Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E039801.8ON86864353e-57
CAGL0B00396g1.8ON88843278e-41
ZYRO0F18414g1.8ON87863279e-41
Kpol_2002.111.8ON86863224e-40
SAKL0C00528g1.8ON110843228e-40
YCL057C-A (MOS1)1.8ON97973131e-38
AFR743W1.8ON82803121e-38
Smik_3.171.8ON97973096e-38
NCAS0B090801.8ON93933086e-38
Suva_3.1551.8ON97853071e-37
KLTH0F00550g1.8ON82853051e-37
TBLA0A049601.8ON96753071e-37
Skud_3.61.8ON97853053e-37
Ecym_10101.8ON82793033e-37
Kwal_33.130161.8ON82702922e-35
TDEL0C069401.8ON86862712e-32
KNAG0C002501.8ON94852689e-32
KLLA0C00550g1.8ON82822661e-31
NDAI0A001701.8ON96962471e-28
KAFR0D001701.8ON90832462e-28
KAFR0K015603.433ON101923631.6
Kwal_55.19561singletonON88244622.0
NCAS0A052701.537ON57726603.1
TBLA0A064405.453ON169019603.4
Kwal_34.16261singletonON32755578.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E03980
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   172   3e-57
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   130   8e-41
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   130   9e-41
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   128   4e-40
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   128   8e-40
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   125   1e-38
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   124   1e-38
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   123   6e-38
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   123   6e-38
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   122   1e-37
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   122   1e-37
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   122   1e-37
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   122   3e-37
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   121   3e-37
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   117   2e-35
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   108   2e-32
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   107   9e-32
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   107   1e-31
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   1e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    99   2e-28
KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON} Anc_3...    29   1.6  
Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON...    28   2.0  
NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON}             28   3.1  
TBLA0A06440 Chr1 complement(1580326..1585398) [5073 bp, 1690 aa]...    28   3.4  
Kwal_34.16261 s34 (266378..267358) [981 bp, 327 aa] {ON} YFL011W...    27   8.1  

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  172 bits (435), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60
          MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI
Sbjct: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60

Query: 61 GFGVGRGYSDGDAIFRSAAGLRSTRI 86
          GFGVGRGYSDGDAIFRSAAGLRSTRI
Sbjct: 61 GFGVGRGYSDGDAIFRSAAGLRSTRI 86

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  130 bits (327), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (84%)

Query: 3  EQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGF 62
          E+     ++ T  +SILNDKWDVVLSNM+VK GLGFGVGVVTS+L FKRR+FPVWLG+GF
Sbjct: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64

Query: 63 GVGRGYSDGDAIFRSAAGLRSTRI 86
          G GRGYS+GDAIFRS AGLRS ++
Sbjct: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  130 bits (327), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 65/86 (75%), Positives = 80/86 (93%), Gaps = 1/86 (1%)

Query: 1  MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59
          M+EQ+    L++T+P KSILNDKWDVVLSN+LVK+GLGFGVGVV S+L+FKRRAFPVWLG
Sbjct: 1  MAEQQQQAQLQVTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLG 60

Query: 60 IGFGVGRGYSDGDAIFRSAAGLRSTR 85
          IGFG+GRGY++GDAIFRSAAGLR+++
Sbjct: 61 IGFGLGRGYAEGDAIFRSAAGLRTSK 86

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  128 bits (322), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 70/86 (81%)

Query: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60
          MS+Q     +     +SILNDKWDVVLSN LVKT LGFG GV+ S++LFKRRAFPVWLGI
Sbjct: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 61 GFGVGRGYSDGDAIFRSAAGLRSTRI 86
          GFG+GRGYS+GDAIFRSAAGLR + +
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  128 bits (322), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 62/84 (73%), Positives = 75/84 (89%), Gaps = 6/84 (7%)

Query: 1   MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59
           MSEQ     L+++ P KSILNDKWDVVLSN++VKTGLGFG G+V S+LLFKRRAFPVWLG
Sbjct: 29  MSEQ-----LQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLG 83

Query: 60  IGFGVGRGYSDGDAIFRSAAGLRS 83
           +GFG+GRGY++GDAIFRS+AGLR+
Sbjct: 84  VGFGLGRGYAEGDAIFRSSAGLRT 107

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  125 bits (313), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 73/97 (75%), Gaps = 11/97 (11%)

Query: 1  MSEQKNNNNLELTSPK-----------SILNDKWDVVLSNMLVKTGLGFGVGVVTSILLF 49
          MSEQ        ++P            +IL+ KWD+VLSNMLVKT +GFGVGV TS+L F
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86
          KRRAFPVWLGIGFGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  124 bits (312), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 7  NNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVG 65
          +  LE+++P +SILNDKWDVVLSN++VKTGLGFG GV  S+L FKRRAFPVWLG+GFG+G
Sbjct: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61

Query: 66 RGYSDGDAIFRSAAGLRSTR 85
          RGY++GDAIFRS AGLR+ R
Sbjct: 62 RGYAEGDAIFRSHAGLRAVR 81

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  123 bits (309), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 72/97 (74%), Gaps = 11/97 (11%)

Query: 1  MSEQKNNNNLELTSPK-----------SILNDKWDVVLSNMLVKTGLGFGVGVVTSILLF 49
          MSEQ         +P            ++L+ KWD+VLSNMLVKT +GFGVGV TS+L F
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86
          KRRAFPVWLGIGFGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  123 bits (308), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 62/93 (66%), Positives = 70/93 (75%), Gaps = 7/93 (7%)

Query: 1  MSEQKNNNNLELTSP-------KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRA 53
          MS   N N    TS        +SILNDKWDVVLSNMLVK GLGF VGVV S++ FKRR 
Sbjct: 1  MSTDNNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRT 60

Query: 54 FPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86
          FPVWLGIGFGVGRGY++GDAIFRS AGLR+ ++
Sbjct: 61 FPVWLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  122 bits (307), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 71/85 (83%)

Query: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61
          S    N+N   ++  ++L+ KWD+VLSNMLVKT +GFG+GV TS+L FKRRAFP WLGIG
Sbjct: 13 STPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIG 72

Query: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86
          FGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  122 bits (305), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (85%), Gaps = 4/85 (4%)

Query: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60
          MSEQ   +     + +S+LNDKWDVVLSN++VKTGLGFG GVV S+LLFKRRAFPVW+G+
Sbjct: 1  MSEQLKVS----PTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGV 56

Query: 61 GFGVGRGYSDGDAIFRSAAGLRSTR 85
          GFG+GRGY++GDAIFRS+AGLR+ +
Sbjct: 57 GFGLGRGYAEGDAIFRSSAGLRTVK 81

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  122 bits (307), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 67/75 (89%)

Query: 12 LTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGRGYSDG 71
          +TS +SILNDKWD+V+SNMLVKT  GFG GV+ S++ FKRRAFPVWLG+GFG+GRGYS+G
Sbjct: 22 VTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEG 81

Query: 72 DAIFRSAAGLRSTRI 86
          DAIFRS AGLRS ++
Sbjct: 82 DAIFRSTAGLRSFQV 96

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  122 bits (305), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 72/85 (84%)

Query: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61
          S   N++    ++  +IL+ KWD+V+SNMLVKT +GFGVGV TS+L FKRRAFPVWLGIG
Sbjct: 13 STSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIG 72

Query: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86
          FGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  121 bits (303), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)

Query: 8  NNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGR 66
            LE+ +P +SILNDKWDVVLSN++VK GLGF VGV+ S+L FKRRAFPVWLGIGFG+GR
Sbjct: 3  EKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGR 62

Query: 67 GYSDGDAIFRSAAGLRSTR 85
          GY++GDAIFRS AGLR+ +
Sbjct: 63 GYAEGDAIFRSHAGLRTMK 81

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 65/70 (92%)

Query: 16 KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGRGYSDGDAIF 75
          +S+LNDKWDVVLSN++VK GLGFG GVV S+LLFKRRA PVW+G+GFG+GRGYS+GDAIF
Sbjct: 12 RSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAIF 71

Query: 76 RSAAGLRSTR 85
          RS+AGLR+ +
Sbjct: 72 RSSAGLRTVK 81

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/86 (77%), Positives = 77/86 (89%), Gaps = 2/86 (2%)

Query: 1  MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59
          MSE K+   L++ +P +SILNDKWDVVLSNMLVKTGLGFGVGVV S+L FKRRAFPVWLG
Sbjct: 1  MSE-KSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLG 59

Query: 60 IGFGVGRGYSDGDAIFRSAAGLRSTR 85
          IGFG+GRGY++GDAIFRSAAGLRS +
Sbjct: 60 IGFGLGRGYAEGDAIFRSAAGLRSVK 85

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  107 bits (268), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 61/85 (71%), Positives = 73/85 (85%)

Query: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61
          + Q NN  L     +S+LNDKWDVVLSNMLVK G+GFGVGVVTS+LLF+RRAFPVWLGIG
Sbjct: 10 ATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIG 69

Query: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86
          FGVGRGYS+GDAIFRS +G+R+ ++
Sbjct: 70 FGVGRGYSEGDAIFRSTSGIRTVKV 94

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 4/82 (4%)

Query: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60
          MSEQ         +  SIL+ +WDVVLSN++ KT LG GVG+V S+L FKRRAFPVW+G+
Sbjct: 1  MSEQVQTTK----AVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56

Query: 61 GFGVGRGYSDGDAIFRSAAGLR 82
          GFG+GRGY++GDAIFR+ AGLR
Sbjct: 57 GFGLGRGYAEGDAIFRTNAGLR 78

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/96 (64%), Positives = 71/96 (73%), Gaps = 10/96 (10%)

Query: 1  MSEQKNNNNLE----------LTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFK 50
          MSEQ N    +           T  KSILNDKWD+VLSN LVK GLGFGVGVVTS++ FK
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 51 RRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86
          RR FPVWLGIGFG GRGY++GDAIFRS+AG+RS  +
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (86%), Gaps = 4/83 (4%)

Query: 4  QKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFG 63
          + +NN+++    +SILNDKWD+VLSNMLVK GLGFGVGVVTS++ FKRRAFPVWLGIG+G
Sbjct: 12 EYSNNSID----RSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYG 67

Query: 64 VGRGYSDGDAIFRSAAGLRSTRI 86
           GR YS+GDAIFRS AGLRS +I
Sbjct: 68 FGRAYSEGDAIFRSNAGLRSVQI 90

>KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON}
           Anc_3.433 YGR094W
          Length = 1019

 Score = 28.9 bits (63), Expect = 1.6,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 5   KNNNNLELTSPKSILNDKWDVVL 27
           KN  +LEL SP S+L   WD++ 
Sbjct: 572 KNTEDLELFSPYSLLETGWDILF 594

>Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON}
           YPR194C (OPT2) - oligopeptide transporter [contig 159]
           FULL
          Length = 882

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 15  PKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWL 58
           PK I ND + ++  + L+   +G   GV      F RR +P WL
Sbjct: 728 PKKIFNDVYPIMRWSWLIGACIGLFFGVWRK---FFRRYYPTWL 768

>NCAS0A05270 Chr1 (1042604..1044337) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 27.7 bits (60), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 5/26 (19%)

Query: 36  LGFGVGVVTSILLFKRRAFPVWLGIG 61
           +G G+GVV +I+     AF VW+GIG
Sbjct: 387 IGTGIGVVVAII-----AFGVWIGIG 407

>TBLA0A06440 Chr1 complement(1580326..1585398) [5073 bp, 1690 aa]
           {ON} Anc_5.453 YDR379W
          Length = 1690

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 2   SEQKNNNNLELTSPKSILN 20
           S +KNNNNL  T+ KS+LN
Sbjct: 727 SMEKNNNNLSHTNSKSLLN 745

>Kwal_34.16261 s34 (266378..267358) [981 bp, 327 aa] {ON} YFL011W
          (HXT10) - high-affinity hexose transporter [contig 460]
          PARTIAL
          Length = 327

 Score = 26.6 bits (57), Expect = 8.1,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 4  QKNNNNLELTSPKSILNDKWDVVLSNMLVK-TGLGFG-----VGVVTSILLFKRR 52
          Q+ + N+E+    S+ +  WDVVLS   +  TG  FG     +G +T++  + RR
Sbjct: 37 QRLSVNMEVREKFSLRDQSWDVVLSCFGISFTGFFFGYDTGTIGGITNMQAWLRR 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,032,149
Number of extensions: 300949
Number of successful extensions: 912
Number of sequences better than 10.0: 27
Number of HSP's gapped: 912
Number of HSP's successfully gapped: 27
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)