Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E040101.5ON96596538010.0
Kpol_2002.81.5ON985101310121e-121
KAFR0D001401.5ON10416857816e-88
NCAS0B091101.5ON10206486831e-74
Suva_3.1521.5ON11403836702e-72
Smik_3.141.5ON11133496622e-71
TBLA0A075701.5ON12527006562e-70
Skud_3.31.5ON11523836453e-69
SAKL0C00462g1.5ON11773746358e-68
YCL061C (MRC1)1.5ON10963496284e-67
NDAI0A001401.5ON10913436258e-67
KNAG0C002201.5ON11614495833e-61
TDEL0C069701.5ON9414315651e-59
ZYRO0F18480g1.5ON9604515511e-57
CAGL0B00330g1.5ON11363545344e-55
Ecym_10081.5ON11183485273e-54
KLTH0F00484g1.5ON9933474471e-44
AFR745W1.5ON10183544321e-42
KLLA0C00484g1.5ON9253634292e-42
Kwal_33.130051.5ON9703594168e-41
TPHA0E030105.211ON90565820.46
Smik_4.1983.153ON854114753.3
CAGL0K12562g8.34ON168239719.9
NDAI0C048708.426ON1241307110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04010
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...  1468   0.0  
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   394   e-121
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   305   6e-88
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   267   1e-74
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   262   2e-72
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   259   2e-71
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   257   2e-70
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   253   3e-69
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   249   8e-68
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   246   4e-67
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   245   8e-67
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   229   3e-61
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   222   1e-59
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   216   1e-57
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   210   4e-55
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   207   3e-54
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   176   1e-44
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   171   1e-42
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   169   2e-42
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   164   8e-41
TPHA0E03010 Chr5 (633187..635904) [2718 bp, 905 aa] {ON} Anc_5.2...    36   0.46 
Smik_4.198 Chr4 complement(360009..362573) [2565 bp, 854 aa] {ON...    33   3.3  
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    32   9.9  
NDAI0C04870 Chr3 complement(1127470..1131195) [3726 bp, 1241 aa]...    32   10.0 

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score = 1468 bits (3801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 772/965 (80%), Positives = 772/965 (80%)

Query: 1   MDSLFDQLNHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILGQ 60
           MDSLFDQLNHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILGQ
Sbjct: 1   MDSLFDQLNHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILGQ 60

Query: 61  IRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHNS 120
           IRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHNS
Sbjct: 61  IRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHNS 120

Query: 121 FKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQTVLVIENTQPLP 180
           FKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQTVLVIENTQPLP
Sbjct: 121 FKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQTVLVIENTQPLP 180

Query: 181 SEIKTQVVNEVNSALPVTQPTQTIVATQANEVTYDTQELMPTVDDVAMRSTGLKITDIEK 240
           SEIKTQVVNEVNSALPVTQPTQTIVATQANEVTYDTQELMPTVDDVAMRSTGLKITDIEK
Sbjct: 181 SEIKTQVVNEVNSALPVTQPTQTIVATQANEVTYDTQELMPTVDDVAMRSTGLKITDIEK 240

Query: 241 ELEEEQRLAXXXXXXXXXXXXXXXXXXXXXXXXXDFLNHFXXXXXXXXXXXKNEKGPNVD 300
           ELEEEQRLA                         DFLNHF           KNEKGPNVD
Sbjct: 241 ELEEEQRLAKETEFGTEFKFKESESKISKKFSKEDFLNHFDDSSSSEDETSKNEKGPNVD 300

Query: 301 KSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASK 360
           KSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASK
Sbjct: 301 KSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASK 360

Query: 361 AVILNIRANXXXXXXXXXXXXXXTTLLMLYNNLKRASKEQIVSYQKELMXXXXXXXXXXX 420
           AVILNIRAN              TTLLMLYNNLKRASKEQIVSYQKELM           
Sbjct: 361 AVILNIRANKSKQQPKVSQKSDQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELE 420

Query: 421 XXXXXXXXXXXQEIAXXXXXXXXXXXXXXXXXXDDLNSNPEEFDLSANELEDSDIPGSDF 480
                      QEIA                  DDLNSNPEEFDLSANELEDSDIPGSDF
Sbjct: 421 KENEIVENLLEQEIARNQKIRQREKQKQKKENQDDLNSNPEEFDLSANELEDSDIPGSDF 480

Query: 481 AXXXXXXXXXXXXXXXXXXXXXXXXXAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIE 540
           A                         APKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIE
Sbjct: 481 AESNNNSEKDDEEEENDEEEEDEQEDAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIE 540

Query: 541 AQIVDSKEIITANTIDLGHYGDNIIQQSRXXXXXXXXXXXXXXXRYNAIISEGIXXXXXX 600
           AQIVDSKEIITANTIDLGHYGDNIIQQSR               RYNAIISEGI      
Sbjct: 541 AQIVDSKEIITANTIDLGHYGDNIIQQSRETLNETEESDEEDEERYNAIISEGIRKQKEL 600

Query: 601 XXXXXXXXXXXXTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQN 660
                       TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQN
Sbjct: 601 EKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQN 660

Query: 661 FNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXX 720
           FNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRK                      
Sbjct: 661 FNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAK 720

Query: 721 XXXXXXEKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTV 780
                 EKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTV
Sbjct: 721 RRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTV 780

Query: 781 DIDNDEKLATNVTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADL 840
           DIDNDEKLATNVT     IVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADL
Sbjct: 781 DIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADL 840

Query: 841 YTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSK 900
           YTLKRYSSIKTLQ            NLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSK
Sbjct: 841 YTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSK 900

Query: 901 FKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQ 960
           FKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQ
Sbjct: 901 FKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQ 960

Query: 961 EGSFE 965
           EGSFE
Sbjct: 961 EGSFE 965

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  394 bits (1012), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 337/1013 (33%), Positives = 485/1013 (47%), Gaps = 77/1013 (7%)

Query: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59
           MD +FD L+  K KKRTTY K+    +E+E +  +        E+  L   ILF NS L 
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEF-----NIELPGLGQSILFNNSKLK 55

Query: 60  QIRNRL--NNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIF 117
           QIRNRL  NN D+E+              D+ Q  TQ+   TQII+NLY+GGEDLE +  
Sbjct: 56  QIRNRLEGNNNDSEN--------------DSSQAETQVIADTQIISNLYEGGEDLEEKEE 101

Query: 118 HNSFKKTQIITDNI------------LIETNTNDKSTQY------EKTQVITINERLSDK 159
               ++TQI+ D+              IE+N  D + +Y      E TQ I I++   DK
Sbjct: 102 RRFLQRTQIVEDHTQIIDASVTYSSKTIESNKMDNTQKYINASDSEPTQ-IQISK--VDK 158

Query: 160 PLDVVNNTQTVLVIENTQPLPSEIKTQV----VNEVNSALPVTQPTQTIVATQANEVTYD 215
            L + +N  +   + +T     E++TQ     V++          TQ      A++    
Sbjct: 159 LLKITDNLDSQKKVLDTTLETQELETQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKH 218

Query: 216 TQELMPTVDDVAMRSTGLKITDIEKELEEEQRLAXXXXXXXXXXXXXXXXXXXXXXXXXD 275
           +   + TVDD    ++ LKI +IE++L+EE ++                          D
Sbjct: 219 SSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKND 278

Query: 276 FLNHFXXXXXXXXXXXKNEKGPNVDKSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKAN 335
           FL HF             +      ++  ++ +N      K     GL NYE+ L++  N
Sbjct: 279 FLEHFDSSSSEEDEEGVVKLSSTEPETAAMNLENSLPQFSKESKFIGLSNYENILKKDIN 338

Query: 336 NEQIIEFSESDEDSDTNISPSYASKAVILNIRANXXXXXXXXXXXXXXTTLLMLYNNLKR 395
            +  IEFS+S+++++     S ASKA IL+I+AN                L  L+++LK+
Sbjct: 339 KQNCIEFSDSEDETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKK 398

Query: 396 ASKEQIVSYQKELMXXXXXXXXXXXXXXXXXXXXXXQEIAXXXXXXXXXXXXXXXXXXDD 455
           A+K QI+ ++KE+M                      QEI                     
Sbjct: 399 ATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIERNRKIRIREKQKEELKKRKQ 458

Query: 456 LNSN---PEEFDLSANELEDSDIPGSDF----------AXXXXXXXXXXXXXXXXXXXXX 502
              N    E+F +SANEL DS++P SD           A                     
Sbjct: 459 RIENGDQEEDFAISANELSDSEVPESDNDGEVMSSNEEASDSDDELRTQLDASTGIEKET 518

Query: 503 XXXXAPKSTVD-----EEDEGFAIGKRKHKKTEIVDDSD-----SEIEAQIVDSKEIITA 552
               +  S  D     +E+    I  RK KK  +V +SD      E   Q V++    + 
Sbjct: 519 EQDASRDSEKDSERDIDEENILNIKNRKSKKIHVVSESDSDSDSGENSVQ-VEANHQPSL 577

Query: 553 NTIDLGHYGDNIIQQSRXXXXXXXXXXXXXXXRYNAIISEGIXXXXXXXXXXXXXXXXXX 612
           NTI+LGHYGDN+ Q++                 Y  ++ + I                  
Sbjct: 578 NTINLGHYGDNLSQENNNERNNIDSDESEDEELYKEMVKKEIDRRRDQERKQRQKLRELK 637

Query: 613 TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAK 672
             G++ MFEVEAEESEDEWHGIGGVD + SD YDSEVEKMIDDYS++NFN  EIRE LA 
Sbjct: 638 DKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAA 697

Query: 673 ENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDI 732
           ENK+ DL +VN+IL DIKNGGFR R+                            EKRL+ 
Sbjct: 698 ENKDMDLKMVNRILNDIKNGGFRKRR-NALEIELSDDEDDDLKAYRAKRRQLMKEKRLET 756

Query: 733 EGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNV 792
           + +KK++ N KS AF ES+VDDI+E KNPFD+ + +I      +TP  D + D   +  +
Sbjct: 757 DHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMD----DTPETDAEGDVN-SNEL 811

Query: 793 TXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTL 852
                  ++SE FVQ+SLSFL+S R  +EFE+NN     + + +  D++ LK + SIK+L
Sbjct: 812 LNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSL 871

Query: 853 QXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSN 912
           +             L+    +   + F+ L++TSV+ SFSS +DI+SKFK+G K+VKVS 
Sbjct: 872 ESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSK 931

Query: 913 AYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQEGSFE 965
           +Y+TVGSA+ASITY+G +R+LV PKK      S  +   + SRLFD Q+ SFE
Sbjct: 932 SYRTVGSAKASITYLGKARKLVPPKKKEHKPHSHKSKTASASRLFDEQDNSFE 984

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  305 bits (781), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 237/685 (34%), Positives = 332/685 (48%), Gaps = 73/685 (10%)

Query: 320  INGLGNYEHNLRRKANNEQIIEFSESDEDSDT-----NISP-SYASKAVILNIRANXXXX 373
            ++GL NYE  L+R+ N++Q I+ +   +D D         P S  SKA + +I+A     
Sbjct: 390  LHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKK 449

Query: 374  XXXXX-XXXXXTTLLMLYNNLKRASKEQIVSYQKELMXXXXXXXXXXXXXXXXXXXXXXQ 432
                       TTL  L+N L++AS++QI+ +QKE++                      Q
Sbjct: 450  RPIVKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQ 509

Query: 433  EIAXXXXXXXXXXXXXXXXXXDDLNSNPEEFDLSANELEDSDIPGSDFAXXXXXXXXXXX 492
            EI                      + N  +FD SANEL++S++ G + A           
Sbjct: 510  EINRNKKIRQREKEREKQLADAQDDENDLDFDHSANELDESELSGEESAIDS-------- 561

Query: 493  XXXXXXXXXXXXXXAPKSTVDEEDEGFAIGK-RKHKKTEIVDDSDSEIE-------AQIV 544
                                D + + F++ K ++ KK  IV+DSD+EIE       AQI 
Sbjct: 562  --------------------DNDYDDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQIR 601

Query: 545  DSKE---IITANTIDLGHYGDNI------IQQSRXXXXXXXXXXXXXXXRYNAI------ 589
            + K+       N I+LG YGDN+      I   +               R   I      
Sbjct: 602  EEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRI 661

Query: 590  --ISEGIXXXXXXXXXXXXXXXXXXTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDS 647
              I E                      G++   E EAEESEDEWHGIGG+D + SD YDS
Sbjct: 662  RLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDS 721

Query: 648  EVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXX 707
            EVEKMIDDYS+ NFNP EIR+MLA ENKETD+ +V KILYDIKNGGFR R+         
Sbjct: 722  EVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELS 781

Query: 708  XXXXXXXXXXXXXXXXXXXEKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNT 767
                               +KRL++   + +VKNPKSKAFFES+VDDI+E KNPF     
Sbjct: 782  DEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPF----- 836

Query: 768  SIEQIVEKETPTVDIDNDEKLATNVTXXXX----XIVISEEFVQRSLSFLNSCREQDEFE 823
            ++ +     T T D    E   +N           +++SEEFVQR+LSFLNS ++ D+F 
Sbjct: 837  AVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFA 896

Query: 824  INNQHNGGEKATSTADLYTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFND-L 882
                           DL  LK+ SSIK+ +            + +++   S   L N  +
Sbjct: 897  PARSMRAEANDELIEDLTALKKQSSIKSFK-TTRASVSQEPTDFDKENDDSFDDLLNSRV 955

Query: 883  RKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK--SR 940
              +S++ +FS+ VDIN KF+EG K+VKVS AYK+V S++ASITYMG  R+LVAP+K  + 
Sbjct: 956  GTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVAN 1015

Query: 941  LTTSSKANSRTTPSRLFDNQEGSFE 965
            L++S   N+ +  S+LF  Q+ SFE
Sbjct: 1016 LSSSDIKNTNSRTSKLFSRQDESFE 1040

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 56/115 (48%), Gaps = 27/115 (23%)

Query: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSIL 58
           MD +F  L   K KKRTTY KI  DL  +  ES +        +   L G G LF N  L
Sbjct: 1   MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNN--------DPPALTGEGFLFDNPTL 52

Query: 59  GQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLE 113
            +I+ RL   D E+KD  +               T  F QTQ+I+NLY GGEDL+
Sbjct: 53  NRIKKRL---DGEEKDVVQ--------------YTMNFSQTQLISNLYGGGEDLD 90

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  267 bits (683), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 224/648 (34%), Positives = 309/648 (47%), Gaps = 65/648 (10%)

Query: 356  SYASKAVILNIRANXXXXXXXXXXXXXXTTLLMLYNNLKRASKEQIVSYQKELMXXXXXX 415
            S  SKA +LN++A               T+L +L+ NLK+AS++QI+ +Q+EL+      
Sbjct: 398  SRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFK 457

Query: 416  XXXXXXXXXXXXXXXXQEIAXXXXXXXXXXXXXXXXXXDDLNSNPE-EFDLSANELEDSD 474
                            +EI                     L+ N + +FDLSANELED +
Sbjct: 458  LEDIEKEKEIVENLLEEEIKRNKRIRMREKQKEKS-----LSENEDADFDLSANELEDEE 512

Query: 475  IPGSDFAXXXXXXX-----------------XXXXXXXXXXXXXXXXXXAPKSTVDEEDE 517
              G + +                                          + K+ + +EDE
Sbjct: 513  EDGVNDSDNIANSQISDEEDEDSDSVLDNGNHVADEEGDANREADNSSISSKNEISDEDE 572

Query: 518  G--FAIGKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNII---------- 565
               F + +++     I+ +SD        D  EI   NTIDLG YG N+           
Sbjct: 573  DSIFQLTRKEKHPVRIIQESD--------DENEINKINTIDLGVYGGNLDNPNPLSSQTE 624

Query: 566  --QQSRXXXXXXXXXXXXXXXRYNAIISEGIXXXXXXXXXXXXXXXXXXTSGVSKMFEVE 623
              +                  R+  I++E                      GV+K+FE+E
Sbjct: 625  PNEDDEDEKSTYENKEITEEERHALILAEK-KRIQLIEKKNAARTKEMKKKGVNKLFEME 683

Query: 624  AEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVN 683
            AEESEDEWHGIGG D + SD YDSEVEKMIDDYS+ NFNP EIR+MLA ENKE DL ++ 
Sbjct: 684  AEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMIT 743

Query: 684  KILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKR--LDIEGDKKIVKN 741
            KILYDIKNGGFR R+                             K+  L+I  DKK++KN
Sbjct: 744  KILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRMLEIGDDKKLIKN 803

Query: 742  PKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVT--XXXXXI 799
            PKSKAFFES+V+DI++ KN F D    IE I   E  + ++D  E+   +VT        
Sbjct: 804  PKSKAFFESMVEDIVDEKNAFGD----IESI---EKSSTELDTQEEKEQDVTPGVDKKKN 856

Query: 800  VISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQXXXXXX 859
            VISEEFVQ++LSFL S R+ +EF I       +   +  DL++LK+ S+IK  +      
Sbjct: 857  VISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFRNPSQTN 916

Query: 860  XXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGS 919
                  N+    S   G      +  SV+ SFSS  DIN KFK+G K+V +S  YKTVGS
Sbjct: 917  TIDLINNVENVESSPLGG----FKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGS 972

Query: 920  ARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSR--LFDNQEGSFE 965
            ++ASITY+G SR+L+ PKK++     K  S+  P+R  LF + + SFE
Sbjct: 973  SKASITYLGKSRKLMPPKKNK--NREKIGSKIKPTRSSLFSSHDESFE 1018

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 57/110 (51%), Gaps = 29/110 (26%)

Query: 1   MDSLFDQLNHFKKKR-TTYDKI---PHDLLEEEQESEDILKNKTAKEISQLDGGILFGNS 56
           M+S+F++ +  KK+R TTY KI   P++  E   E+ D++          +  G +FGN+
Sbjct: 1   MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPV------IGNGFIFGNA 54

Query: 57  ILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLY 106
           ++ +IRNRL+         GKE  E           T +  QTQ+I+NLY
Sbjct: 55  LIDKIRNRLD---------GKENKE----------DTPVPTQTQMIDNLY 85

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 71/152 (46%), Gaps = 19/152 (12%)

Query: 98  QTQIINNLYDGGEDLENEIFHNS--FKKTQIITDNI-LIETNTNDKSTQYEKTQVITINE 154
           +TQ+IN +    +  EN   +    F  TQ I D +  +E  + D S    K + ITIN 
Sbjct: 156 ETQVINPVLSESQPSENRSSNEKIPFTFTQKIQDFVETVENYSTDLS--LSKDETITIN- 212

Query: 155 RLSDKPLDVVNNTQTVLVIENTQPLPSEIKTQVVNEVNSALPVTQPTQTIVATQANEVTY 214
            L +   D   + +   + +  Q   +++ TQV+N  N           I AT A+    
Sbjct: 213 -LPNHATDNSTSKRAHRISQELQRTMTDMDTQVINNTN--------LDVIEATMAD--LP 261

Query: 215 DTQELMPTVDDVAMRSTGLKITDIEKELEEEQ 246
           +  E   TV D+   STGLKI +I+KELE E+
Sbjct: 262 NLNEPQSTVADIP--STGLKIHEIQKELERER 291

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  262 bits (670), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 171/383 (44%), Positives = 220/383 (57%), Gaps = 34/383 (8%)

Query: 613  TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAK 672
            + GV+  FE+EAEESEDEWHG+GG D + SD YDSEVEKMIDDYS+  FN  EIREMLA 
Sbjct: 761  SKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAA 820

Query: 673  ENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEK-RLD 731
            ENKE D+ ++NKILYDIKNGGFR ++                             K RL+
Sbjct: 821  ENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLE 880

Query: 732  IEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDE-KLAT 790
            I  D K+VKNPKSKAFFES+V+DI+E KNPF     S + +    T     DND  K   
Sbjct: 881  IGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGD 940

Query: 791  N---------VTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNGGEKATS 836
            N         V      ++ISE+FVQ+SLSFL S    DEFE++      QH  GE    
Sbjct: 941  NTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKS-NNYDEFEMDRELARIQHGNGE--GD 997

Query: 837  TADLYTLKRYSSIKTLQXXXXXXXXXXXXNL----------NEQPSQSSGSLFNDLRKTS 886
              DL+TLK++SSIK+              N           N++      SL    +  S
Sbjct: 998  VVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPS 1057

Query: 887  VLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSK 946
            V+ SF+S  DIN KFKEG K+VK+S +YKTVGS++ASITYMG +R+L+APK+ +   +  
Sbjct: 1058 VIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKR-KTEENHH 1116

Query: 947  AN----SRTTPSRLFDNQEGSFE 965
             N    S+T  S+LF+N + SF+
Sbjct: 1117 PNHIKKSKTQKSKLFENGQDSFD 1139

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 115/249 (46%), Gaps = 49/249 (19%)

Query: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSI 57
           MD   + L+    KK+ TTY K+   +L+E  +++  L          L G G LFGN+ 
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 58  LGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLEN--- 114
           L +++NRL   +   +D           +D E +   +F  TQ+I NLYDGGE+LE+   
Sbjct: 104 LNRVKNRLEGRNELGQD----------GQDKENEDEDVF-STQLIANLYDGGEELESKSN 152

Query: 115 ------EIFHNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ 168
                 ++  +SF +TQ I  +I  + N  +         + +INE    +P     N  
Sbjct: 153 GDKNNQKVNVSSFTQTQRIPVSITQQNNEIN-------VPIHSINE---GEPTQKAKNRG 202

Query: 169 TVLVIENTQPLP------SEIKTQVVNEVNSA-----LPVTQPTQTIVATQANEVTY--- 214
           +V+    TQ +P      ++  TQ +N   +      +P T+P++    TQA+  T    
Sbjct: 203 SVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSE--AQTQADVATANDS 260

Query: 215 DTQELMPTV 223
           DTQ+ +P +
Sbjct: 261 DTQQKVPML 269

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 523 KRKHKKTEIVDDSDSEIEAQI-----VDSKEIITANTIDLGHYGDNI 564
           K+ ++   I+D+SDSE+E +       + + +   N IDLGHYG+NI
Sbjct: 622 KKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNI 668

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  259 bits (662), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 200/349 (57%), Gaps = 28/349 (8%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GV+  FE+EAEES+DEWHGIGG D + SD YDS+VEKMIDDYS+ NFN  EIREMLA EN
Sbjct: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEK-RLDIE 733
            KE D+ ++NKILYDIKNGGFR ++                             K RL+I 
Sbjct: 797  KEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 856

Query: 734  GDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVT 793
               K+VKNPKSKAFFES+V+DI+E KNPF     S + I    T    +DN+     + T
Sbjct: 857  DGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDST 916

Query: 794  X---------XXXXIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNGGEKATSTAD 839
                          I+ISE+FVQ+SLSFL S    +EFE++      QH  G       D
Sbjct: 917  RNNEKGPVDDKSKKIIISEDFVQKSLSFLKS-NNYNEFEMDKELAKMQH--GNDDEPIED 973

Query: 840  LYTLKRYSSIKTLQXXXXXXXXXXXXNL----------NEQPSQSSGSLFNDLRKTSVLN 889
            L+TLK++SSIK+                           ++      SL +  +  S++ 
Sbjct: 974  LFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVK 1033

Query: 890  SFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938
            SF+S  DIN KFKEG K+VK+S +YK VGS++ASITYMG +R+L+APK+
Sbjct: 1034 SFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKR 1082

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 101/227 (44%), Gaps = 36/227 (15%)

Query: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSI 57
           MD   + L+    KK+ TTY K+   + ++   ++  L          L G G LF N+ 
Sbjct: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 58  LGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIF 117
           L +++NRL         +G +A E     DN+ D  +    +Q+I NLY+GGEDLE E  
Sbjct: 61  LNRVKNRL---------EGGKAPEQ--EHDNKDDEDEDVSSSQLIANLYEGGEDLE-ETK 108

Query: 118 HNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQTVLVIENTQ 177
            N         +N     N     TQ ++  V    +++ D P+  VN  +   +I++  
Sbjct: 109 SN---------ENDCTGKNCMPTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKD-- 157

Query: 178 PLPSEIKTQVVNEVNSALPVTQPTQTIVATQ---ANEVTYDTQELMP 221
                     VN++  A  ++  T   VATQ   ++++   +Q+ +P
Sbjct: 158 -------DCFVNKIPQAQKLSTTTIKPVATQRIDSDDIITQSQQALP 197

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 8/47 (17%)

Query: 523 KRKHKKTEIVDDSDSEIEAQIVDSKEIITAN-----TIDLGHYGDNI 564
           K+ H    ++D+SDSE EA     KE + A+      I+LGHYGDNI
Sbjct: 611 KKAHHVKRMIDESDSENEAV---PKEKVDASVPKRIAINLGHYGDNI 654

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  257 bits (656), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 220/700 (31%), Positives = 305/700 (43%), Gaps = 85/700 (12%)

Query: 323  LGNYEHNLRRKA-NNEQIIEFSESDEDSDTNISPSYASKAVILNIRANXXXXXXXXXXXX 381
            L  YE+ L+     N  I  +S+S+E++ ++I  S ASKA IL+IR              
Sbjct: 580  LSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHKLSKKKPQVKKKT 639

Query: 382  XXTTLLMLYNNLKRASKEQIVSYQKELMXXXXXXXXXXXXXXXXXXXXXXQEIAXXXX-X 440
              T L  L+N LK+ASK+QI  +QK  +                      QEI       
Sbjct: 640  IQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQEIERNRKIR 699

Query: 441  XXXXXXXXXXXXXDDLN----SNPEEFDLSANELEDSDIPGSDFAXXXXXXXXXXXXXXX 496
                         DD +    S+ ++FD SANELEDS    SD                 
Sbjct: 700  AKERKRENKKNKVDDKSVQSASDEDDFDHSANELEDSFYNDSD----------------- 742

Query: 497  XXXXXXXXXXAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTID 556
                        +   ++ ++   I + K     + ++SDSE +  +   K  I  N I+
Sbjct: 743  ------ENKEIIEPEEEDSEDDINIFRHKKGLKLVTEESDSENDNPLESEKIPINPNIIN 796

Query: 557  LGHYGDNI-----------------IQQSRXXXXXXXXXXXXXXXRYNAIISEGIXXXXX 599
            LGHYGDN+                 I+Q                  Y   I + +     
Sbjct: 797  LGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTENSNNELNELEYKRHIKQELEKQKL 856

Query: 600  XXXXXXXXXXXXXTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQ 659
                           G SKMF++EAEESEDEW GIGG D + SD YDSEVEK+IDDYSRQ
Sbjct: 857  KEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQ 916

Query: 660  NFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXX 719
            +FNP EIR  L  ENKE D+ +VN+ILYDIKNGGFR R                      
Sbjct: 917  DFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRI 976

Query: 720  XXXXXXXEKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPF----------------- 762
                   +KRL++    KI+K  KSKAFF S+VDDI+ET NPF                 
Sbjct: 977  KRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDS 1036

Query: 763  -DDMNTSIEQIVEKETPTVDIDNDEKLATNVTXXXXXIVISEEFVQRSLSFLNSCREQDE 821
              + N       +K+      D+  +L+ +        V+SE+FV ++LSFL   +E +E
Sbjct: 1037 ISNKNHKDANNAKKDKKDKRTDDHARLSQS---SRKKFVMSEDFVHKTLSFLTKSKEVNE 1093

Query: 822  FEINNQHNGGEKATSTADLYTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPS-----QSSG 876
            F+  N+H   +  T   D+ +LK+ SSIKT+                           +G
Sbjct: 1094 FQHVNEHYKSQIGT-INDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAG 1152

Query: 877  SLFNDL--------RKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMG 928
            S  N          +  S++  F S  DIN KFK+G K+V +SN+YKTVG  + SIT  G
Sbjct: 1153 SFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFG 1212

Query: 929  TSRRLVAPKKSRLT---TSSKANSRTTPSRLFDNQEGSFE 965
              R+LVAP K+              ++ S+LF NQ+ SF+
Sbjct: 1213 -RRKLVAPVKTHNNFNKNRISNIKSSSNSKLFRNQDKSFK 1251

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 1  MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59
          MD++FD L+  K KKRTTY K+P  +  E  ++   + N        L  G LF N  L 
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPS--FNLSEGFLFANDKLE 60

Query: 60 QIRNRLN 66
          +I+NRLN
Sbjct: 61 KIKNRLN 67

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  253 bits (645), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 167/383 (43%), Positives = 222/383 (57%), Gaps = 34/383 (8%)

Query: 613  TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAK 672
            + G++  FE+EAEESEDEWHG+GG D + S+ YDSEVEKMIDDYS+ +FN  EIREMLA 
Sbjct: 773  SKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAA 832

Query: 673  ENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEK-RLD 731
            ENKE D+ ++N+ILYDIKNGGFR ++                             K RL+
Sbjct: 833  ENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLE 892

Query: 732  IEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATN 791
            I  D K+VKNPKSKAFFES+V+DI+E KNPF     S + +    T     DND     +
Sbjct: 893  IGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGD 952

Query: 792  VTX---------XXXXIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNGGEKATST 837
             T               +ISE+FVQ+SLSFL S    DEFE++      QH+ G++    
Sbjct: 953  STRNNEHRRVDDRSKKTIISEDFVQKSLSFLRS-NNYDEFEMDKERARIQHDIGDEGVE- 1010

Query: 838  ADLYTLKRYSSIKTLQXXXXXXXXXXXXNLN---EQPSQSSG-------SLFNDLRKTSV 887
             DL+TLK++SSIK+              N     EQP++ +        SL    +  S+
Sbjct: 1011 -DLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSI 1069

Query: 888  LNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKS-----RLT 942
            + SF+S  DIN KFKEG K+VK+S  YKTVGS++ASITYMG +R+L+APKK         
Sbjct: 1070 IKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHN 1129

Query: 943  TSSKANSRTTPSRLFDNQEGSFE 965
              SKA  +T  S+LF++ + SF+
Sbjct: 1130 HHSKA-WKTQKSKLFESGQDSFD 1151

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 38/232 (16%)

Query: 1   MDSLFDQLNHF--KKKRTTYDKIPHDL-LEEEQESEDILKNKTAKEISQLDGGILFGNSI 57
           MD++ + L+    KK+ TTY KI   +   ++    D+L N      +    G LFGN+ 
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 58  LGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIF 117
           L +++NRL  ID  + D+          KDNE +       TQ+I NLYDGGEDLE    
Sbjct: 116 LNRVKNRLEGIDVPEDDR--------QIKDNENEDA---VSTQLIANLYDGGEDLE---- 160

Query: 118 HNSFKKTQIITDNILIETNTNDKSTQYEKTQVITI---NERLSDKPLDVVNNTQTVLVIE 174
                +T+ + DN  ++    D    + +TQ I +   +E + D P+  +N  ++  +I 
Sbjct: 161 -----ETKSMGDNASLK----DGIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIR 211

Query: 175 NTQPLPSEIKTQ-VVNEVNSALPVTQPTQTI----VATQANEVTYDTQELMP 221
           +     +  +TQ ++      +PV   TQ I     A+Q  +V + T+ + P
Sbjct: 212 DDGFFSTAAQTQKIIPATARIIPVA--TQRIHSRDTASQTQQVPF-TKPIEP 260

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 523 KRKHKKTEIVDDSDSEIEAQ--IVDSKEIITA---NTIDLGHYGDNI 564
           K+ +    ++++SDSEIE +  +  SK+       N IDLGHYGDNI
Sbjct: 649 KKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNI 695

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  249 bits (635), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 164/374 (43%), Positives = 216/374 (57%), Gaps = 34/374 (9%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GVSKMFE+EAEESEDEWHG+GG D + SD YDSE+EKM+DDY++  F+P+EIR+MLA E+
Sbjct: 814  GVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAED 873

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEG 734
            KE D  +VNKIL+DIKNGGFR R                             +K L+   
Sbjct: 874  KEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENGE 933

Query: 735  DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVD----IDNDEKLAT 790
              K+V NPKS AFFES+V+D++E+KNPF     SI +  + ++  +     +DN  +  T
Sbjct: 934  ASKLVSNPKSHAFFESMVEDLVESKNPF-----SIGETADPDSGAISENDKVDNASEHGT 988

Query: 791  N-------VTXXXXXIVISEEFVQRSLSFLNSCREQD-EFEIN-----NQHNG-GEKATS 836
                    V      I IS+EFVQRSLSFLNS  E D EFE++     +QH+  G+    
Sbjct: 989  QPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDD 1048

Query: 837  TADLYTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVD 896
              DL+TLK+ S IKTL              ++        S  N  +  SV++SFSS +D
Sbjct: 1049 LEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD------GNSPANGFKLPSVISSFSSRID 1102

Query: 897  INSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK---SRLTTSSKANSRTTP 953
            IN KFKEGTK+VKVS +YKT+G +RASITY+G  R+L APK+    R       +    P
Sbjct: 1103 INEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAP 1162

Query: 954  SR--LFDNQEGSFE 965
             R  LF + + SFE
Sbjct: 1163 KRAGLFADNDDSFE 1176

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 26/118 (22%)

Query: 1   MDSLFDQLNHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGG-ILFGNS-IL 58
           +D+L D L H KKK+TTY K       +E+  E+       K+  QL     LFGNS I+
Sbjct: 4   LDALGD-LKHPKKKKTTYVKDIEVYATQEENDEE-------KKQPQLSSASFLFGNSTIV 55

Query: 59  GQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEI 116
            ++++RLN + NE+ D                +     PQTQ+I N YD GEDLE + 
Sbjct: 56  DKVKSRLNGVSNEETDG---------------ERGDALPQTQVIPNYYD-GEDLEQDF 97

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 323 LGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASKAVILNIRANXXXXXXXXXXXXX 382
           L +Y++ L+ + ++++ I+   S ++ + ++  S  SKA +L I+A              
Sbjct: 412 LNSYKNQLKARLDSKEHIDLDSSSDEDENSVPASKMSKAAVLEIKARTSKRQGIKKTRQQ 471

Query: 383 XTT-----LLMLYNNLKRASKEQIVSYQKEL 408
            +T     L  L+++LK+A+K+QI+ +++E+
Sbjct: 472 PSTPRAPSLKELFSSLKKANKKQILDHRREI 502

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  246 bits (628), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 200/349 (57%), Gaps = 29/349 (8%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GV+  FE+EAEESEDEWHGIGG D + SD YDS++EKMIDDYS+ NFNP EIREMLA EN
Sbjct: 714  GVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAEN 773

Query: 675  KETDLALVNKILYDIKNGGFRTR--KXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDI 732
            KE D+ ++NKILYDIKNGGFR +  K                            ++RL+I
Sbjct: 774  KEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEI 833

Query: 733  EGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATN- 791
              D K+VKNPKS AFFES+V+DIIE KNPF         I    T     DN   +  N 
Sbjct: 834  GDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNT 893

Query: 792  -------VTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNGGEKATSTAD 839
                   V      ++ISE+FVQ+SLSFL S   +D FE +      QH   E   +  D
Sbjct: 894  GNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYED-FETDKELSRIQHGNDE---AIED 949

Query: 840  LYTLKRYSSIKTLQXXXXXXXXXXXXN----LNEQP------SQSSGSLFNDLRKTSVLN 889
            LYTLK+ SSIK+              N    L ++P           SL    +  S++ 
Sbjct: 950  LYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIK 1009

Query: 890  SFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938
            SF+S  DIN KFKEG K+VK+  +YKTVGS++ASITYMG +R+L+APK+
Sbjct: 1010 SFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKR 1058

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 102/223 (45%), Gaps = 32/223 (14%)

Query: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSIL 58
           MD     L+    KK+ TTY K+   +L+E   +     N           G LF N+ L
Sbjct: 1   MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELTGNGFLFANATL 60

Query: 59  GQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFH 118
            +++NRL         +GK+A E   + +N +D ++    TQ+I+NLYDGGE+LE     
Sbjct: 61  NRVKNRL---------EGKKAPEQ--NHNNGKDRSENSLPTQLISNLYDGGEELE----- 104

Query: 119 NSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQTVLVIENTQP 178
               K++ + DN   E N +   TQ ++  V    +++ + P+  VN+ +   +I+    
Sbjct: 105 ----KSE-VKDNSYSEKNVSSSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIK---- 155

Query: 179 LPSEIKTQVVNEVNSALPVTQPTQTIVATQANEVTYDTQELMP 221
                +  +VNE + AL     T    ATQ  + +  T +  P
Sbjct: 156 -----EDGLVNETSQALKTPLTTGRPGATQRIDSSGATSQTQP 193

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 109/286 (38%), Gaps = 57/286 (19%)

Query: 313 TLLKVKSINGLGNYEHNLRRKANNEQII---------EFSESDEDS-----DTNISP-SY 357
           T +  K +  L +Y +NL+R+ ++ + I         E+ + D DS     D ++ P S 
Sbjct: 376 TRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQ 435

Query: 358 ASKAVILNIRA-----NXXXXXXXXXXXXXXTTLLMLYNNLKRASKEQIVSYQKELMXXX 412
            SKA ILN++A     N                  +L N L++AS++QI+ +QKE++   
Sbjct: 436 LSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETK 495

Query: 413 XXXXXXXXXXXXXXXXXXXQEIAXXXXXXXXXXXXXXXXXXD-DLNSNPEE--------- 462
                              QEI                   D  LN++            
Sbjct: 496 GLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQLNAHDSGSDSGSESSG 555

Query: 463 FDLSANELEDSDIPGSDFAXXXXXXXXXXXXXXXXXXXXXXXXXAPKSTVDEEDEGFAIG 522
           F LS NE+ D +  GS+                               +  E+DE     
Sbjct: 556 FALSGNEIADYESSGSE-----------------------NDNRRESDSEKEDDEIILKQ 592

Query: 523 KRKHKKTEIVD--DSDSEIEAQIVDSKE--IITANTIDLGHYGDNI 564
           K+ H    I++  DSD+E+EA+  +  +  +     I+LGHYGDNI
Sbjct: 593 KKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNI 638

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  245 bits (625), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 203/343 (59%), Gaps = 24/343 (6%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GV+K FE+EAEESEDEWHGIGG+D + SD YDS+VEKMIDDYS+ NF+P+EIREMLA EN
Sbjct: 724  GVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEG 734
            KE DL ++NKILYDIKNGGFR RK                             KR    G
Sbjct: 784  KEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELG 843

Query: 735  D--KKIVKNPKSKAFFESIVDDIIETKNPFDD----------MNTSIEQIVEKETPTVDI 782
            D  KK+VKNPKSKAFFES+V+DI + KN F+D          +N + + + E++   V  
Sbjct: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKE 903

Query: 783  DNDEKLATNVTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYT 842
            + D K              SEEFVQR+LSFL S RE +EF +N      +  T   +L +
Sbjct: 904  NGDSKRIKKKKTII-----SEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLS 958

Query: 843  LKRYSSIKTLQXXXXXXXX----XXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDIN 898
            LK+ SSIK  Q                N ++    S  +LF   +  S+L SF S  DIN
Sbjct: 959  LKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALF---KVPSILKSFGSKTDIN 1015

Query: 899  SKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRL 941
             KF++G K+V +S +Y+TVGS++ASITY+G SR+L+AP  S++
Sbjct: 1016 EKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKM 1058

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 27/173 (15%)

Query: 1   MDSLFDQLNHFKK-KRTTYDKIPHDLLEEEQESEDILKNKTAK---EISQLDGGILFGNS 56
           MDSL D L    K ++TTY+K   D   EEQE + IL + T+      + L  G LF NS
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 57  ILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEI 116
            + ++R RL+  +  +++K   AS       +EQ       +TQII NLY  GEDLE ++
Sbjct: 61  TIDKVRARLSGKNYIEQEKTPLAS-------SEQ-------ETQIITNLYTNGEDLEKDL 106

Query: 117 F-HNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ 168
             H    +TQ I       TNT ++ TQ E+   +TI+   ++ P  V+ +T+
Sbjct: 107 IKHIPVSQTQPI-------TNTGER-TQLEQEIKVTIDNDSNEMPTQVIGSTE 151

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 70/174 (40%), Gaps = 12/174 (6%)

Query: 320 INGLGNYEHNLRRKANNEQIIEFSESDEDSD---TNISPSYASKAVILNIRANXXXXXXX 376
           +N L  YE+ L+   N++  ++    DE SD    ++  S  SKA IL I+A        
Sbjct: 408 LNTLSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKSK 467

Query: 377 XXXXXXXTT---LLMLYNNLKRASKEQIVSYQKELMXXXXXXXXXXXXXXXXXXXXXXQE 433
                  T    L  L+ NLK++S++QI+  Q+EL+                      QE
Sbjct: 468 KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQE 527

Query: 434 IAX----XXXXXXXXXXXXXXXXXDDLNSNPEEFDLSANELE--DSDIPGSDFA 481
           I                       D +N +  EFDLSANE E  +SD   SD +
Sbjct: 528 IKRNQKIRQREKEREDKKNNANDSDSVNDSDVEFDLSANEQEEQESDAELSDVS 581

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  229 bits (583), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 166/449 (36%), Positives = 227/449 (50%), Gaps = 28/449 (6%)

Query: 512  VDEEDE----GFAIGK-RKHKKTEIVDDSDSEIEAQIVDSKEIITA------------NT 554
            VD EDE     F + K +K K  +I  +SDSE E    + K +               N 
Sbjct: 688  VDSEDEEEFAAFQVLKGKKRKNMQIQPESDSEEETVNSNDKRVNAPSESKPIHPVNNINA 747

Query: 555  IDLGHYGDNI-IQQSRXXXXXXXXXXXXXXXRYNAIISEGIXXXXXXXXXXXXXXXXXXT 613
            IDLG YG+N+ I+                   +   + +                     
Sbjct: 748  IDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEHARAVDKERLKTIMKEKKLMLKRAELKE 807

Query: 614  SGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKE 673
             GVS  FE EAEESEDEWHGIGG+D + SD YDSEVEKMIDDYSR + +P EIR++L  E
Sbjct: 808  KGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSE 867

Query: 674  NKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIE 733
            NKE D+ +VNKIL+DIKNG FR R                             ++ LD+ 
Sbjct: 868  NKEMDVKMVNKILFDIKNGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLG 927

Query: 734  GDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTV-----DIDNDEKL 788
             DKK+VKN K+KAFF+S+V+DI+E KNPF  M+ +  Q  ++ T         + N E+ 
Sbjct: 928  DDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEK 987

Query: 789  ATNVTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYTLKRYSS 848
             T         V+SEEFVQRSLSFLNS R   EFE N      +     +DLYTLK+ SS
Sbjct: 988  PTQ--EKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLKKQSS 1045

Query: 849  IKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSV 908
            +K+ +            N++   +  +       R  S++ SF+S ++++ KF+ G K+V
Sbjct: 1046 VKSFK---SVGSKNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTV 1102

Query: 909  KVSNAYKTVGSARASITYMGTSRRLVAPK 937
            K   +YK VG ++ S+TYM   R+L APK
Sbjct: 1103 KTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 61/117 (52%), Gaps = 21/117 (17%)

Query: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59
           MD L ++ N  K K+RTTY K+  +  +E    +D +    A        G LFGN+ + 
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKVQQNSTDEAAGDDDCVPTSLAG------NGFLFGNATVD 54

Query: 60  QIRNRLNNID--NEDKDKGKEASESITSKDNEQDSTQI-FPQTQIINNLYDGGEDLE 113
           +I+NRLNN D  N   D  K +SE            QI   Q+Q+++ LYDGGEDLE
Sbjct: 55  KIKNRLNNEDHPNSSIDVTKSSSED-----------QIPVSQSQLLSTLYDGGEDLE 100

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 89/212 (41%), Gaps = 22/212 (10%)

Query: 215 DTQELMPTV-DDVAMRSTGLKITDIEKELEEEQRLAXXXXXXXXXXXXXXXXXXXXXXXX 273
           +TQE  PTV DDV      LKI +I+ +++EE R                          
Sbjct: 397 ETQEFQPTVADDVKSGGNTLKIHEIQTQIDEETR-NMLNRGVEHRKSRGVPSRVEVRFTK 455

Query: 274 XDFLNHFXXXXXXXXXXXK----NEKGP------NVDKSEVLHPDNKSKTLLKVKSINGL 323
             F+  F                N+  P      N D ++   P    KT    K + GL
Sbjct: 456 ESFMADFEESDSASDMESDSDQINDTTPETGSSQNSDSNKARKPTEAPKT----KRVTGL 511

Query: 324 GNYEHNLRRKANNEQIIEFS-----ESDEDSDTNISPSYASKAVILNIRANXXXXXXXXX 378
            +YE  LR K N+++ ++        S+E+ D     S ASKA +LNI+A          
Sbjct: 512 SSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASKAAVLNIKAKALKKKAIVK 571

Query: 379 XX-XXXTTLLMLYNNLKRASKEQIVSYQKELM 409
                 TTL  L+++LK+ +++QI+S+Q E++
Sbjct: 572 AANTNKTTLDSLFSDLKKKNRQQILSHQAEII 603

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  222 bits (565), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 167/431 (38%), Positives = 229/431 (53%), Gaps = 42/431 (9%)

Query: 550 ITANT-IDLGHYGDNIIQQSRXXXXXXXXXXXX------XXXRYNAIISEGIXXXXXXXX 602
           +T N+ I+LG YGDN+I  ++                     +Y  +  E          
Sbjct: 537 LTVNSAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKE---KSKIRAQ 593

Query: 603 XXXXXXXXXXTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFN 662
                      SGV+ MF++EAEES+DEW G+GGVD +  D YDS++EKMIDD+S    N
Sbjct: 594 EEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSN 653

Query: 663 PSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXX 722
             +IR++L  ENKETDL  VNKIL+DIKNGGFR R+                        
Sbjct: 654 ADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKL 713

Query: 723 XXXXEKRLDIEG-DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVD 781
               ++RL     DKK++KN +SKAFFES+V+DII+ K+PF +   + E+  +K    VD
Sbjct: 714 ELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKD-KKSEGLVD 772

Query: 782 IDNDEKLATNVTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLY 841
             N +K             IS EFVQ+SLSFL+S R+  EFE+      GE+ T   DL 
Sbjct: 773 ASNKQK-----------DTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGERNT---DLN 818

Query: 842 TLKRYSSIKTLQXXXXXXXXXXXXNLNE-----QPSQSSGSLFNDLRKTSVLNSFSSDVD 896
           +LK+ S++KTL             +  E      P +SS S        SV+ SF  D++
Sbjct: 819 SLKQDSTVKTLYAPSNIISESERADHEEFDNSVLPVESSYS--------SVVKSFGFDLN 870

Query: 897 INSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKS--RLTTSSKANSRTTPS 954
            N K KEG K+V VS +Y+TVG  +ASITY+G  R+LVAPKKS   + T+SK ++    S
Sbjct: 871 ANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLSTLGN-S 929

Query: 955 RLFDNQEGSFE 965
           ++F N E SFE
Sbjct: 930 KIFRNFESSFE 940

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 28/117 (23%)

Query: 1   MDSLFDQL-NHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59
           MD LF+   N  KK+R TY K   +  E+++ +ED L          L  G LF +S L 
Sbjct: 1   MDKLFESFDNAIKKRRATYQKAVQN--EDDEYTEDPLVPPAV-----LGNGFLFNSSTLD 53

Query: 60  QIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEI 116
           +++NRLN                   KD EQ  TQ    TQ+++NLY+ GEDLE E+
Sbjct: 54  KVKNRLN-------------------KDQEQ-GTQAIDTTQVLSNLYEDGEDLEKEV 90

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 314 LLKVKSINGLGNYEHNLRRKAN-NEQIIEFSESDEDSDTNISPSYASKAVILNIRANXXX 372
           +LK KS   L  Y+  L+ KA   + ++  SESD++ D  +S S+ +KA +L ++A    
Sbjct: 310 VLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSK 369

Query: 373 XXXXXXXXXXXTTLLMLYNNLKRASKEQIVSYQKE 407
                       +L  L  NL+ ++K QI+  QKE
Sbjct: 370 RRPPVESQHGKASLSALMKNLRNSTKRQILDRQKE 404

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  216 bits (551), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 156/451 (34%), Positives = 227/451 (50%), Gaps = 31/451 (6%)

Query: 522 GKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNII-----QQSRXXXXXXX 576
           G+ K+ K    +DSDSE +       + +  N IDLG YG+N+                 
Sbjct: 533 GRTKNHKMLPAEDSDSEHD-------DTLPRNIIDLGPYGNNLQVNHEEDMENLPLSDSA 585

Query: 577 XXXXXXXXRYNAIISEGIXXXXXXXXXXXXXXXXXXTSGVSKMFEVEAEESEDEWHGIGG 636
                   + N +I E I                    G++KM E+EAEESEDEW G+GG
Sbjct: 586 EIDAAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGG 645

Query: 637 VDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRT 696
           VD D SD +DS++E+MIDD+++ N N  ++R++LAKENKE D  +VNKILYDIKNGGFR 
Sbjct: 646 VDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRK 705

Query: 697 RKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEGDKKIVKNPKSKAFFESIVDDII 756
           R                             + R++ +  +K  +N KSKAF ES+VDDI 
Sbjct: 706 RGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDID 765

Query: 757 ETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVTXXXXXIVISEEFVQRSLSFLNSC 816
           E+KNPF D    +E          D+D  E    +         +S+EFVQRSLSFL++ 
Sbjct: 766 ESKNPFGDPEMDVED-------NTDVDTQE---NDYPKNKEKNTLSQEFVQRSLSFLSNN 815

Query: 817 REQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPSQSSG 876
               EFE+  Q   G++     D+ +LKR SSI  L             +L ++      
Sbjct: 816 NSSREFELGEQITLGDEE---QDVSSLKRNSSIHALH----NSSSPIKEDLEKENQDEDF 868

Query: 877 SLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAP 936
               + +  S++ S +   D N+KF+ G K+V VS +Y+ VG +R+SITY G  R+LV P
Sbjct: 869 ITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGP 928

Query: 937 K--KSRLTTSSKANSRTTPSRLFDNQEGSFE 965
           K   S L+   +  S+ T  +L+++Q+ SF+
Sbjct: 929 KNRNSTLSKGPRPASKPTMGKLWESQQNSFD 959

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 192/448 (42%), Gaps = 72/448 (16%)

Query: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59
           MDSL ++L+    K+RTTY K+      +E+E    + N     I  L  G LF NS + 
Sbjct: 1   MDSLLEKLDPLSSKRRTTYKKV---FEPQEEEETQQISNSPPPPI--LGNGFLFQNSTID 55

Query: 60  QIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHN 119
           ++RNRL N +    D   +  +    +  EQ+      QTQ+I +LY+G E+LE +    
Sbjct: 56  KVRNRLRNAE----DGANKVQQKEQEQ--EQEQETQLNQTQVIADLYEGAEELEEQ---- 105

Query: 120 SFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ--TVLVIENTQ 177
                    + + +  +    S   EKTQVI     +      V NN +  T +  E TQ
Sbjct: 106 -------NKERVRLPLSKKTSSASQEKTQVIPWAPTVE----GVENNVEQGTDIHEEKTQ 154

Query: 178 PLPSEI----KTQVVN--EVNSALPVTQ----PTQTI-VATQA--NEVTYDTQELMPTV- 223
            +P+EI    KTQ +   +     P+TQ    P +T+ V T A  +E   DTQE  P   
Sbjct: 155 QVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLDTQEQNPITQ 214

Query: 224 ----DDVAMRSTG----------LKITDIEKELEEEQRLAXXXXXXXXXXXXXXXXXXXX 269
               + +  ++T           LK+ DIEKEL EE+R                      
Sbjct: 215 LDISNSLLFQATDSDIPKSPPQRLKMHDIEKEL-EEKRQERDHRRNIEYRAPEKPVNVKR 273

Query: 270 XXXXXDFLNHFXXXXXXXXXXXK------NEKGPNVDKSEVLHPDNKSKTLLKVKSINGL 323
                 FL +F           +       +K    DKS  L    +S    +V S+   
Sbjct: 274 VFSKEAFLKNFDEESSSEDELIELRSRDIEKKHTEKDKS-TLENTTESSQRQRVFSV--- 329

Query: 324 GNYEHNLRRKANNEQIIEFSESDEDSDTNISP--SYASKAVILNIRANXXXXXXXXXXXX 381
             YE+ L+ + ++++ I+  + +++SD ++    S  SKA +L+I+A             
Sbjct: 330 --YEYKLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATVLDIKARRSKQEPLSKIKQ 387

Query: 382 XXTTLLMLYNNLKRASKEQIVSYQKELM 409
             TTL  L   LK+ASK+QI  +Q ELM
Sbjct: 388 KKTTLNDLICTLKKASKKQITDHQNELM 415

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  210 bits (534), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 147/354 (41%), Positives = 199/354 (56%), Gaps = 22/354 (6%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GV++ FE EAEES+DEW GIGGVD D    YDSEVEKMIDDYS+   + + +R+ +  EN
Sbjct: 802  GVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDEN 861

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEG 734
            KE DL LVNKILYDIKNGGFR R                             ++ L+ E 
Sbjct: 862  KEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENED 921

Query: 735  DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVTX 794
              K+ KNPKSKAFFES++ D++E KN FDD++   +QI  KE      DN+++     + 
Sbjct: 922  TDKLTKNPKSKAFFESMIVDLVEDKNNFDDLS---DQIELKEENITQEDNEKEYNEAKSN 978

Query: 795  XXXXIVISEEFVQRSLSFLNSCREQDEFE---INNQHNGGEKATSTADLYTLKRYSSIKT 851
                I ISE+FVQ++LSFL++     EF+   I ++  G        D+  LK  SS+  
Sbjct: 979  KRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKG------IGDMNALKSNSSLSF 1032

Query: 852  LQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVS 911
                           +N++  +     F   ++ S++ SFSS   I+ KFK+G KSVKVS
Sbjct: 1033 CSKLSTSRKI-----INDE--EDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVS 1085

Query: 912  NAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQEGSFE 965
             +YKTVG ++ASITY+G +R+LV PK     T  K NS  T SRLF+ Q   F+
Sbjct: 1086 TSYKTVGGSKASITYLGKTRKLVPPKNG--PTVRKRNSNNT-SRLFNIQNDPFD 1136

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 68/159 (42%), Gaps = 41/159 (25%)

Query: 1   MDSLFDQLNHFK-KKRTTYDKIP------HDLLEEEQESEDILKN--KTAKEISQL---- 47
           MD LFD+L   K KKRTTY K+        D +  E  S  I+ N   T+ +  +L    
Sbjct: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60

Query: 48  -DGGILFGNSILGQIRNRLNNIDNEDKDKGKEASES---ITSKDNEQDSTQIFPQ----- 98
              G L  +  L  IR+RL       + K  E  E    I  +  EQ   + F       
Sbjct: 61  NKKGFLLTSDKLDTIRSRLA------QSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNI 114

Query: 99  ---------TQIINNLYDGGEDLE-NEIFHNSFKKTQII 127
                    TQIIN  YDGGEDL+  +I  NS   TQ+I
Sbjct: 115 VVNQSDDISTQIINEYYDGGEDLDATDIIKNS---TQVI 150

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 302 SEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNE--QIIEFSESDEDSDTNISPSYAS 359
           S +  P  KS +++       L  Y +NL++K  N+  Q+   S+ + DS      S  S
Sbjct: 484 SPISKPRWKSSSMI-------LPAYVNNLKQKVENKKLQLSSDSDDEVDSAVIYKLSNKS 536

Query: 360 KAVILNIRANXXXXXXXXXXXXXXTTLLMLYNNLKRASKEQIVSYQKELM 409
           KA +LN++                 +  +L+NNL++A+K+QI+ ++KELM
Sbjct: 537 KATLLNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELM 586

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  207 bits (527), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/348 (38%), Positives = 192/348 (55%), Gaps = 30/348 (8%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            GV+KM E+EA+ESEDEWHG+GGVD + SD YDS+++KMIDDY++  F+P EIR++LA E+
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEG 734
             + D  +VNKIL+DIK GGFR R                             +K LD E 
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEH 900

Query: 735  DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIV-EKETPTVDIDNDEKLATNVT 793
            +  +  NPKS  FFES+V          D+    +E+ +   ++P     N  +L  N  
Sbjct: 901  NTSVKSNPKSLPFFESMV----------DEFTIPVERALGTPDSPPAQSTNVLELKQNT- 949

Query: 794  XXXXXIVISEEFVQRSLSFL----NSCREQDEFEINNQHNGGEKATS-TADLYTLKRYSS 848
                 IVISE FV+++LSFL    N    + E  +   +N  +  +S   DLYTLK  S+
Sbjct: 950  --KQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETST 1007

Query: 849  IKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSV 908
            IK L              +NE      G+ F   +  SV+ +F S  D+N KFK+G KSV
Sbjct: 1008 IKVLNTYSGKPI------VNE---DEDGAEFG-FKAPSVMQTFGSRNDVNDKFKDGFKSV 1057

Query: 909  KVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRL 956
            K+SN YKT+GS+RA+IT++G  R+L+ PK+S  +    A+ R+  +RL
Sbjct: 1058 KISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAH-RSIKNRL 1104

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  176 bits (447), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 180/347 (51%), Gaps = 53/347 (15%)

Query: 614 SGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKE 673
           S  S++ + EAEES+DEWHGIGGVD +  D +DS++EKMIDDYS   F+ SE+R+   +E
Sbjct: 649 SKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEE 708

Query: 674 NKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIE 733
               D ++VNKIL+DI+ GGFR R                             +K +  +
Sbjct: 709 EISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQK-VSAQ 767

Query: 734 GDKKIV-KNPKSKAFFESIVDDIIETKNPFDDMN-------TSIEQIVEKETPTVDIDND 785
           G+ K++ +NPKSKAFFE+IV+D I +K   +D         +S+    EK +     D+D
Sbjct: 768 GEAKLLAENPKSKAFFETIVED-IRSKGALEDEGPPPVRGFSSVNAPEEKNS-----DSD 821

Query: 786 EKLATNVTXXXXXIVISEEFVQRSLSFLNSCREQDEFEINNQ------HNGGEKATSTAD 839
           +K            V+SE FVQ++LSFL S    +E    N       H        T D
Sbjct: 822 KK--------GKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEETQD 873

Query: 840 LYTLKRYSSIKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFND--------LRKTSVLNSF 891
           ++ LK+ SSIK+L                  P+++S ++  D         R  S    F
Sbjct: 874 IFALKQNSSIKSLSA----------------PTRNSSNMLIDDQEDLLSRKRACSFFARF 917

Query: 892 SSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938
           +  VD N KF+EG K+V+  N+YK  GS++ASITY+G +R+L APKK
Sbjct: 918 TKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKK 964

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 10/67 (14%)

Query: 50  GILFGNSILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGG 109
           G LFGNS+L ++++RL + +N + D         ++K    +      QTQ++   YD G
Sbjct: 35  GFLFGNSVLRRVKSRLGDDENHEAD---------STKSPIDNGCCDLSQTQVVGLAYD-G 84

Query: 110 EDLENEI 116
           EDLE + 
Sbjct: 85  EDLEQDF 91

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 7/52 (13%)

Query: 513 DEEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNI 564
           +EED     G RKHKK  ++D +D E      D   + + N IDLG YG NI
Sbjct: 524 EEEDAIRKSGLRKHKKFCLID-TDEE------DGSVLNSGNIIDLGAYGSNI 568

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  171 bits (432), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 133/354 (37%), Positives = 188/354 (53%), Gaps = 41/354 (11%)

Query: 615  GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKEN 674
            G++KM E+EAEESEDEWHGIGG D++ S+ YDSEVEKMIDDYS  + N   +R +LAK  
Sbjct: 685  GITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNE 744

Query: 675  KETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIEG 734
            ++ D  +VNKIL+DI  GGFR R                             +K L+   
Sbjct: 745  RQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGD 804

Query: 735  DKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVTX 794
              K+V NPKS AFF+++VDD+ E    F +              T D + DEK  T+ + 
Sbjct: 805  TSKLVSNPKSYAFFQTMVDDVTEAS--FGN--------------TFDANIDEK--TDPSA 846

Query: 795  XXXXIVISEEFVQRSLSFLNSCREQDEF--EINNQHNGGEKATSTADLYTLKRYSSIKTL 852
                IVISE+FV+ +LSFL+S     E   E  +  +   +     DL+TLK+ S+IK L
Sbjct: 847  AGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHL 906

Query: 853  QXXXXXXXXXXXXNLNEQPSQ----SSGS----LFNDLRKTSVLNSFSSDVDINSKFKEG 904
            +               E P+Q    SSG      F+  R  S   SF++  +++ KFK G
Sbjct: 907  KGSL------------ELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSG 954

Query: 905  TKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKAN-SRTTPSRLF 957
            TK+V++  A KT+G ++A+IT++G  RRL+ PK     +  K N S+   S+LF
Sbjct: 955  TKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLF 1008

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  169 bits (429), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 189/363 (52%), Gaps = 61/363 (16%)

Query: 613 TSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAK 672
           ++G++K+ E+EAEESEDEWHG+GG D + SD YDS+++ MIDD+S+  F+ + IRE LA 
Sbjct: 612 STGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLAL 671

Query: 673 ENKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLD- 731
           ENKE D  ++NKIL+DI  GGFR R                             +K L+ 
Sbjct: 672 ENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLEN 731

Query: 732 IEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATN 791
           ++G   +V N KSKAFF+S+V+D                 I  K  P V   ++    T 
Sbjct: 732 VDG---VVNNSKSKAFFDSMVED-----------------ITRKSIPAVTSFSN----TR 767

Query: 792 VTXXXXXIVISEEFVQRSLSFLNSCREQD--EFEINNQHNGGEKATSTADLYTLKRYSSI 849
                  IVISEEFVQ SLSFL S ++ D  EFE+    +      +T DL +LK+ S+I
Sbjct: 768 DEMGKKKIVISEEFVQSSLSFL-SAKDDDINEFEVTEAAHD-----ATEDLESLKQRSNI 821

Query: 850 KTLQXXXXXXXXXXXXNLNEQPSQSSGSLFN--------DLRKTSVLNSFSSDVDINSKF 901
           K+L                + P ++  S F         D +  S++ SFSS+ D+N KF
Sbjct: 822 KSL----------------DSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFSSNSDVNDKF 865

Query: 902 KEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQE 961
           K G K+V +S +Y+    +R++IT++G  R+L AP+  + T       R   S LFD+  
Sbjct: 866 KTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPL----VRKPTSSLFDSNS 921

Query: 962 GSF 964
            SF
Sbjct: 922 DSF 924

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  164 bits (416), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 175/359 (48%), Gaps = 29/359 (8%)

Query: 614 SGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKE 673
           S  + M + EAEES+DEW G+GG D + SD YDSE+++MIDDYS    +P  +R+ L +E
Sbjct: 633 SKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEE 692

Query: 674 NKETDLALVNKILYDIKNGGFRTRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKRLDIE 733
            K  D  +V++IL+DI+NGGFR R                             E++   +
Sbjct: 693 EKLHDKDMVDRILHDIENGGFRKRGRYAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQ 752

Query: 734 GDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVT 793
               +  NPKSKAFF+SI +         DD+   I  + E ++    +    K A +  
Sbjct: 753 EISVLATNPKSKAFFDSIFE---------DDLKGGIANLKEYQSHASPL----KAAKDEI 799

Query: 794 XXXXXIVISEEFVQRSLSFLNSCR-EQDEFEI-----NNQHNGGEKATSTADLYTLKRYS 847
                  ISE+FVQ++LSFL S   EQ + E        + + G+ A +T D Y LK+ S
Sbjct: 800 SGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEAT-DFYRLKQLS 858

Query: 848 SIKTLQXXXXXXXXXXXXNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKS 907
            IK+              N +         + +    T+++  F   VD N KF+EG K+
Sbjct: 859 GIKSFSAPLRSSIRLQVRNKD--------GVLSGKANTTLVERFVRSVDTNEKFEEGRKT 910

Query: 908 VKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQEG-SFE 965
           VK  N+YK  GS+RASIT++G +R L A K+     S+    +   S  F   +G SFE
Sbjct: 911 VKSLNSYKIAGSSRASITFLGKARSLKARKRGPHARSAPHGQKIMTSHQFFASDGQSFE 969

>TPHA0E03010 Chr5 (633187..635904) [2718 bp, 905 aa] {ON} Anc_5.211
           YLL005C
          Length = 905

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 767 TSIEQIVEK--ETPTVDIDNDEKLATNVTXXXXXIVISE--EFVQRSLSFLNSCREQDEF 822
           TS+  I+ K    PT+      KL  +V      ++I+E   F+ R LS++  CR Q+E 
Sbjct: 547 TSLIPIISKLNNQPTII----SKLLNSVIPILSLVIITELVPFIYRYLSYIRYCRTQEEL 602

Query: 823 EINNQ 827
           EIN Q
Sbjct: 603 EINIQ 607

>Smik_4.198 Chr4 complement(360009..362573) [2565 bp, 854 aa] {ON}
           YDL040C (REAL)
          Length = 854

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 17/114 (14%)

Query: 38  NKTAKEISQLDGGILFGNSILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFP 97
           NK AK+   ++G  LFG+ ++  +R   N+   +      +  + + +K  E+D ++I P
Sbjct: 735 NKFAKKFGSMNG--LFGSMVIVLLRATRNDASFD------QILKKVVTKSLEKDYSEILP 786

Query: 98  QTQIINNLYD---------GGEDLENEIFHNSFKKTQIITDNILIETNTNDKST 142
            +++ NN +D         GG D    +F   + +   I  +IL E   N+ S+
Sbjct: 787 LSEVSNNNFDWLKFYQETFGGNDTRGLLFLYRYCEDVAIEQSILKEVIINNISS 840

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON}
           similar to uniprot|P43565 Saccharomyces cerevisiae
           YFL033c RIM15 protein kinase involved in expression of
           meiotic genes
          Length = 1682

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 730 LDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTS 768
           L++E +   +K  +S+AFFE+I+D++I+  N   ++N S
Sbjct: 298 LELEYNSVPIKGTRSRAFFETIIDELIDLCNAAININPS 336

>NDAI0C04870 Chr3 complement(1127470..1131195) [3726 bp, 1241 aa]
           {ON} Anc_8.426 YDR217C
          Length = 1241

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 159 KPLDVVNNTQTVLVIENTQPLPSEIKTQVV 188
           K L+  ++TQTVL  EN QPL  E++TQ++
Sbjct: 417 KALNNFDSTQTVLPTENIQPLHEEVETQLI 446

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,062,331
Number of extensions: 3694472
Number of successful extensions: 17471
Number of sequences better than 10.0: 252
Number of HSP's gapped: 18259
Number of HSP's successfully gapped: 304
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)