Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E040201.4ON54052424270.0
Kpol_2002.71.4ON4745563892e-40
TDEL0C069801.4ON4265253616e-37
Suva_3.1511.4ON4215303422e-34
Skud_3.21.4ON4265343141e-30
Smik_3.131.4ON4252463009e-29
ZYRO0F18502g1.4ON4505462992e-28
YCL063W (VAC17)1.4ON4232452937e-28
NDAI0A001301.4ON4785542871e-26
SAKL0C00440g1.4ON4625592462e-21
NCAS0B091201.4ON4335382282e-19
KLLA0C00462g1.4ON4605612231e-18
CAGL0B00308g1.4ON4303912212e-18
KNAG0C001901.4ON4425402141e-17
TBLA0A075801.4ON5131591714e-12
Kwal_33.130031.4ON4492561054e-04
KAFR0D001201.4ON399144900.019
KLTH0F00462g1.4ON451253800.37
SAKL0B06886g3.322ON66772705.7
NOTE: 2 genes in the same pillar as TPHA0E04020 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04020
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   939   0.0  
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   154   2e-40
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   143   6e-37
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   136   2e-34
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      125   1e-30
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   120   9e-29
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   119   2e-28
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   117   7e-28
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   115   1e-26
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...    99   2e-21
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    92   2e-19
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    91   1e-18
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    90   2e-18
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...    87   1e-17
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    70   4e-12
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    45   4e-04
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    39   0.019
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    35   0.37 
SAKL0B06886g Chr2 (595868..597871) [2004 bp, 667 aa] {ON} simila...    32   5.7  

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/524 (89%), Positives = 468/524 (89%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL
Sbjct: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76

Query: 77  YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTS 136
           YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTS
Sbjct: 77  YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTS 136

Query: 137 TRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGGKLMIKD 196
           TRSSSMESMNLKPLKVVAKHEKRMS          SVTFGKETRISLTTNGIGGKLMIKD
Sbjct: 137 TRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKETRISLTTNGIGGKLMIKD 196

Query: 197 DSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQRFSI 256
           DSDASPQLIDKKYKVLRNAISYDTGL                  DAAYDSLFKNKQRFSI
Sbjct: 197 DSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDAAYDSLFKNKQRFSI 256

Query: 257 SLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDDYILS 316
           SLFEDYVD        EFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDDYILS
Sbjct: 257 SLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDDYILS 316

Query: 317 NSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPT 376
           NSIQLD             HLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPT
Sbjct: 317 NSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPT 376

Query: 377 VASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTS 436
           VASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTS
Sbjct: 377 VASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTS 436

Query: 437 NSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQNA 496
           NSNSSKYFFENWGLF       TFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQNA
Sbjct: 437 NSNSSKYFFENWGLFSSMSSSSTFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQNA 496

Query: 497 YTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKLLF 540
           YTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKLLF
Sbjct: 497 YTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKLLF 540

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  154 bits (389), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 190/556 (34%), Positives = 252/556 (45%), Gaps = 131/556 (23%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           +RSQEAILQLDLWI RQQQ      +  + D      D N+ L  +  TY+LYMSQLNSL
Sbjct: 15  VRSQEAILQLDLWIQRQQQ------WAESDDN----HDEND-LEKVTDTYNLYMSQLNSL 63

Query: 77  YVRSEFIRDKLNSEKN---------NVNKFNLDHR-NIEELVFEFQNIREKLNQLAASSK 126
           Y+RS+ +RDKLN++K          + +K N++ + +IE+L+FEFQ+I  KLN LA+S +
Sbjct: 64  YIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRR 123

Query: 127 LDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTN 186
               S   +S+RSSS+ S   KPLK+  K  K +           +VTF  E    L  N
Sbjct: 124 RCSSS-KSSSSRSSSIGSFQPKPLKISLKRNKSL-----KEQNKKTVTFDVEEVTDLNIN 177

Query: 187 GI----GGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDA 242
            +    G  L    +  +SP +       LR A SYDTGL                  D+
Sbjct: 178 SVISLPGSPLR---NEQSSPPM----NHHLRQAKSYDTGL-----NSKRSIKPKKSKIDS 225

Query: 243 AYDSLFKNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHL 302
            YDS FKN QR SISLF                   D   N   I N SDQETVISSS L
Sbjct: 226 VYDSTFKNTQRLSISLF-------------------DIDTNENDITNISDQETVISSSSL 266

Query: 303 PCITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSN 362
               +EPL+  I+ +                   LRR NSHESILSTK+          +
Sbjct: 267 TM--DEPLE--IIDD------------QKNNLKPLRRYNSHESILSTKIRPI-------S 303

Query: 363 FYDRFIFSSFYRPTVASVSTTSTNIEPFLSDGKNE---SPNKNLQLPLTSSTRGVTSREL 419
              RF    F R    + ++T+ +     +D K +    PN      L++ST   TS+++
Sbjct: 304 ISKRFQIGPF-RSVSTTTTSTNYDTTASNTDVKADDFYKPN------LSNST---TSKDI 353

Query: 420 LSKFADKPEQLKAPTTSN-------SNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIIS 472
           LS ++ K + ++     N       SNSS  FF  W +F                  I S
Sbjct: 354 LSMYSIKND-VQNSNRGNIINNKKESNSSTSFFNKWNIFNFPL--------------IAS 398

Query: 473 SEVGKKLCDRSTG----------IKVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKER 522
           SEVG K  + +T           I   S N  N Y+   I  N        I  P     
Sbjct: 399 SEVGSKQENNTTAKHFGSQRKKQISSLSYNKAN-YSTMTIGPNGSMFCSPTIYEPTFSNT 457

Query: 523 VSYNELHDALNTEIKL 538
           VS+ ELHDALNTE+ L
Sbjct: 458 VSFQELHDALNTELDL 473

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  143 bits (361), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 151/525 (28%), Positives = 218/525 (41%), Gaps = 119/525 (22%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLY 77
           RSQEAILQL+LWI RQQ                + +DS  +++ L + Y++Y++QLNSL 
Sbjct: 13  RSQEAILQLELWIQRQQHLR-------------ELEDS--SIDKLGNQYNVYIAQLNSLC 57

Query: 78  VRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTST 137
           VRSE++RDKLN E+        D + IE+LVFEFQ+I  KLN+LA S  +D  +P   ST
Sbjct: 58  VRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQSID-STPSSKST 116

Query: 138 RSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGGKLMIKDD 197
           R SS+ S   +PLK+  +H   +           SV   K  + S   +     +     
Sbjct: 117 R-SSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVI--KSVKFSGLHDSKEEAVSKCLS 173

Query: 198 SDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQRFSIS 257
              SP  +    + +R A SYDTGL                  D    S+F+  QR SI+
Sbjct: 174 LPGSPVRVTGPTRSIRMAKSYDTGL------NSKNTKKSKGSRDYDVPSIFRENQRLSIT 227

Query: 258 LFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDDYILSN 317
           +F+D+                      E  ++ SDQ+TVIS          P DD     
Sbjct: 228 VFDDF---------------------DEDADSTSDQDTVISLV--------PADD----- 253

Query: 318 SIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPTV 377
                              LRR NSHESILSTK++           +  F+  S  RP++
Sbjct: 254 --------------GKGLPLRRFNSHESILSTKVQPI----SSLPLFSSFLLPSSNRPSM 295

Query: 378 ASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTSN 437
            SV  +S    P  S  K  +P               +SR+LLS F  +P +    T   
Sbjct: 296 KSVRVSSA---PVFS--KTSAP--------------ASSRDLLSTFVTRPGKASNATGIK 336

Query: 438 SNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISSEVGKKLCDR----STGIKVTSINT 493
             +   FF NW  F          +  +S S+ I +   K    R    S   +  ++  
Sbjct: 337 QENKLGFFANWNFF----------KGPSSASHDIRATKQKASASRPESNSADCRSKTLEK 386

Query: 494 QNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKL 538
                F           +  +  P+    +SY +L +AL+TEI L
Sbjct: 387 MAPRRFS---------PRSPVKAPVFDSLISYEDLREALSTEIIL 422

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  136 bits (342), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 226/530 (42%), Gaps = 133/530 (25%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLY 77
           RS+EAILQLDLWI RQQ+        +  +  ++     ++L+ L   Y+ YMSQLNSLY
Sbjct: 16  RSEEAILQLDLWIQRQQR-------SSVCEPSDR-----DSLDKLSQQYNQYMSQLNSLY 63

Query: 78  VRSEFIRDKLNSEK-NNVNKFNLDHRNIEELVFEFQNIREKLNQLA-ASSKLDKHSPPKT 135
           VRSE +RDKL+ E+   +N    +H+ IE+LV EFQ+I  +LN LA   +K    SP   
Sbjct: 64  VRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQ 123

Query: 136 STRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGK--ETRISLTTNGIGGKLM 193
           STR SS++S   +PLK++ +  +R+           SV F    +      TN +     
Sbjct: 124 STR-SSLDSFQPRPLKIIER--QRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLP---- 176

Query: 194 IKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQR 253
                  SP+    K   LR A S+DTGL                    AY+S FKNKQR
Sbjct: 177 ------CSPKKQPGKAHTLRAAKSHDTGLNKSKKPSSTD----------AYESFFKNKQR 220

Query: 254 FSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLPCITN----EP 309
            S++ F++  D             +D+  +T ++ N      + + SH+   T     EP
Sbjct: 221 LSLTFFDEMDDE-----------DLDSDQDTIILPN------ISTPSHMDMATKGAEFEP 263

Query: 310 LDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIF 369
           L                           RR NSHESILS K       ++GS     F F
Sbjct: 264 L---------------------------RRYNSHESILSNKPAPAMSLSLGS-----FPF 291

Query: 370 SSFYRPTVA-SVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPE 428
                PT   SVS    N  P ++            +P  + +R  TS+ LLS F  +P+
Sbjct: 292 FKPSNPTFGTSVSNVQVNYRPKMAAS---------MIPKRNGSRAPTSKALLSSFIAQPD 342

Query: 429 QLKAPTTSNSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISSEVGKKLCDRSTGIKV 488
           ++     S +     F + +               N+S S I  S   KK      G K 
Sbjct: 343 RIVVKQKSTNLKHTSFLDKF---------------NSSLSTISESFQNKK------GKKS 381

Query: 489 TSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKL 538
           + +N          R   H + + N  N ++   VS  EL DALNTE+ L
Sbjct: 382 SDLNDD--------RIPPHIMPEHN--NNLMDMGVSIEELQDALNTELLL 421

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  125 bits (314), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 159/534 (29%), Positives = 240/534 (44%), Gaps = 132/534 (24%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQEAILQLDLWI RQQ+        +   T ++     E+L+ L   Y+ YMSQLNSL
Sbjct: 15  IRSQEAILQLDLWIQRQQR-------SSVCQTSDQ-----ESLDKLSQQYNQYMSQLNSL 62

Query: 77  YVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPK 134
           YVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA       +  P+
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVHEFQDITSRLNELATVPHGVSNDSPQ 121

Query: 135 TSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGG-KLM 193
           + +  SS  S   +PLK++ +    M            VT  K  + S+  N I      
Sbjct: 122 SQSTRSSSGSFQPRPLKIIERQRVCM------------VTPSKPPKKSVGFNPINDVDCP 169

Query: 194 IKDDS-DASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQ 252
            K +S   SP+    K + LR A S+DTGL                    AY+S FKNKQ
Sbjct: 170 SKTNSLPCSPKKPPAKNRTLRAAKSHDTGLNKSKKMSSTD----------AYESFFKNKQ 219

Query: 253 RFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDD 312
           R S++ F++  D                       + +SDQ+T+I    LP I+  P  +
Sbjct: 220 RLSLTFFDEMDDE----------------------DLDSDQDTII----LPNISTPPHMN 253

Query: 313 YILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSF 372
            + +   + +              LRR NSHESILS K       ++G          SF
Sbjct: 254 -VTAKGAEFEP-------------LRRYNSHESILSNKPAPIMSLSLGG------FPGSF 293

Query: 373 YRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGV---TSRELLSKFADKPEQ 429
           Y+P+  +  T+++N++           +  + + + S   G    +S+ LLS F  +P++
Sbjct: 294 YKPSHPTFGTSTSNVQ--------VDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDR 345

Query: 430 LKAPTTSNSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISS---EVGKKLCDRSTGI 486
           + A     +     F + +               N+S S I  S   + GKK  D + G 
Sbjct: 346 IAAKQDPTNLKHTSFLDKF---------------NSSLSTISESFQNKKGKKNKDVNDG- 389

Query: 487 KVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKLLF 540
           +++++N              H  T++   N I+   VS  EL DALNTE  LLF
Sbjct: 390 RISNLN--------------HIATQEQKKN-IMDMSVSIEELQDALNTE--LLF 426

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  120 bits (300), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 128/246 (52%), Gaps = 41/246 (16%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQEAILQLDLWI RQQ+        +   T ++     E L+ +   Y+ YMSQLNSL
Sbjct: 15  IRSQEAILQLDLWIQRQQR-------SSVCQTTDQ-----ELLDKVSKQYNQYMSQLNSL 62

Query: 77  YVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLA-ASSKLDKHSPP 133
           YVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA A +++   SP 
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVREFQDITLRLNELATAPNEVANDSPQ 121

Query: 134 KTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLT--TNGIGGK 191
             STR SS+ES   +PLK++ +  +R+           SV F     +     TN +   
Sbjct: 122 SQSTR-SSLESFQPRPLKIIER--QRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLP-- 176

Query: 192 LMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNK 251
                    SP+    K   LR A S+DTGL                    AY+S FKN+
Sbjct: 177 --------CSPKKQPAKNHTLRAAKSHDTGLNKSKKPSSAD----------AYESFFKNR 218

Query: 252 QRFSIS 257
           QR S++
Sbjct: 219 QRLSLT 224

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 152/546 (27%), Positives = 238/546 (43%), Gaps = 132/546 (24%)

Query: 17  IRSQEAILQLDLWILRQQ---QQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQL 73
           IRSQEA+LQL+LWI RQQ   +  ++H                 A + +   Y+LYM+QL
Sbjct: 13  IRSQEAVLQLELWIRRQQHLSEIEHEH-----------------ARDKIADQYNLYMAQL 55

Query: 74  NSLYVRSEFIRDKLNSEKNNVNKFNLDHRN-IEELVFEFQNIREKLNQLAASSKLDKHSP 132
           NSL VRSE++RDKLN+   N     ++ +N IE+LV+EFQ+I  KLN+LA + K  +   
Sbjct: 56  NSLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQK--EQVT 113

Query: 133 PKTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXX----XXXSVTFGKETRISL----- 183
           P +   + S+ S   +PLK+  ++   +               +V F +E+   L     
Sbjct: 114 PSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSK 173

Query: 184 TTNGIGGKLMIKDDSDASP-QLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDA 242
            T+  G  L ++     SP +L D+    LR A SYDTGL                  + 
Sbjct: 174 CTSLPGSPLKMR-----SPDRLPDRP---LRVAKSYDTGL------NPNSRAKLKKQKEE 219

Query: 243 AYDSLFKNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHL 302
              S+FK  QR SI+  +D +D                    E  ++ SDQ TVIS+S +
Sbjct: 220 EMLSVFKENQRLSITFCDD-ID--------------------EGSDSASDQNTVISTSPI 258

Query: 303 PCITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSN 362
           P            S+ IQ D              LRR NSH+S+LSTK++      + S 
Sbjct: 259 PP-----------SHPIQYDVQSEKPP-------LRRYNSHDSVLSTKVQ-----PISSA 295

Query: 363 FYDRFI-FSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRG-VTSRELL 420
               F+   +  RP++ SV+ +S                     P+ SST G  +S++LL
Sbjct: 296 KCPTFLTIPTANRPSMKSVTVSSA--------------------PIISSTGGKASSKDLL 335

Query: 421 SKFADKPEQLKAPTTSNSNSSKYFFEN--WGLFXXXXXXXTFHRKNTSGSNIISSEVGKK 478
           S F    +       +++ ++  F  N  W LF           +N +   +   +V   
Sbjct: 336 SSFISNTQDYDKKARNDNGNNNRFSSNLIWNLFKQKSQKN----RNPTPLRVPQQDVTS- 390

Query: 479 LCDRSTGIKVTSINTQNAYTFP---FIRSNSHDI---TKQNITNPIIKERVSYNELHDAL 532
             +R     +T+ +    Y+      +++ +  I   T+Q ITN        Y+EL +AL
Sbjct: 391 --ERKENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRITN----GNTMYDELQEAL 444

Query: 533 NTEIKL 538
           +TE+ L
Sbjct: 445 DTELVL 450

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  117 bits (293), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 122/245 (49%), Gaps = 39/245 (15%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQEAILQLDLWI RQQ+          TD         E+L+ L   Y+ YMSQLNSL
Sbjct: 15  IRSQEAILQLDLWIQRQQRSS----ICQTTD--------QESLDKLSQQYNQYMSQLNSL 62

Query: 77  YVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPK 134
           YVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA       +  P+
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVREFQDITLRLNELATVPNEAPNDSPQ 121

Query: 135 TSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGK--ETRISLTTNGIGGKL 192
           + +  SS+ S   +PLK++ +  +R+           SV F    E      TN +    
Sbjct: 122 SQSTRSSLGSFQPRPLKIIER--QRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSL---- 175

Query: 193 MIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQ 252
                   SP+    + + LR A S+DTGL                     Y+S FKN+Q
Sbjct: 176 ------PCSPKKQPARNRTLRAAKSHDTGLNKSKKPSSSD----------TYESFFKNRQ 219

Query: 253 RFSIS 257
           R S++
Sbjct: 220 RLSLT 224

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 337 LRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPTVASVSTTSTNIE 388
           LRR NSHESILS K   +   N+GS        +SF+RP+  +  T+ +N++
Sbjct: 264 LRRYNSHESILSNKPAPSKSLNLGS------FSASFFRPSNPTFGTSISNVQ 309

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 155/554 (27%), Positives = 234/554 (42%), Gaps = 121/554 (21%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQEAILQLDLWI R+++Q       T  ++ N T D     +     Y++Y++QLNSL
Sbjct: 14  IRSQEAILQLDLWIQREKKQQ---ELSTLNNSNNITYD-----HVDNQQYNVYLAQLNSL 65

Query: 77  YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSP--PK 134
            VR ++IRDK     N ++    + + IE LV+EF+ I  KLN L+  +K    S    K
Sbjct: 66  IVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSSENSSK 125

Query: 135 TSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGGKLMI 194
           T++  SSMES   KPLK++ + +                    + ++S T N     L++
Sbjct: 126 TASSKSSMESFEPKPLKIIKRTK-------------------NDQKVSNTINN-DHDLIM 165

Query: 195 KDDSDASPQ-------------LIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXD 241
           +D++   P               I +  + LR   S D                     D
Sbjct: 166 QDENLQRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFEND 225

Query: 242 AAYDSLFKNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTE-LIENNSDQETVISSS 300
              +  FK++QR SI +F++  D          N      I  E L +NNSDQ TVIS  
Sbjct: 226 TI-NQFFKSQQRLSIGIFDNDDDNIYST-----NMGTATRITGEYLTDNNSDQATVISQG 279

Query: 301 HLPCITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVG 360
            +        DD+                       LRR NSHESILS K+ +T   +  
Sbjct: 280 TIK----RNDDDF---------------------TPLRRYNSHESILSQKISSTPLIDNN 314

Query: 361 SN--FYDRF-IFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSST------ 411
           +N  F  +  ++SS  RP++ S+  TS  I    S GK    +K+L     +S+      
Sbjct: 315 NNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARSSQGK---TSKDLLSSFVTSSIPRNNN 371

Query: 412 RGVTSRELLSKFADKPEQLKAPTTSNSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNII 471
           R + +R      + +  QL+  T  N  S+  FF NW                    N+I
Sbjct: 372 RNIQTRTKTRTQSRRNNQLRDHTI-NQTSTSSFFGNWNFLNRF--------------NMI 416

Query: 472 SSEVGKKLCDRSTGIKVTSINTQNAYTFPFI-RSNSHDITKQN------ITNPIIKERVS 524
           +SE              T+ N +  Y  P + +S +H+I   +      I  P+    +S
Sbjct: 417 TSETN------------TTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISIKEPVYDNTIS 464

Query: 525 YNELHDALNTEIKL 538
            ++L DALNTE+ L
Sbjct: 465 LDDLEDALNTELLL 478

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 150/559 (26%), Positives = 221/559 (39%), Gaps = 146/559 (26%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           +RSQEAILQLDL+I RQQ+ + ++      D G  TK            Y   ++QLNSL
Sbjct: 13  VRSQEAILQLDLYIQRQQRLY-EYETLDQPDNGLLTKLQE---------YQTCLAQLNSL 62

Query: 77  YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTS 136
           ++RSE +RD++ S  +  ++   D  +I  LV EFQ I  KLN+LAA+      SP   S
Sbjct: 63  HIRSEHLRDRIASTDHRASQ---DGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQS 119

Query: 137 TRS-SSMESMNLK------------PLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISL 183
           T+S SS E   LK            P K VA   K+++           V F   ++   
Sbjct: 120 TKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSK--- 176

Query: 184 TTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAA 243
           +T+  G   M    + +SP  I ++ +  R+A S D GL                     
Sbjct: 177 STSLPGSPSM----AASSPVSIQQE-RFPRHAKSCDAGLNKQQRRRQDSDNRL------- 224

Query: 244 YDSLFKNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLP 303
             + FK  QR SIS F+D +D                         +SD++TVIS S   
Sbjct: 225 --NFFKENQRLSISFFDDEIDY------------------------SSDEDTVISVS--- 255

Query: 304 CITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNF 363
                P +        + +              LRR NSHES+LS K      + + +  
Sbjct: 256 -----PPETTSFKGFPKAEP-------------LRRYNSHESVLSRK------EVLPAAL 291

Query: 364 YDRFIFSSFY-------RPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTS 416
             R  + S +       +P   SV   S N +P  S            L  + S    TS
Sbjct: 292 PARAGWFSLWAGRNNKPKPMAESV---SINDKPVYSTAA---------LLRSHSKTTETS 339

Query: 417 RELLSKFADKPEQLKAPTTS----NSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIIS 472
           ++LL++F     + K  TTS         +  F  W LF              + S +++
Sbjct: 340 KDLLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLF--------------NNSVLVT 385

Query: 473 SEVGKKLCDRSTGIKVTSINTQN-AYTFPFIRSNSHDITKQNITN------------PII 519
           SE G  L D ++      I     A   P  R  +H  +   I              P++
Sbjct: 386 SETG--LQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVL 443

Query: 520 KERVSYNELHDALNTEIKL 538
             +VSY+ LH+AL TE +L
Sbjct: 444 NNKVSYDALHEALCTEFRL 462

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 142/538 (26%), Positives = 221/538 (41%), Gaps = 133/538 (24%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTAT----DTGNKTKDSNEALNALRSTYDLYMSQ 72
           +RSQEAILQLD+WI RQ++               DT N   D    L      Y+ YM+Q
Sbjct: 13  VRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDT-NTNMDIRGTLPQFLEQYNTYMAQ 71

Query: 73  LNSLYVRSEFIRDKLNSEKN-NVNKFNLDHRN-------IEELVFEFQNIREKLNQLAAS 124
           LNSL VR EFIRD L ++KN  +    L+  N       I++LV EFQ+I +KL++L+ +
Sbjct: 72  LNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQKLSELS-T 130

Query: 125 SKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLT 184
            +    +  ++++  SS+ES   KPL+++++     S           V+F ++   S  
Sbjct: 131 VRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTH-SHLHQQTSLDKKVSFNEDESNSSI 189

Query: 185 TNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAY 244
           ++    + + ++             K LRN  S D                      + +
Sbjct: 190 SHSRSMESLHENS------------KSLRNTKSMDV------------LKRSTFKNHSDF 225

Query: 245 DSLFKNKQRFSISLFEDYVDXXXXXXXXEF-NPTVDASINTELIENNSDQETVISSSHLP 303
             L  ++QR SI++F+D  D        EF N   D           SDQ TVIS     
Sbjct: 226 SKLLNSRQRLSINIFDD--DLIANEDGNEFYNQYSD-----------SDQATVISHGTPI 272

Query: 304 CITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNF 363
              + PL                          LRR NSHESILS      F K   S  
Sbjct: 273 RGADTPL--------------------------LRRYNSHESILS------FRKPTQSRQ 300

Query: 364 YDRFI-FSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTR-GVTSRELLS 421
            ++ + +SS  +P++ SV+  S                     P+ S  R   TS++LLS
Sbjct: 301 PNQILPYSSVRQPSMQSVAVNSN--------------------PIFSRMRPNATSKDLLS 340

Query: 422 KFADKPEQLKAPTTSNSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISSEVGKKLCD 481
            F +KP+  +        +S   F  W  F                 N ++SE+G     
Sbjct: 341 SFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKF--------------NSVTSEIG----- 381

Query: 482 RSTGIKVTSINTQNAYTFPFIRSNSHDI-TKQNITNPIIKERVSYNELHDALNTEIKL 538
            +T  ++   N+  +  F     N +DI +  +I  P+  + +   +L+DALNTE+ L
Sbjct: 382 -TTTTQLYPTNSSMSNKF-----NPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 136/561 (24%), Positives = 230/561 (40%), Gaps = 158/561 (28%)

Query: 17  IRSQEAILQLDLWILRQQQQ---HNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQL 73
           IR  EA++QL+L I R+  +   +N H F    +                  Y  ++++L
Sbjct: 13  IRCNEAVMQLELSIQRKMCEFDPNNSHCFIQVQE------------------YYSFLARL 54

Query: 74  NSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPP 133
           +SL +R+E +++ L  ++ + N   +++  +E+L++EFQ+I   LN++A + +    SP 
Sbjct: 55  SSLKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQ----SPT 110

Query: 134 KTSTRSSSMES--MNLKPLKVVAKHE---------KRMSXXXXXXXXXXSVTFGKETRIS 182
           K++   SS ES  + LK LK++ ++          K+            S+   +  R  
Sbjct: 111 KSARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQ 170

Query: 183 -------------LTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXX 229
                           N + G  M   D+    Q+  +++K LR A SYD GL       
Sbjct: 171 EDDLDILHHLHSVKRANSLPGSPM--PDTLLESQMFSREHKTLRMAKSYDVGLNGRAKK- 227

Query: 230 XXXXXXXXXXXDAAYDSLFKNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIEN 289
                      +A ++  FKNK R S+S+F+D                    +NT+    
Sbjct: 228 -----------NADWE-FFKNKNRLSLSVFDD--------------------VNTDA--- 252

Query: 290 NSDQETVISSSHLPCITNEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILST 349
            SD+ETVIS S        P   Y LS +                  +RRCNSHESILS 
Sbjct: 253 -SDEETVISVS-------PPNISYYLSQN----------EDQYPSKQVRRCNSHESILSR 294

Query: 350 KLENTFYKNVGSNFYDRFIFSSFY-------RPTVASVSTTSTNIEPFLSDGKNESPNKN 402
           K+      +  +N   R  + S +       +PT+ S ST+++   P +      SP+  
Sbjct: 295 KI---LSPSTPANLIMRPTYQSVWQKKAIVTKPTI-SCSTSNSTASPTIG-----SPH-- 343

Query: 403 LQLPLTSSTRGVTSRELLSKFADKPEQLKAPTT-SNSNSSKY---FFENWGLFXXXXXXX 458
                        S+++LS+F   P   K     S+SNS+ +    F+ W          
Sbjct: 344 ------------LSKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKWFNSDSLVTKE 391

Query: 459 TFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQNAYTFP----FIRSNSHDITKQNI 514
             +  N+S S+      G+ + +       ++  + +    P    FIR          +
Sbjct: 392 IGNPDNSSPSS------GRPIVENRQRHSSSNSYSTSIVIGPNGAKFIR---------GL 436

Query: 515 TNPIIKERVSYNELHDALNTE 535
            +P++   VSYNEL +ALNTE
Sbjct: 437 NDPLVTCTVSYNELQEALNTE 457

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 113/391 (28%), Positives = 171/391 (43%), Gaps = 92/391 (23%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLY 77
           RS EAI QLD WIL Q    N +R  +   +G    DS E L+     Y  ++ +LNSLY
Sbjct: 14  RSNEAIEQLDEWILLQ----NKNRHISENKSG---LDSIERLD---DKYTEFLEKLNSLY 63

Query: 78  VRSEFIRDKLNSEKN---NVNKFNLDHRNIEELVFEFQNIREKLNQLAAS---SKLDKHS 131
           +RS++I+DK+ +EKN      K  L+   I+EL+ EF+ I   LN++A     +   + S
Sbjct: 64  IRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQLS 123

Query: 132 PPKTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGGK 191
           P  TST+ SS+ES   KPLK++ +     S               K+  IS         
Sbjct: 124 PASTSTK-SSLESFTPKPLKILNRASMIRSPINSP---------PKKRNISFCPIHENLS 173

Query: 192 LMIKDDSDASP---QLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLF 248
           +   +   +SP    L++++ +VL  A S+ TGL                      D  F
Sbjct: 174 VTEYESLPSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKN---------QLDKYF 224

Query: 249 KNKQRFSISLFEDYVDXXXXXXXXEFNPTVDASINTELIENN--SDQETVISSSHLPCIT 306
           K+KQR S++LF                 + DA  + E + NN  SD+ETVI +S     T
Sbjct: 225 KDKQRLSLTLF----------------GSADAD-DGESLNNNDYSDEETVIFTSSSNIET 267

Query: 307 NEPLDDYILSNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGSNF--- 363
           +   DD                        +RRCNSHES+LS  + N F     +N    
Sbjct: 268 DAITDDM---------------------KPIRRCNSHESVLS--VHNKFVPKNNNNLQFQ 304

Query: 364 -----YDRFIFSS----FYRPTVASVSTTST 385
                + R++ +S    F  P++ ++  + T
Sbjct: 305 NRLEPFGRYLATSNNRNFTIPSIQNIQVSGT 335

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 223/540 (41%), Gaps = 128/540 (23%)

Query: 17  IRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSL 76
           IRSQ+AILQL+LW+ +Q++          TD  +  +   EA+   R   +L++SQLNSL
Sbjct: 13  IRSQDAILQLELWVQQQEKL-------LLTDHASVDRKKFEAIAQQR---NLHLSQLNSL 62

Query: 77  YVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTS 136
            +RS +I++KL SE+N  +        IE LV+EFQ+I   LN+L+ +++  K+  P + 
Sbjct: 63  CLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNR--KNGSPVSQ 120

Query: 137 TRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTFGKETRISLTTNGIGGKLMIKD 196
             ++S +S   KPL+++ + ++  +           +   +ET  S  T  +     +  
Sbjct: 121 ATTNSSDSFEPKPLRILER-QRTCNAKSPTKRNSNHIKIPRETEKSDFTENVAD--CLHS 177

Query: 197 DSDASP-QLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNKQRFS 255
              +SP +  +   + +R   SY   L                   +   + F  K R S
Sbjct: 178 SLPSSPLRGSNGSQQTIRLTKSYHESL-----------NGQKPTSHSPLMNPFNAKNRLS 226

Query: 256 ISLFEDYVDXXXXXXXXEFNPTVDASINTELIENNSDQETVISSSHLPCITNEPLDDYIL 315
           + LF D +D        E  P  D         +NSDQETV        + N P    ++
Sbjct: 227 LYLF-DNID------EKELTPCDD---------DNSDQETV--------MYNSP----VV 258

Query: 316 SNSIQLDXXXXXXXXXXXXXHLRRCNSHESILSTKLENTFYKNVGS-NFYDRFIFSSFYR 374
           S     +              LRR NSHESILS   +   + +     FY          
Sbjct: 259 SKGAAFEP-------------LRRYNSHESILSVAKKAPIHSSAQKLQFY---------- 295

Query: 375 PTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPT 434
           P+  + +T++ ++  F+S     +       PL+  +R   S++LLS  A         T
Sbjct: 296 PSATNGTTSAQSV--FVSSKPVYTK------PLSVQSR---SKDLLSSIAHAEASKDTKT 344

Query: 435 TSNSNSSKYFFENWGLFXXXXXXXTFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQ 494
           TS        F  W LF              S +  I+SEVG   C  S   K ++I T 
Sbjct: 345 TS-------VFNGWNLF------------GKSSTAAITSEVGT--CAISQK-KHSAIKTN 382

Query: 495 NAY----TFPFIRSNSHDITKQNI------------TNPIIKERVSYNELHDALNTEIKL 538
             Y    T     SN   +++ ++              PI+  +V  NEL +AL TE+ L
Sbjct: 383 RRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALETELLL 442

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 79/159 (49%), Gaps = 32/159 (20%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLY 77
           ++QEA+LQLDLWI  QQ   N  R G    T        E+L      Y+ YM QLNSLY
Sbjct: 14  KAQEAVLQLDLWIKDQQGFQN--RDGLRASTS-------ESLEQAERDYNRYMFQLNSLY 64

Query: 78  VRSEFIRDKLNSEKNNVNKFNL-----------DHRNIEELVFEFQNIREKLNQLAA--- 123
           +R+++IRDK+  +    N +NL            H  +++LV EF ++  K+N+L+A   
Sbjct: 65  LRAQYIRDKIEKQ----NAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE 120

Query: 124 -----SSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHE 157
                SS L   S     + S   +    +PLK++ + +
Sbjct: 121 NVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQK 159

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 106/256 (41%), Gaps = 45/256 (17%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRST----YDLYMSQL 73
           RS+EA+++L+  + +Q++ +   R             S++ L+   S+    Y  Y+ QL
Sbjct: 14  RSEEALVRLEKCVGKQRRLYESER-------------SDQCLSEESSSTIVQYYSYLGQL 60

Query: 74  NSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPP 133
           N LY++++ ++D + +   ++   N     IE L  +++ +    N+L    K  + SP 
Sbjct: 61  NCLYIKAQSLKDMMGNRCGHLP--NSTQEAIERLEHDYKALCNHANELGIREKNLEDSP- 117

Query: 134 KTSTRSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTF--------GKETRISLTT 185
            +    +S+ S   KPLK++   E+R++          + T         G +       
Sbjct: 118 -SCLSPASVSSFQPKPLKII---ERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIP 173

Query: 186 NGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYD 245
           + IG       +S  + +   K+ K +R   S  TGL                       
Sbjct: 174 DEIGKTNSCNTNSPCTNE-AKKEPKFIRVVKSCGTGLNKHSNPHENRL------------ 220

Query: 246 SLFKNKQRFSISLFED 261
           S F+++QR SIS  ED
Sbjct: 221 SFFRDRQRLSISFIED 236

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 42/144 (29%)

Query: 18  RSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLY 77
           RS+EA+ QL+ W+ +Q+Q H                         ++T +    QLNSL 
Sbjct: 12  RSEEAVSQLESWLKQQEQLH-------------------------QTTAE--YKQLNSLC 44

Query: 78  VRSEFIRDKLNSEKNNVNKFNLDHRN----IEELVFEFQNIREKLNQLAASSKLDKHSPP 133
            +S++I + L  + +++    ++ +     +E L+ EF  I  KLN++        H+ P
Sbjct: 45  AKSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT------HTSP 98

Query: 134 KTSTRSSSMESMNLKPLKVVAKHE 157
           +     S+++S   KPL ++ K++
Sbjct: 99  Q-----STIDSFEPKPLNLLRKNK 117

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 106/253 (41%), Gaps = 34/253 (13%)

Query: 19  SQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDLYMSQLNSLYV 78
           SQ A+ +LD  + RQ++ +         ++G   +  ++  +   + Y  Y+ QL SLY 
Sbjct: 15  SQSALARLDSCLERQRRLY---------ESGFPDQCLSDKSSTNMAQYYEYIGQLYSLYT 65

Query: 79  RSEFIRDK-LNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSKLDKHSPPKTST 137
           +++ + D  + S+  +++  ++  R IE L+ EFQ I +      + S   + SP   S 
Sbjct: 66  KAQKLSDTVILSDSKSLS--SVQQRAIENLIQEFQEIAKNDENFISYSM--RESPNSMSV 121

Query: 138 RSSSMESMNLKPLKVVAKHEKRMSXXXXXXXXXXSVTF---GKETRISLTTNGIGGKLMI 194
           +S  + S   KPLK++ + + ++                  G ET ++  ++    +L+ 
Sbjct: 122 QS--ICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERLLG 179

Query: 195 KDDSDA---SPQLIDKKYKVLRNAISYDTGLXXXXXXXXXXXXXXXXXXDAAYDSLFKNK 251
              S      P   +     +R+A S D GL                       + FK++
Sbjct: 180 SSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRL------------NFFKDR 227

Query: 252 QRFSISLFEDYVD 264
           QR SIS  ED  D
Sbjct: 228 QRLSISFIEDEED 240

>SAKL0B06886g Chr2 (595868..597871) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38121 Saccharomyces cerevisiae YBL035C POL12
           Subunit of the DNA polymerase alpha-primase complex
           required for the initiation of DNA replication during
           mitotic DNA synthesis and premeiotic DNA synthesis
          Length = 667

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 54  DSNEALNALRSTYDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEEL-VFEFQ 112
           D  E L +L +   +Y      LY+R E       S   N NK  L+ RNIE+   F  Q
Sbjct: 17  DKAETLTSLETLMKIYALSAEDLYIRWEQF-----SYHKNENKTELNDRNIEQFKQFMQQ 71

Query: 113 NIREKLNQLAAS 124
            I +KLN    S
Sbjct: 72  QIEKKLNNATGS 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,195,253
Number of extensions: 2194599
Number of successful extensions: 8632
Number of sequences better than 10.0: 86
Number of HSP's gapped: 8977
Number of HSP's successfully gapped: 95
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)