Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E039901.7ON1161165645e-76
Kpol_2002.101.7ON111951643e-15
SAKL0C00506g1.7ON105891547e-14
TBLA0A049501.7ON113901487e-13
Skud_3.51.7ON1131001452e-12
KAFR0D001601.7ON1111131391e-11
Smik_3.161.7ON1131171364e-11
Suva_3.1541.7ON1131221364e-11
NCAS0B090901.7ON1191241365e-11
TDEL0C069501.7ON1111111331e-10
YCL058W-A (ADF1)1.7ON1131061286e-10
KNAG0C002401.7ON1261281219e-09
ZYRO0F18436g1.7ON112931148e-08
CAGL0B00374g1.7ON121931052e-06
Kwal_YGOB_YCL058W-A1.7ON10582954e-05
Kwal_33.13015singletonOFF10582954e-05
KLTH0F00528g1.7ON104105902e-04
NDAI0A001601.7ON12343840.002
AFR743CA1.7ON101106810.005
KLLA0C00528g1.7ON11676740.053
KLLA0D15983g7.185ON103586710.28
TPHA0K005305.527ON64674642.0
TBLA0A055401.90ON121769633.2
TPHA0G032602.501ON44767623.8
TPHA0C014707.181ON23549614.3
TPHA0A043703.186ON66454624.4
Kpol_2000.271.117ON14969605.1
Kpol_1020.183.64ON61135616.3
ZYRO0B14762gsingletonON151558616.4
AER280C8.817ON51046608.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E03990
         (116 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...   221   5e-76
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    68   3e-15
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    64   7e-14
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    62   7e-13
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    60   2e-12
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    58   1e-11
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    57   4e-11
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    57   4e-11
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    57   5e-11
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    56   1e-10
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    54   6e-10
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    51   9e-09
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    49   8e-08
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    45   2e-06
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    41   4e-05
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    41   4e-05
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    39   2e-04
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    37   0.002
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    36   0.005
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    33   0.053
KLLA0D15983g Chr4 (1343315..1346422) [3108 bp, 1035 aa] {ON} sim...    32   0.28 
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....    29   2.0  
TBLA0A05540 Chr1 complement(1374452..1378105) [3654 bp, 1217 aa]...    29   3.2  
TPHA0G03260 Chr7 (698046..699389) [1344 bp, 447 aa] {ON} Anc_2.5...    28   3.8  
TPHA0C01470 Chr3 (337155..337862) [708 bp, 235 aa] {ON} Anc_7.18...    28   4.3  
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...    28   4.4  
Kpol_2000.27 s2000 (51932..52381) [450 bp, 149 aa] {ON} (51932.....    28   5.1  
Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {O...    28   6.3  
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    28   6.4  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    28   8.7  

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score =  221 bits (564), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MAKGKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALN 60
           MAKGKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALN
Sbjct: 1   MAKGKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALN 60

Query: 61  ALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
           ALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL
Sbjct: 61  ALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 67.8 bits (164), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 4/95 (4%)

Query: 23  RKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNAL-NGKKREKQTSVLEAKTLAK 81
           RKN+   +S   +K  K K+EK+NK  ++ SD +   N   NG+    +   LE++ L +
Sbjct: 20  RKNV---ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQ 76

Query: 82  DNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
           DN+KDR+ I KIE+ KKET+ S+L+QIE+M+GFSL
Sbjct: 77  DNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 63.9 bits (154), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 61/89 (68%), Gaps = 2/89 (2%)

Query: 28  GKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDR 87
           G +    +K T+ +VE+LNK E + SD +N  NA + K +EK    L+AK LA+D  KD+
Sbjct: 19  GGIKKSQKKRTRIQVEQLNKQEFLLSD-LNMTNAGSTKTKEK-PKTLQAKALAQDQKKDK 76

Query: 88  QLIEKIESKKKETNASLLQQIEMMSGFSL 116
           +  +K+E ++K+TN ++L Q+EM+SGFSL
Sbjct: 77  ETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 61.6 bits (148), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 6/90 (6%)

Query: 29  KLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKRE--KQTSVLEAKTLAKDNLKD 86
           K+S   +K  K +VEK+NK + + SD IN    LNGK +E  K  + L +K L KD  KD
Sbjct: 28  KISVGDKKRAKLQVEKMNKQDSLLSDIIN----LNGKSKELAKNVNTLSSKQLKKDQEKD 83

Query: 87  RQLIEKIESKKKETNASLLQQIEMMSGFSL 116
           R L  +I++KKK+TN  L+ QIEM+SGFSL
Sbjct: 84  RLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 60.5 bits (145), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%), Gaps = 4/100 (4%)

Query: 17  GKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEA 76
           GK V+ ++ I    S+  RK TK +VEKLNK   I    +    A     +++  S L+A
Sbjct: 18  GKKVQKKRPI----STAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKA 73

Query: 77  KTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
           + L KD  KD ++ E+I+++K +TN S+L+QIEM+SGFSL
Sbjct: 74  EELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 58.2 bits (139), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 4   GKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALN 63
           GKS   +++  N  K +K RKN+   +S   RK  K  VEK N+  + +  ++N     +
Sbjct: 2   GKSKTARQAGGNRIKKIKSRKNV---ISQSERKKNKLIVEKFNQQTITNVQELNKDLKKD 58

Query: 64  GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
            ++  K  + LE K L  D  +D ++ + IE+K KET  S+L+QIEM+SGFSL
Sbjct: 59  KRRLSKTKNALETKKLLHDQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 71/117 (60%), Gaps = 9/117 (7%)

Query: 4   GKSNNIKKSFRNN---GKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKL-EVISSDDINAL 59
           GK++  +KS   N   GK V+ R++I    S+ V+K TK +VEKLNK  E++    +   
Sbjct: 2   GKNSMRRKSVGKNVGVGKKVQKRRSI----STAVKKRTKLQVEKLNKSSEMMIPTLLRET 57

Query: 60  NALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
            A    KR K  S L+A  L KD  KD ++ E I+ +K +TN ++L+QIEM+SGFSL
Sbjct: 58  GAQEPAKR-KTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 70/122 (57%), Gaps = 19/122 (15%)

Query: 4   GKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNK---------LEVISSD 54
           GKS+  KK+   NG  V  ++  K  +S+   K TK +VE+LNK         L+  S  
Sbjct: 2   GKSSMRKKTQGKNG-GVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60

Query: 55  DINALNALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGF 114
           D++         ++K  S LEA+ L KD  +D ++ E IE++K +TN S+L+QIEM+SGF
Sbjct: 61  DLD---------KKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGF 111

Query: 115 SL 116
           SL
Sbjct: 112 SL 113

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 57.0 bits (136), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 13/124 (10%)

Query: 1   MAKGKSNNIKKSFRNNGKNVKDR-KNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINAL 59
           MA+  S   K +  N  K  K++ K  K  +S   RK  KH+VEKLNK E     ++  +
Sbjct: 1   MARSHSTKTKAATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKKE-----NLLPM 55

Query: 60  NALN-------GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMS 112
           N L+        KK E   S+L A++L +D  KD+++  KI +++K T+ S+ +QIEM+S
Sbjct: 56  NVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSIEKQIEMIS 115

Query: 113 GFSL 116
           GF+ 
Sbjct: 116 GFTF 119

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 5/111 (4%)

Query: 9   IKKSFRNNGKNV-KDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDI--NALNALNGK 65
           +K +F+  GK V K++KN K  +S +  K TK +VE LN+     S+ I  NA  A+ G 
Sbjct: 3   VKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGS 62

Query: 66  KREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
            R+  T  LE +TL KD  KD+++ EK +++K+E   +L +QIE +SGFSL
Sbjct: 63  ARKANT--LENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 53.9 bits (128), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 64/106 (60%), Gaps = 10/106 (9%)

Query: 17  GKNVKDRKNIKGK--LSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKRE----KQ 70
           GKNV   K ++ K  +S+  RK TK +VEKLNK    SS+ +          +E    K 
Sbjct: 12  GKNVGVGKKVQKKRSISTAERKRTKLQVEKLNK----SSETMIPTLLREASTQEPAKLKA 67

Query: 71  TSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
            + L+A+ L KD  KD ++ E+I ++K +TN S+L+QIEM+SGFSL
Sbjct: 68  ETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 51.2 bits (121), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 14/128 (10%)

Query: 1   MAKGKSNNIKKSFRNNGKNVKDRKNIKGK---LSSQVRKSTKHKVEKLNKLE--VISSDD 55
           MA  K+   +KS RN+ K V+  K  +G    +    RK  K +VEKLN+    +I  + 
Sbjct: 1   MAGSKTVLGRKSKRNDTKRVQKHKK-RGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNA 59

Query: 56  INALNALN-------GKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQI 108
           ++  N ++       G+ R    S L+ + LA+D  KDR + E++  K+KET+ S+L QI
Sbjct: 60  VDIRNEIDKHNQEVEGQNRTVHRS-LDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQI 118

Query: 109 EMMSGFSL 116
           EM+SGFSL
Sbjct: 119 EMISGFSL 126

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 48.5 bits (114), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 24  KNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDN 83
           K  K  +S   +K TK KVEKL+   ++ S+ I  LN     K    +S L A+ L +D 
Sbjct: 21  KKPKKSISHSDKKRTKSKVEKLDAKGLLPSE-IFKLNRSASSKTSNGSSSLLARNLEQDR 79

Query: 84  LKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
             D+   +K  +KKKET+ ++LQQIEM+SGFSL
Sbjct: 80  KMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 53/93 (56%), Gaps = 8/93 (8%)

Query: 29  KLSSQVRKSTKHKVEKLNK-LEVISSDDINALN----ALNGKKREKQTSVLEAKTLAKDN 83
           K+S+  RK +K    +LNK  +V     I  LN    A   KKR+   + L+   L KD 
Sbjct: 32  KISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQ---TALDMNCLVKDQ 88

Query: 84  LKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
            +D+++ E IE    ETN+ +L+Q+E+MSGFSL
Sbjct: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 9/82 (10%)

Query: 38  TKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEA---KTLAKDNLKDRQLIEKIE 94
           TK KVE+ NK EV     I+ LN     KR  Q+S LE+     L KD  KD+   +++E
Sbjct: 30  TKLKVEQANK-EVFL---ISELNKREDTKR--QSSPLESLKPSRLVKDIKKDQNAQKQLE 83

Query: 95  SKKKETNASLLQQIEMMSGFSL 116
           S++K T+ ++L+Q+E++SGFSL
Sbjct: 84  SQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 9/82 (10%)

Query: 38  TKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEA---KTLAKDNLKDRQLIEKIE 94
           TK KVE+ NK EV     I+ LN     KR  Q+S LE+     L KD  KD+   +++E
Sbjct: 30  TKLKVEQANK-EVFL---ISELNKREDTKR--QSSPLESLKPSRLVKDIKKDQNAQKQLE 83

Query: 95  SKKKETNASLLQQIEMMSGFSL 116
           S++K T+ ++L+Q+E++SGFSL
Sbjct: 84  SQRKATDENVLRQLELISGFSL 105

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 60/105 (57%), Gaps = 6/105 (5%)

Query: 14  RNNGKNVKDRKNI-KGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNAL-NGKKREKQT 71
           + +GK  +  +++ KG +    +  TK KVE+ NK   +    I+ LN   +  KR    
Sbjct: 4   KGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFL----ISELNEREHNTKRTPAL 59

Query: 72  SVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
             L+   L +D  KD+ + +K+E +K+ T+ ++++Q+E++SGFSL
Sbjct: 60  ESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%)

Query: 72  SVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGF 114
           S L A  L  D  KD +   +I+++KK+ N  +L+QIEM+SGF
Sbjct: 79  SSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 35.8 bits (81), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 12  SFRNNGKNVKDRKNIK-GKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQ 70
           +F++  K  K+  + K GK+S   +K  K +VEKL+K  V+ ++               +
Sbjct: 3   AFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKRGVLLAELTA-------AAPAAK 55

Query: 71  TSVLEAKTLAKDNLKDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116
           T VL+A +LA+D   D Q  ++   ++   +  ++QQ+E ++GFSL
Sbjct: 56  TGVLQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 33.1 bits (74), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 41  KVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKET 100
           +V +L+KL++  +D +        +K+ + ++ LE + + +   +D+++++K + +KK T
Sbjct: 45  QVRQLDKLDLSIADIV----PNKAQKKPRSSASLEGQKVREHYKEDKEVVKKHDKEKKAT 100

Query: 101 NASLLQQIEMMSGFSL 116
              +  Q+E++SGFSL
Sbjct: 101 EKKIEDQLELISGFSL 116

>KLLA0D15983g Chr4 (1343315..1346422) [3108 bp, 1035 aa] {ON}
           similar to uniprot|P39692 Saccharomyces cerevisiae
           YFR030W MET10 Subunit alpha of assimilatory sulfite
           reductase which is responsible for the conversion of
           sulfite into sulfide
          Length = 1035

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 7   NNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGK- 65
           +N+  S R    N+ +    + + +S   KS K  V  ++  +VI  +DI+ LNA +   
Sbjct: 391 DNVDISLRTKFDNIGNAGTFQAQFTSHPSKS-KSVVSNIDSADVIVVEDISILNAYDVAS 449

Query: 66  --KREKQTSVLEAKTLAKDNLKDRQL 89
             K+E    VL   +L   +LKD++ 
Sbjct: 450 TVKQEGSIIVLVKSSLVDKDLKDKKF 475

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 41  KVEKLNKLEVISSDDINAL--NALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKK 98
           ++E  + +E I  D IN L  ++L     E Q    E+K++A D  K R  +  I+SK K
Sbjct: 265 ELETPDHIETIEVDSINGLSTDSLLSLAEESQGHAEESKSIAHDVQKTRVTLRWIDSKFK 324

Query: 99  ETNASLLQQIEMMS 112
             N    Q + ++S
Sbjct: 325 PNN---YQSVSIIS 335

>TBLA0A05540 Chr1 complement(1374452..1378105) [3654 bp, 1217 aa]
           {ON} Anc_1.90 YGL140C
          Length = 1217

 Score = 28.9 bits (63), Expect = 3.2,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 29  KLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQ 88
           +L + VR+   H+  K          +INA+N    K+R    S+   +T   D  +D  
Sbjct: 922 RLVNSVRQILSHRYRK----------EINAINNTANKRRMSSKSIYNEETYLSDGNEDED 971

Query: 89  LIEKIESKK 97
           +I    SKK
Sbjct: 972 IIITTSSKK 980

>TPHA0G03260 Chr7 (698046..699389) [1344 bp, 447 aa] {ON}
          Anc_2.501 YHL003C
          Length = 447

 Score = 28.5 bits (62), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 27 KGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKD 86
          K K+ ++ R+ +      L ++++   D + +L  +   K+EK+ S    K L+ ++  D
Sbjct: 35 KAKIRTRSRRGSS-----LGRIDL--GDTVRSLGTMPSSKQEKKASKNRLKVLSMESKGD 87

Query: 87 RQLIEKI 93
          R L++KI
Sbjct: 88 RDLLKKI 94

>TPHA0C01470 Chr3 (337155..337862) [708 bp, 235 aa] {ON} Anc_7.181
           YBR256C
          Length = 235

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 53  SDDINALNALNGKKREKQ-TSVLEAKTLAKDNLKDRQLIEKI-ESKKKE 99
            D++N    L GK  EKQ TSVLEA+ + K+N   +  +EKI E+K KE
Sbjct: 184 GDEVNIEVDLTGKVIEKQITSVLEAE-IEKENSIFKAFVEKIVEAKMKE 231

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score = 28.5 bits (62), Expect = 4.4,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 19  NVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTS 72
           N +  +NI G+LS Q R  ++ ++   N   +  +   N LN    ++RE++ +
Sbjct: 197 NTRTNQNISGRLSRQPRMPSRREIRARNIRNLRITRQRNRLNRFEAQRRERKKA 250

>Kpol_2000.27 s2000 (51932..52381) [450 bp, 149 aa] {ON}
           (51932..52381) [450 nt, 150 aa]
          Length = 149

 Score = 27.7 bits (60), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 7/69 (10%)

Query: 30  LSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLK-DRQ 88
           L S V    KHK  K N LE + SD  +  + L GKK       L++  ++K+NLK D +
Sbjct: 50  LDSLVDPHHKHKNSKKNGLEWMYSDPTHNEDYLLGKKS------LDSSVISKNNLKNDSK 103

Query: 89  LIEKIESKK 97
           +  KI+S++
Sbjct: 104 VDSKIDSEQ 112

>Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {ON}
           complement(38564..40399) [1836 nt, 612 aa]
          Length = 611

 Score = 28.1 bits (61), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 45  LNKLEVISSDDINALNALNGKKREKQTSVLEAKTL 79
           LN  E +S DD+N ++ +NG+K E+  ++L+A  L
Sbjct: 83  LNMCE-MSIDDLNEIDVINGRKIEEPFNLLDASKL 116

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON}
           similar to uniprot|P32568 Saccharomyces cerevisiae
           YDR011W SNQ2 ABC transporter
          Length = 1515

 Score = 28.1 bits (61), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 4   GKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEVISSDDINALNA 61
           GK + +    R+NG+  +    +  K+ S  R  +KH++     L++ S DD +  NA
Sbjct: 55  GKLHEMLTRNRSNGQGSQFSPEVTSKVQSLARTLSKHRLSD-GSLDLPSGDDEDGFNA 111

>AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML102W
           (CAC2)
          Length = 510

 Score = 27.7 bits (60), Expect = 8.7,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 5   KSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEKLNKLEV 50
           KSN  + + R+N  NVK + ++ G   S ++++ K KV  L+ + V
Sbjct: 431 KSNIFRNTLRSNPVNVKRKHSVGGHNDSPIKRAAK-KVSPLSPVVV 475

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.300 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,795,046
Number of extensions: 473831
Number of successful extensions: 3582
Number of sequences better than 10.0: 450
Number of HSP's gapped: 3541
Number of HSP's successfully gapped: 482
Length of query: 116
Length of database: 53,481,399
Length adjustment: 86
Effective length of query: 30
Effective length of database: 43,620,123
Effective search space: 1308603690
Effective search space used: 1308603690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 59 (27.3 bits)