLSNIDKKLIEPI 138
           +P T+V+P +T     + +   G+ V++ GN + EA        +   L+NI        
Sbjct: 144 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP------- 196

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
              PFD+  +  G  T+  EI+    Q H    K+ A+   V             ++  +
Sbjct: 197 ---PFDHPYVIAGQGTVAMEILR---QVH-NANKIGAVFVPVGGGGLVAGVGAYLKR--I 247

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           A  I ++GVET       TSLK G+      +   A       I  +TF  A++   + +
Sbjct: 248 APHIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVV 307

Query: 259 VVDDLKVVETCLKFTRDSNMVAEPA 283
           +V+  ++         D+  + EP+
Sbjct: 308 LVNTDEICAAVKDVFEDTRSIVEPS 332

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 108/295 (36%), Gaps = 29/295 (9%)

Query: 2   SQVYN---KTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57
           S VY+   ++P+ R +     L   V LK E   P  SFK RG  N++   S E QKN  
Sbjct: 67  SSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFSFKLRGAYNMMAKLS-EAQKNQG 125

Query: 58  KSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117
               V                + L++P  +V+P  T     + +   G  V++ GN + E
Sbjct: 126 ----VIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDE 181

Query: 118 ADTYL----KTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKV 173
           A T      +   L+NI           PFD+  +  G  T+  EI+    Q H      
Sbjct: 182 AKTECTRISEERGLTNIP----------PFDHPYVIAGQGTVAMEILR---QVH---NAA 225

Query: 174 KAIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTI 233
           K     V                 +A  I ++GVET       TSL+ G       + T 
Sbjct: 226 KIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLSTVGTF 285

Query: 234 ATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           A       I  +TF   +      I+V+  ++         D+  + EP+   A+
Sbjct: 286 ADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEPSGALAV 340

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 112/295 (37%), Gaps = 29/295 (9%)

Query: 2   SQVYN---KTPLLRHLFPGKNL-PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57
           S VY+   ++P+ R +     L   V LK E   P  SFK RG  N++   + E Q N  
Sbjct: 56  SSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFSFKLRGAYNMMAKLA-EGQGNKG 114

Query: 58  KSPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117
               V                + L++P  +V+P  T     + +   G  V++ GN + E
Sbjct: 115 ----VIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDE 170

Query: 118 ADTYL----KTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKV 173
           A        +   L+NI           PFD+  +  G  T+  EI+    Q H    K+
Sbjct: 171 AKIECARISEERGLTNIP----------PFDHPYVIAGQGTVAMEILR---QVH-NASKI 216

Query: 174 KAIVCSVXXXXXXXXXXXXXEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTI 233
            A+   V             ++  +A  I +VGVET       TSL  G       + T 
Sbjct: 217 GAVFVPVGGGGLVAGVAAYLKR--IAPHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTF 274

Query: 234 ATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAAL 288
           A       I  +TF   + +  + ++V+  ++         D+  + EP+   A+
Sbjct: 275 ADGTSVRMIGEETFRICEDFVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALAV 329

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 93/232 (40%), Gaps = 25/232 (10%)

Query: 79  KMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKTNVLSNIDKKLIEPI 138
           K+L++P T+V+P       V      GA+ I K N + E    +   + +     LI P 
Sbjct: 33  KLLNVPATIVMPEDASTLKVAATTGYGAH-ITKYNRYTEDRDKIGRQLAAKHGFALIPP- 90

Query: 139 YVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSVXXXXXXXXXXXXXEKHDL 198
           Y HP     +  G +    +++E  GQ       + A+   V                 L
Sbjct: 91  YDHP----DVIAGQSASAKKLLEEVGQ-------LDALF--VLLGGGGLLSGSTLASRSL 137

Query: 199 ATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSI 258
           +    + GVE    +    S + G V+  +  NTIA    T ++   TF   ++     +
Sbjct: 138 SPDCKIFGVEPEAGNDGQQSFRSGSVVHIDTPNTIAGEAQTQHLGEYTFAIIRENVDDIL 197

Query: 259 VVDDLKVVETCLKF--TRDSNMVAEPACGAALHMGYNMDILEKS--LGKKLA 306
            V D K++E C+ F   R   +V   AC     +G+   +L+K   +G+K+ 
Sbjct: 198 TVTDGKLIE-CMHFLAERMKLVVGPTAC-----LGHAGAVLKKKELVGEKIG 243

>Suva_8.244 Chr8 (436751..440251) [3501 bp, 1166 aa] {ON} YOR188W
           (REAL)
          Length = 1166

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 5/117 (4%)

Query: 236 SLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMD 295
           SL  ++ +N ++  + K NT   + +  K+ E  +    DS+    P  G       +  
Sbjct: 741 SLKLSSNTNDSYPDSSKVNTDKKIAEPRKISEQSI-VNDDSSSYYSPINGVPTSRMPSQP 799

Query: 296 ILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNEKENYSIFHSLRFQ 352
            L  S  KK   +D  L +  GG SN +Q++    ++   +SN     S  H  R Q
Sbjct: 800 TLLNSGPKKALANDPRLDVLQGGGSNPIQQIMPKSSKRAPESNS----SPIHQHRHQ 852

>KLLA0C18029g Chr3 complement(1601829..1602983) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53206 Saccharomyces cerevisiae
           YGR012W Hypothetical ORF
          Length = 384

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 61/157 (38%), Gaps = 20/157 (12%)

Query: 8   TPLLR----HLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLE--IQKNSKKSPE 61
           TP++R      + G N   VF K E   P GS K R   N+I++ S +  I+ +S K   
Sbjct: 51  TPMVRIKSLSDYTGLN---VFAKMELNNPGGSAKDRVALNIIKTISSQEGIKGSSDKKNR 107

Query: 62  VFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTY 121
           +F                 L   C + +P  T    +  + A GA V    N  K A + 
Sbjct: 108 IFEGTSGSTGISLAICCNALGYSCHISLPDDTSQEKLSLLTALGAIV----NKVKPA-SI 162

Query: 122 LKTNVLSNIDKKLIEP------IYVHPFDNKKIWEGH 152
           +  N   N  K   E       ++   F+N+  W+ H
Sbjct: 163 VDPNQYVNAAKSCSEEYTEGVGVFADQFENEANWKCH 199

>Kpol_1013.43 s1013 complement(97761..98366) [606 bp, 201 aa] {ON}
           complement(97761..98366) [606 nt, 202 aa]
          Length = 201

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 3/72 (4%)

Query: 251 KKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALH---MGYNMDILEKSLGKKLAT 307
           K YN K    DD  +  TC    +  N++A PA     H      N+ + + SL +    
Sbjct: 46  KSYNHKEGQTDDYIIFATCANTEKYENILANPAVSLLFHDWITANNLSVRKNSLSQSATP 105

Query: 308 DDIVLIIACGGS 319
           D   L  +  GS
Sbjct: 106 DPTTLPTSTKGS 117

>NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON}
          Anc_4.69
          Length = 502

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 21 PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSPE 61
          PQVF K E + P GS K R   ++I+    E +   + SPE
Sbjct: 32 PQVFAKLELYNPGGSIKDRIAKSMIE----EAEARGEISPE 68

>CAGL0F08789g Chr6 (868002..869171) [1170 bp, 389 aa] {ON} similar
           to uniprot|P53206 Saccharomyces cerevisiae YGR012w
          Length = 389

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 60/166 (36%), Gaps = 21/166 (12%)

Query: 1   MSQVYNKTPL--LRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKK 58
           M ++   TP+  L+ L        V+ K E   P GS K R   N+IQ    E +    +
Sbjct: 40  MQELIGNTPMVKLKSLCDTDRNINVYAKLEMNNPGGSAKDRIALNIIQVAEAEGRLVRGE 99

Query: 59  SPEVFXXXXXXXXXXXXXXXKMLSLPCTVVVPTATKLRMVEKIKATGANV-------IVK 111
              VF                 L     + +P  T L  +  +K+ GA +       IV 
Sbjct: 100 PGMVFEGTSGSTGISLAMICNALGYKAHISLPDDTSLEKLNLLKSLGAIINPVKPASIVD 159

Query: 112 GNHW-----KEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGH 152
            + +     K  D YL++        K    I+   F+N+  WE H
Sbjct: 160 PDQYVNAAKKACDDYLESG-------KTKYAIFSDQFENEHNWEIH 198

>KNAG0J02670 Chr10 (497838..499340) [1503 bp, 500 aa] {ON}
          Anc_4.69 YGR155W
          Length = 500

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 21 PQVFLKYECFQPSGSFKSRGIGNLIQ 46
          PQV++K E + P GS K R   N+I+
Sbjct: 31 PQVYVKLELYNPGGSTKDRIAKNMIE 56

>ZYRO0G07568g Chr7 complement(596422..598317) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P03874 Saccharomyces
           cerevisiae YHL038C CBP2 Protein required for splicing of
           COB aI5 intron Cytochrome B pre-mRNA processing protein
          Length = 631

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 132 KKLIEP-IYVHPFDNKKIWEGHATMIDEIVETFGQQ 166
           KK+++P  Y++ + N+K  E +  +ID+I++ F QQ
Sbjct: 592 KKMLDPDTYIYLYHNEKHLESNKDLIDDIIDRFDQQ 627

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 45/97 (46%), Gaps = 13/97 (13%)

Query: 205 VGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSIVVDD-- 262
           +GVE+ GCH F  +L +    Q ++     + +    I+ ++  Y    +   +++D+  
Sbjct: 57  IGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPPDGGKVIIDENS 116

Query: 263 LKVV-ETCLKFT----------RDSNMVAEPACGAAL 288
           LK++ +T L +T           D N+ +   CG++ 
Sbjct: 117 LKILNDTVLNYTTELIGSQFKIEDGNLKSSCGCGSSF 153

>NCAS0H01390 Chr8 complement(265088..267538) [2451 bp, 816 aa] {ON}
           Anc_6.123 YBR225W
          Length = 816

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 81  LSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYLKTNVLSNIDKKLIEPIYV 140
           L+LP + V PT+    + EK  +TG       N W E D + K   LSN  + ++   Y+
Sbjct: 515 LTLPASSVTPTSAGSIISEKTMSTGDQNENNQNIWLE-DYFCK--ALSNYQRVILPTQYI 571

Query: 141 HPFDNK 146
            P D K
Sbjct: 572 LPGDGK 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,541,697
Number of extensions: 1382929
Number of successful extensions: 4542
Number of sequences better than 10.0: 78
Number of HSP's gapped: 4551
Number of HSP's successfully gapped: 78
Length of query: 357
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 246
Effective length of database: 40,753,473
Effective search space: 10025354358
Effective search space used: 10025354358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)