Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E040001.6ON31631615670.0
NCAS0B091001.6ON32731614070.0
Kpol_2002.91.6ON33831614070.0
NDAI0A001501.6ON31731313820.0
SAKL0C00484g1.6ON33931713690.0
CAGL0B00352g1.6ON33731313640.0
KLLA0C00506g1.6ON33031013570.0
KNAG0C002301.6ON34931313490.0
Kwal_33.130111.6ON33431713390.0
Ecym_10091.6ON33631413270.0
YCL059C (KRR1)1.6ON31631113000.0
Smik_3.151.6ON31631112990.0
Suva_3.1531.6ON31631112940.0
Skud_3.41.6ON31631412931e-180
TDEL0C069601.6ON35031512931e-180
ZYRO0F18458g1.6ON31431312781e-178
KLTH0F00506g1.6ON33231712691e-177
AFR744W1.6ON34331012671e-176
KAFR0D001501.6ON34430812651e-176
TBLA0A049401.6ON31631612481e-174
ZYRO0D11440g5.482ON2691461004e-04
SAKL0G03740g5.482ON266146986e-04
TDEL0A034605.482ON272146987e-04
Suva_8.1975.482ON274148988e-04
Kpol_543.135.482ON268146970.001
Ecym_45525.482ON271146970.001
Kwal_47.188645.482ON271146970.001
NCAS0A119605.482ON270193960.001
KLTH0G02574g5.482ON271146960.001
Skud_15.3105.482ON276148930.003
KLLA0C06446g5.482ON274146920.004
YOR145C (PNO1)5.482ON274148920.004
TPHA0J028205.482ON268146910.005
KAFR0E036005.482ON276146910.006
Smik_15.3265.482ON274148910.006
AFR390C5.482ON311146910.007
NDAI0A043105.482ON274146890.009
CAGL0K09460g5.482ON261146890.010
KNAG0C046105.482ON277168890.011
TBLA0D018905.482ON271146850.030
KAFR0B030308.309ON46756740.81
Ecym_61714.124ON21776711.4
AGL183C8.309ON50724702.7
Kpol_1036.608.309ON49454702.7
CAGL0J06534g8.821ON167054694.0
KLTH0E14014g8.798ON48699684.4
KNAG0G023508.309ON49724685.0
KLLA0D02398g1.290ON120583677.1
TPHA0C042702.546ON50030668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E04000
         (316 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   608   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   546   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   546   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   536   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   531   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   530   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   527   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   524   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   520   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   515   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   505   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   504   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   503   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   502   e-180
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   502   e-180
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   496   e-178
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   493   e-177
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   492   e-176
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   491   e-176
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   485   e-174
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    43   4e-04
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    42   6e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    42   7e-04
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    42   8e-04
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    42   0.001
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    42   0.001
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    42   0.001
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    42   0.001
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    42   0.001
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    40   0.003
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    40   0.004
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    40   0.004
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    40   0.005
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    40   0.006
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    40   0.006
AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON} ...    40   0.007
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    39   0.009
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    39   0.010
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    39   0.011
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    37   0.030
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    33   0.81 
Ecym_6171 Chr6 (317922..318575) [654 bp, 217 aa] {ON} similar to...    32   1.4  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.7  
Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON} (1695...    32   2.7  
CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} simi...    31   4.0  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   4.4  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.0  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    30   7.1  
TPHA0C04270 Chr3 complement(920351..921853) [1503 bp, 500 aa] {O...    30   8.8  

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/316 (94%), Positives = 298/316 (94%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 NYIAPKEEKYVSSIEK 316
           NYIAPKEEKYVSSIEK
Sbjct: 301 NYIAPKEEKYVSSIEK 316

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/316 (81%), Positives = 286/316 (90%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDT D+DKW +E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+AL+KH++ C L+LV+GSMTV TTRKT+DP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                +YTPFPP+QLPRKVDLEIESGEYFLSK+EKE+K+LHERR+QQAEKQAEK++ER+K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 NYIAPKEEKYVSSIEK 316
           NYIAP+EE Y SS++K
Sbjct: 301 NYIAPEEETYKSSLKK 316

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/316 (82%), Positives = 285/316 (90%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNK+KPWDTEDIDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TKALDK H+ACTL+LV+GSMTV TTRKT+DPY ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVVED M+NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+Q PRKVDLEIESGEYFLSKKEKEVKRL ERR++Q++KQ EK+ ERSK
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 NYIAPKEEKYVSSIEK 316
           +Y+AP EE+Y S+I K
Sbjct: 301 DYVAPMEEEYKSTITK 316

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/313 (80%), Positives = 282/313 (90%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDTE+I+KWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+AL+ H++AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+N+HPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                +YTPFPP+QLPRKVDLEIESGEYFLSK+EKE+K+L+ERR+QQAEKQ EK+ ER+K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 NYIAPKEEKYVSS 313
           +Y+AP E  Y SS
Sbjct: 301 DYVAPSEPTYKSS 313

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/317 (80%), Positives = 284/317 (89%), Gaps = 1/317 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNK+KPWDT +IDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKHH+ACTL+LV+GSM+V TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+QLPRKVDLEIESGEYFLSKKEKEVK+L ERR +QAEKQA+K+ ER+
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KNYIAPKEEKYVSSIEK 316
           K+Y+AP+E +Y S+++K
Sbjct: 301 KDYVAPEEAEYKSTLKK 317

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 277/313 (88%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVST+NK+KPWDTEDIDKWK+E+FKPEDN SG PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKHH+ CTL+LV+GSMTV TTRKT+DP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVV D M+NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDL+IESGEYFLSKKEKE+K+LHE+R++QAEKQ  KD ER K
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 NYIAPKEEKYVSS 313
           +YIAPKE++Y SS
Sbjct: 301 DYIAPKEDEYKSS 313

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 278/310 (89%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNK+KPWDT+++DKW +E+FKPEDN SG+PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T++LD HH+AC LNLV+GSMTV TTRKTYDP +ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                +YTPFPP+QLPRKVDLEIESGEYFLSK+EKEVK+LHERR+QQA K AEK+ ER+K
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 NYIAPKEEKY 310
           ++IAPKE  Y
Sbjct: 300 DFIAPKETDY 309

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 273/313 (87%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNK+KPWDT+DIDKW +E+FKPEDNASG PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TKALD HH+ACTL+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL +D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDLEIESGEYFL+KKEK+ K+L ER++ QAEKQ  KD ER K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 NYIAPKEEKYVSS 313
           +Y APKE+ Y ++
Sbjct: 301 DYTAPKEKAYGTT 313

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/317 (78%), Positives = 277/317 (87%), Gaps = 1/317 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNK+KPWDT DIDKWK+E+FKPEDN SG+PFSEESSFMTLFPKYREVYLKSVWKDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+AL+KH ++C L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP Q PRKVDL+IESGEYFLSKKEKE K+L ER+ +QAEKQ EKD ER+
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KNYIAPKEEKYVSSIEK 316
           K+Y+AP E++Y S+ ++
Sbjct: 301 KDYVAPSEKEYGSTAKR 317

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 277/314 (88%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNK+KPWDT DIDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKHH+AC LNLV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDLEIE+GEYFLSK EK++K+L E R++Q EKQ EK  ER++
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 NYIAPKEEKYVSSI 314
           +YIAP E++Y +++
Sbjct: 300 DYIAPDEKEYKNAL 313

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 277/311 (89%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDT+DIDKWK+E+FK EDNASG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKH++AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED M+N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+QLPRKVDLEIESGEYFLSK+EK++K+L+E++++Q E++ E+  ER+
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KNYIAPKEEKY 310
           K++IAP+EE Y
Sbjct: 301 KDFIAPEEEAY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/311 (78%), Positives = 276/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDT+DIDKWK+E+FK EDNASG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKH++AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+QLPRKVDLEIESGEYFLSK+EK++K+L E++++Q E++ E+  ER+
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KNYIAPKEEKY 310
           K++IAP+EE Y
Sbjct: 301 KDFIAPEEETY 311

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 276/311 (88%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDT+D+DKW +E+FK EDNASG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKH+++C L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+QLPRKVDLEIESGEYFLSK+EK++K+L+E++++Q E++ E+  ER+
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KNYIAPKEEKY 310
           KN++AP+EE Y
Sbjct: 301 KNFVAPQEEAY 311

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  502 bits (1293), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/314 (77%), Positives = 276/314 (87%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN+EKPWDT+DIDKWK+E+FK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKH++AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED M+N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+QLPRKVDLEIESGEYFLSK++K+VK+L+E++++Q E++ E+  ER+
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KNYIAPKEEKYVSS 313
           K++ AP+EE Y  S
Sbjct: 301 KDFTAPEEESYKPS 314

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  502 bits (1293), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 245/315 (77%), Positives = 277/315 (87%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDTEDIDKW++E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+AL+ HH+AC L+L++GSMTV TTRKT+DP IIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED MRNVHPIY IKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+Q PRK+DLEIESGEYFLSKKEKE+ +L ERR++QAEKQ EK+  RSK
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 NYIAPKEEKYVSSIE 315
           +YIAPKE+ Y SS+E
Sbjct: 301 DYIAPKEDVYKSSLE 315

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/313 (75%), Positives = 266/313 (84%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHNK+KPWDT +IDKW  ++FK EDNASG+PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TKAL+K+HVAC L+LV+GSMTV TTRKT DP IILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+N+HPIYHIKELMIKRELAK+PELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+Q PRKVDLEIESGEYFL+K+EKE K+L ERR++QAEKQ E+  ER K
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 NYIAPKEEKYVSS 313
           +++ PKEE Y  S
Sbjct: 301 DFLPPKEEDYKKS 313

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  493 bits (1269), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/317 (77%), Positives = 274/317 (86%), Gaps = 1/317 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           M STHNK+KPWDT DIDKWK+E+FKPEDN SGMPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+ALDKH++AC L+LV+GSMTV TTR+TYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVED MRN+HPIYHIKELMIKRELAK+P+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299
                 VYTPFPP+Q PRK+DL+IESGEYFL+KKEKE K+L ER+ +QAEKQ EK+ ER+
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KNYIAPKEEKYVSSIEK 316
           K+Y+AP E+ Y  S +K
Sbjct: 301 KDYVAPIEKGYEGSSKK 317

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/310 (77%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVST NK+KPWDT D+DKW +E+F PED+ASG+PF+EESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           T+AL+KHH+AC LNLV+GSM+V TTRKTYDP IILKARDLIKLLARSVP PQA+KIL DD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED MRN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDLEIE+GEYFLSKKEKE K+L  RR QQAEKQ+EK+ ER+K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 NYIAPKEEKY 310
           +YIAP E +Y
Sbjct: 300 DYIAPAEPEY 309

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 257/308 (83%), Positives = 278/308 (90%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVST+NKEKPWDTEDIDKW+ E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVWKDV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TKAL+KHH+AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M NVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDLEIESGEYFLSKKEKEVK+L ER+++QA+KQ EK+ ER K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 NYIAPKEE 308
           NYIAPKEE
Sbjct: 301 NYIAPKEE 308

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  485 bits (1248), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 245/316 (77%), Positives = 280/316 (88%)

Query: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60
           MVSTHN++KPWDT DI+KW++++FKPEDNASG+PF+EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120
           TK+LDK+HVACTL+L++GSMTV TTRKTYDP IILKARDLIKLLARSVP+PQA++IL DD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
                VYTPFPP+QLPRKVDLEIESGEYFLSKKEKE+K+L ERR++Q EKQ EK+ ER K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 NYIAPKEEKYVSSIEK 316
           ++IAP E++Y SS++K
Sbjct: 301 DFIAPSEKEYKSSLQK 316

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTV-STTRKTYDPYIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   +NL   S+ + S  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLI 101
           + P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFKGLKEIRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ + T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 82/193 (42%), Gaps = 10/193 (5%)

Query: 4   THNKEKPWDTEDIDKWKLED-----FKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWK 58
           TH+  +P   ++     L++     F   + A G     ES  + + P +R   L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKLLARSVPFPQAVKI 116
            +   L  H  +   +NL   S+ + T  K T DP  + K  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVM 174
           L  DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+  I++    + ++
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPFKGLKEIRRVV 187
           G F  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ + T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLI 101
           + P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSVMGPFKGLKEIRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   LK+ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVTNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLI 101
           + P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFKGLKEIRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLI 101
           + P +R   L++ W  +   L +H  +   +NL   S+ + T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSVMGPFKGLKEIRRVV 187
           T+  I++  + + ++G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>AFR390C Chr6 complement(1138631..1139566) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR145C
           (PNO1)
          Length = 311

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTT-RKTYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  R T DP  + K  D IK 
Sbjct: 139 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPRHTTDPGALQKGADFIKA 198

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T + +   +   R+ G +G +  A+E  T+
Sbjct: 199 FTLGFDLDDSISLLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKSKFAIENATR 258

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 259 TRIVLADSKIHILGGFTHIRMAREAV 284

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++    + ++G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   ++ + T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTV 82
           F   + AS      ES  + + P +R   L++ W  +   L  H  +   +NL   S+ +
Sbjct: 84  FSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVEL 142

Query: 83  STTRK-TYDPYIILKARDLIKLLARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFV 139
            T  K T DP  + K  D IK          ++ +L  DD+  +  ++ +  T + +   
Sbjct: 143 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLS 202

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGLKEIRRVV 187
           +   R+ G +G T  A+E  T+  I++  + + ++G F  ++  R  V
Sbjct: 203 RAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREVYLKSVWKDVTKALDKH-HVACTLNLVDGSMTVSTTRK-TYDPYIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   +NL   S+ + T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILD-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSVMGPFKGLKEIRRVV 187
             I++  + + ++G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGLKEIRRVVEDAMRNVHPIYHI 200
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E AM    P++ +
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLHCL 201

>Ecym_6171 Chr6 (317922..318575) [654 bp, 217 aa] {ON} similar to
           Ashbya gossypii AFL005W
          Length = 217

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 246 VYTPFPPSQLPR-----KVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300
            + P     L R     +V+ E+ SG Y  +KKE  ++ LH+      +K AE  I+R +
Sbjct: 107 CFQPHFQGWLARTKTKVEVNFEVRSGSYLDTKKEGTIQYLHQLVLSLNDKAAE--IKREQ 164

Query: 301 NYIAPKEEKYVSSIEK 316
           + +  +E K+  + E+
Sbjct: 165 DLVRERESKFRDTSER 180

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>Kpol_1036.60 s1036 (169585..171069) [1485 bp, 494 aa] {ON}
           (169585..171069) [1485 nt, 495 aa]
          Length = 494

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGLKEIRRVVEDAMRNVHPIY 198
           L+GP GNTLK L+  ++C I ++G      G  K  K    + + AM    P++
Sbjct: 152 LLGPRGNTLKKLQEDSQCKIAIRG-----RGSVKEGKNANDLPQGAMNFSDPLH 200

>CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} similar
           to uniprot|P52593 Saccharomyces cerevisiae YML103c
           NUP188 nuclear pore protein
          Length = 1670

 Score = 31.2 bits (69), Expect = 4.0,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 32  GMPFSEESSFMT--LFPKYREVYLKSVWKDVTKALDKHHVACTLNLVDGSMTVS 83
           G+P+S E  F+   L   Y E +L S+ KD+T  L  + +A TL +  G++  S
Sbjct: 924 GVPWSSEYPFLYSYLGHTYSEKFLSSIIKDLTTTLQDYQLAKTLYVFFGTLIRS 977

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGLKEIRRVVEDAMRNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKKPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 112  QAVKILDDDMA-CDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQ--- 167
            +A K+++D +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 168  ---GNTVSVMGPFKGLKEIRRVV 187
                N + V+G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

>TPHA0C04270 Chr3 complement(920351..921853) [1503 bp, 500 aa]
          {ON} Anc_2.546 YKL035W
          Length = 500

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 20 KLEDFKPEDNASGMPFSEE-SSFMTLFPKY 48
          KL+D  P DNA+   F  E  SF TLF +Y
Sbjct: 34 KLDDTMPNDNAASARFQNELDSFFTLFRRY 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,509,155
Number of extensions: 1402217
Number of successful extensions: 8147
Number of sequences better than 10.0: 80
Number of HSP's gapped: 8322
Number of HSP's successfully gapped: 81
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)