Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E039701.9ON74774738200.0
Kpol_2002.121.9ON73973426770.0
NCAS0B090701.9ON73073025470.0
ZYRO0F18392g1.9ON72573025310.0
TBLA0A075601.9ON74168625190.0
SAKL0C00550g1.9ON73273224790.0
KAFR0D001801.9ON72372924750.0
KNAG0C002601.9ON74473224660.0
NDAI0A001801.9ON74071224460.0
CAGL0B00418g1.9ON74374824010.0
KLLA0C00572g1.9ON71272323750.0
YCL057W (PRD1)1.9ON71270523750.0
Smik_3.181.9ON71270523620.0
Skud_3.71.9ON71270923410.0
Suva_3.1561.9ON71268823230.0
Ecym_1011na 1ON71672620810.0
AGR406C1.9ON68369116870.0
AGR405Cna 1ON71769016650.0
ABR185WsingletonON4574179871e-126
NDAI0E020102.432ON7784735027e-53
Kpol_297.82.432ON7875164799e-50
SAKL0E03938g2.432ON7674764638e-48
KNAG0A062002.432ON7895194551e-46
KAFR0D029502.432ON7774814532e-46
Suva_11.912.432ON7754974522e-46
Kwal_26.76162.432ON7705344505e-46
AFR198W2.432ON7765074488e-46
Skud_11.932.432ON7724994471e-45
YKL134C (OCT1)2.432ON7724844452e-45
TBLA0I007102.432ON7735684443e-45
CAGL0D02112g2.432ON7614654434e-45
ZYRO0G20130g2.432ON7864714391e-44
KLTH0D04730g2.432ON7725794382e-44
Ecym_60992.432ON7735024372e-44
Smik_11.1022.432ON7724974283e-43
NCAS0A042802.432ON7734384231e-42
TPHA0G023902.432ON7954864203e-42
TDEL0A020802.432ON7874414099e-41
KLLA0B12397g2.432ON7794413884e-38
CAGL0J06534g8.821ON167095771.6
TBLA0H035908.539ON60084761.6
Suva_7.1346.227ON48674752.2
Kpol_416.7singletonON34339733.3
SAKL0D11220g1.460ON69935725.0
Smik_7.1426.227ON45074725.2
NDAI0F002905.702ON155472725.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E03970
         (747 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...  1476   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1035   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   985   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   979   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   974   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   959   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   957   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   954   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        946   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   929   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   919   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   919   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   914   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    906   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   899   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   806   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   654   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   645   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   384   e-126
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   197   7e-53
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   189   9e-50
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   182   8e-48
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   179   1e-46
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   179   2e-46
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   178   2e-46
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   177   5e-46
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   177   8e-46
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   176   1e-45
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   176   2e-45
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   175   3e-45
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   175   4e-45
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   173   1e-44
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   173   2e-44
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   172   2e-44
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   169   3e-43
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   167   1e-42
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   166   3e-42
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   162   9e-41
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   154   4e-38
CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} simi...    34   1.6  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    34   1.6  
Suva_7.134 Chr7 complement(263981..265441) [1461 bp, 486 aa] {ON...    33   2.2  
Kpol_416.7 s416 (29908..30939) [1032 bp, 343 aa] {ON} (29908..30...    33   3.3  
SAKL0D11220g Chr4 (931648..933747) [2100 bp, 699 aa] {ON} simila...    32   5.0  
Smik_7.142 Chr7 complement(261679..263031) [1353 bp, 450 aa] {ON...    32   5.2  
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    32   5.9  

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score = 1476 bits (3820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/747 (96%), Positives = 720/747 (96%)

Query: 1   MIQFLSPIIKSGIGKSFKNKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFI 60
           MIQFLSPIIKSGIGKSFKNKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFI
Sbjct: 1   MIQFLSPIIKSGIGKSFKNKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFI 60

Query: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120
           APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN
Sbjct: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120

Query: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXT 180
           QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIF             T
Sbjct: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKT 180

Query: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVA 240
           ATPKDYEIFKYVEKCHKDYVRSGLNLS              ALNSLQFSKNLGEQNEFVA
Sbjct: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVA 240

Query: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300
           FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ
Sbjct: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300

Query: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360
           NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA
Sbjct: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360

Query: 361 EKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTI 420
           EKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTI
Sbjct: 361 EKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTI 420

Query: 421 QGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPRE 480
           QGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPRE
Sbjct: 421 QGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPRE 480

Query: 481 GKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGI 540
           GKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGI
Sbjct: 481 GKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGI 540

Query: 541 HDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLES 600
           HDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLES
Sbjct: 541 HDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLES 600

Query: 601 LIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEM 660
           LIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEM
Sbjct: 601 LIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEM 660

Query: 661 NKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGI 720
           NKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGI
Sbjct: 661 NKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGI 720

Query: 721 RETNDNLKEFLGREPSKEAFLKELGLQ 747
           RETNDNLKEFLGREPSKEAFLKELGLQ
Sbjct: 721 RETNDNLKEFLGREPSKEAFLKELGLQ 747

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/734 (67%), Positives = 595/734 (81%), Gaps = 18/734 (2%)

Query: 14  GKSFKN-KSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSP 72
           GK+ KN K+ ++S  A+PA+A  I       L++ T +    N +  IAPQ +P W+++P
Sbjct: 22  GKTLKNRKTRIVSFFAVPAIAFTI-------LKYSTMT----NSSLLIAPQPAPTWNWTP 70

Query: 73  ERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDK 132
           E I+ DA+ +I  SN  ++ + AI +P++ENF++P +N EN+ S  INQLTFLQHVS DK
Sbjct: 71  EGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADK 130

Query: 133 LIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYV 192
            IRD+S++ATELI NF+IE SLR D+F QFDKI+              +  K+YE ++++
Sbjct: 131 DIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDS--KNYESYRFI 188

Query: 193 EKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDD 252
           EKCHKD++RSGLNLS              A NSL FSKNLGEQ EF+AFTKEEL+GVSD 
Sbjct: 189 EKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDA 248

Query: 253 VMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFID 312
           VM+QFE + DE+TGE+KFKVTFKYPDI PVLK+AKNPNTRK+AFNADQNKVPENE LF+D
Sbjct: 249 VMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVD 308

Query: 313 TLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKK 372
           TLKLR  L  +L Y  YANYNL++KMAKN+ETV  FL DLK KL+PL  KEIE+LK +K+
Sbjct: 309 TLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKE 368

Query: 373 TEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMN 432
            + +ELN+ YD+HYYIWDHRYYDNKYLKD FNVDLEKISEYYP+ES+I GMLKIYETVM 
Sbjct: 369 KDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMK 428

Query: 433 LKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMA 492
           LKF+EETD   ++ W  +DVKQL+VWKMD+P  PEF+GWIYFDLHPR+GKYGHAANFG++
Sbjct: 429 LKFVEETDPAKRNVWH-EDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGIS 487

Query: 493 PSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRF 552
            SY+D++ KR YPVTALVCNFS  T+DKP+LLKHNE+TTFFHELGHGIHDLVG N   R 
Sbjct: 488 SSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRL 547

Query: 553 NGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALF 612
           NGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLSKHYKTGEKIPESL+ESL++TKHVNGALF
Sbjct: 548 NGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALF 607

Query: 613 ALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMS 672
           ALRQLHF  FDM+VHT  D   +  ++L++LWNGLRE+I LVENGDEM+KGYDSFGHIMS
Sbjct: 608 ALRQLHFSTFDMEVHTAED---VSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMS 664

Query: 673 DSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLG 732
            +YSAGYYGYMWAEVFATDMYY+KFA DPLN+KSG+EYRDIIL+RGGI E NDNL+EFLG
Sbjct: 665 GAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLG 724

Query: 733 REPSKEAFLKELGL 746
           REP+  AFLKE+GL
Sbjct: 725 REPNNSAFLKEMGL 738

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/730 (64%), Positives = 580/730 (79%), Gaps = 18/730 (2%)

Query: 19  NKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQ-LSPKWDFSPERILS 77
           NK +L+S + +PA A  +  ++     FY    +  N    +AP   +P W +SPE IL+
Sbjct: 17  NKKLLISAIVLPATAFILTRKS-----FYMT--LPTNNKLLVAPTGTAPTWKWSPESILA 69

Query: 78  DAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDA 137
             K++ID + + Y+++ AIE PS+E+ V P +++EN+  L +NQLTFLQHVS DKLIRDA
Sbjct: 70  KTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDA 129

Query: 138 SLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHK 197
           S+EATEL+ +F IE S+R D+F+QFDKI+                 KD+E +K++EK HK
Sbjct: 130 SVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDD------DLKSKDFETYKFIEKVHK 183

Query: 198 DYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQF 257
           DYVR+GLNL               A NSL +SKNLGEQ E+V+FTKE+L+GVS+ VM+QF
Sbjct: 184 DYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQF 243

Query: 258 ETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLR 317
           E + D +T E+K+KVTFKYPDIFPVLKTA+ P TRK+A+ +DQNKVP+NE LF++TLKLR
Sbjct: 244 EKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLR 303

Query: 318 YQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQE 377
            QL ++LGY TYANYNLDIKMAKNQETV +F+ +LKDKLKPL +KEIE LK +KK + +E
Sbjct: 304 NQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEE 363

Query: 378 LNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIE 437
           L +AYDDHYYIWDHRYYDNK+LKD +NVDLE+ISEYYP+ESTI+GML IYET++ LKF++
Sbjct: 364 LGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVD 423

Query: 438 ETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYID 497
           ET+  +K  W  +DVKQLAVWKMDD   PEF+GWIYFDLHPR+GKY HAANFG++ SYI 
Sbjct: 424 ETNPKIKDVWH-EDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYIT 482

Query: 498 KDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGA 557
           +D  R +PVTALVCNFS +T  KP+LLKHNEITTFFHELGHGIHDLVG N   RFNGPGA
Sbjct: 483 QDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGA 542

Query: 558 VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQL 617
            PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI E LL+SLIATKHVNGALFALRQL
Sbjct: 543 TPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQL 602

Query: 618 HFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSA 677
           HFGLFDM VHTT +   +++++L++LWN LRE+I LVENG+E+ KGYDSFGHIMSDSYSA
Sbjct: 603 HFGLFDMTVHTTKN---VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSA 659

Query: 678 GYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSK 737
           GYYGYMWAEVFA DMYY+KFA DPLN+++G++YRDI+LA GG+ E  D LKEFLGREP+ 
Sbjct: 660 GYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTN 719

Query: 738 EAFLKELGLQ 747
           +AFLKELGL 
Sbjct: 720 DAFLKELGLH 729

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/730 (64%), Positives = 573/730 (78%), Gaps = 17/730 (2%)

Query: 17  FKNKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERIL 76
           F  KSI  S+VA+PA+AIGIY  +    ++ T S   +    FIAPQ +P W F+P+ +L
Sbjct: 12  FTRKSIF-SVVAVPALAIGIYRVSK--FQYSTMSSPNL----FIAPQSAPSWAFTPQSLL 64

Query: 77  SDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRD 136
            +  ++I++S  FY+++  + NP++EN V P ++ EN   L  +QLTF Q VS DK IRD
Sbjct: 65  DETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRD 124

Query: 137 ASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCH 196
           AS++ATE + NF IE SLR+D+F QFDKI+                 ++YEI+KYVEK H
Sbjct: 125 ASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGS-----QEYEIYKYVEKIH 179

Query: 197 KDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQ 256
           +DY R GL L               A NSL+FSKNLGEQ EFVAFTKEEL+GVS+ VM Q
Sbjct: 180 RDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQ 239

Query: 257 FETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKL 316
           FE + DE  G  K+KVTFKYPDIFPVLKTAKNP TRK+AF  DQ+KVP+NEKLF++TL+L
Sbjct: 240 FEQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQL 298

Query: 317 RYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQ 376
           R +L  ILGY TYANYNL++KMAKNQ+ V +FL +LKDKLKPL  KE E LK IK+ E +
Sbjct: 299 RNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECE 358

Query: 377 ELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFI 436
            L + YD HYY+WDHRYYDNKYLKD +NVDLEKISEYYP+ESTI GML IYET++ LKF+
Sbjct: 359 SLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFV 418

Query: 437 EETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYI 496
           EETD + +S W  +DVKQLAVWKMD+PSKPEFVGWIYFDLHPR+GKYGHAANFG++ SY+
Sbjct: 419 EETDPEKRSVWH-EDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYV 477

Query: 497 DKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPG 556
            +D  R YPVTALVCNFS  +A KP+LLKHNEI+TFFHELGHGIHDLVG N +  FNGPG
Sbjct: 478 KEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPG 537

Query: 557 AVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQ 616
           AVPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP+ LL+SLI+TKHV+GALFALRQ
Sbjct: 538 AVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQ 597

Query: 617 LHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYS 676
           LHFGLFDM VHT+ +   +  +DL++LWN LREE+SLVENGD   KGYDSFGHIMSDSYS
Sbjct: 598 LHFGLFDMYVHTSKN---VAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYS 654

Query: 677 AGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPS 736
           AGYYGYMWAEVFA DMY+++FA DPL++K+G++YRDI+L RGG+ ETNDNL+EFLGREPS
Sbjct: 655 AGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPS 714

Query: 737 KEAFLKELGL 746
           +EAFLKELGL
Sbjct: 715 EEAFLKELGL 724

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/686 (68%), Positives = 553/686 (80%), Gaps = 6/686 (0%)

Query: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120
           APQ +P W+++P +++ DA+ +ID SN FY+A+  +++P   NF++P +N+EN+    IN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXT 180
           QLTFLQHVS +K IRDAS +AT+L+ NF+IE SLRY +F QFDKI+              
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE--- 177

Query: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVA 240
             PKD E +++V K H+D+VR+GLNL               A NSL+F+ NLGEQ EFVA
Sbjct: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVA 237

Query: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300
           FTKEEL+GVSD VM+QFE + DE+TG++ +KVTFKYPDIFPVLKTA+NP TRK AF  DQ
Sbjct: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297

Query: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360
           NKV EN  LF +TLKLR QL  ILGY TYANYNL++KMAK Q++V +FL DL D+LKPL 
Sbjct: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357

Query: 361 EKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTI 420
            KEIE+LK+IK+ E +ELN+ +D+HYY+WDHRYYDNKYLKD +NVDLEKISEYYP++STI
Sbjct: 358 SKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTI 417

Query: 421 QGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPRE 480
           +GML IYET++NLKFIEE D          +VKQLAVWKMD+P  PEFVGWIYFDLHPR+
Sbjct: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477

Query: 481 GKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGI 540
           GKYGHAANFG++ SYI  +++R YPVTALVCNFS  TADKPALLKHNEITTFFHELGHGI
Sbjct: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537

Query: 541 HDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLES 600
           HDLVG N   RFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP  LL S
Sbjct: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597

Query: 601 LIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEM 660
           L+ATKHVNGALFALRQLHFGLFDMKVHT+ D   ++N+D ++LWN LREE+SLVENGD  
Sbjct: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKD---LENLDFLKLWNELREEVSLVENGDLF 654

Query: 661 NKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGI 720
            KGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYY+KFA +PL TK G+EYRD +LARGG+
Sbjct: 655 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714

Query: 721 RETNDNLKEFLGREPSKEAFLKELGL 746
            E  DNL +FLGR+PS EAFLKELGL
Sbjct: 715 YEIEDNLIQFLGRKPSNEAFLKELGL 740

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/732 (63%), Positives = 564/732 (77%), Gaps = 18/732 (2%)

Query: 21  SILLSLVAIPAVAIGIY---HQNNQGLRFYTASQVKMN---EAAFIAPQLSPKWDFSPER 74
           S   SL+AIPA+A G Y   H  N+ LR   ++   M+    A  + PQ +P W +SPE 
Sbjct: 12  STTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPED 71

Query: 75  ILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLI 134
           IL    + I +++  ++A+  +ENP++E+ V P +  EN     INQLTFLQHVS DK +
Sbjct: 72  ILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEV 131

Query: 135 RDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEK 194
           RDAS +ATEL+ +F+IE SLR+D+F QFDK++                 + +E++K+VEK
Sbjct: 132 RDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKK------EHFELYKFVEK 185

Query: 195 CHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVM 254
           CHKDYVR+GLNL               + NSLQFSKNLGEQ EFVAFT EEL+GVS  VM
Sbjct: 186 CHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVM 245

Query: 255 KQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTL 314
            QFE +TD   G +K KV+FKYPDI PVLKTAKNP TRK AF  DQNKVP+NE LF++TL
Sbjct: 246 DQFEKFTDTD-GVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETL 304

Query: 315 KLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTE 374
           +LR +L  +LGY TYANYNLDIKMAK QETV+ FL DLK+KLKPL  KEIE LK++K+ +
Sbjct: 305 RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKD 364

Query: 375 AQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLK 434
            +EL + +D+HYYIWD+RYYDNKYLK+ +NVD EKISEY+P+E TI GMLKIYETV+ LK
Sbjct: 365 CKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLK 424

Query: 435 FIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPS 494
           F+EETD + K  W  +DVKQLAVWK+D    PEFVGWIYFDLHPR+GKYGHAANFG+A S
Sbjct: 425 FVEETDAEKKQVWH-EDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASS 483

Query: 495 YIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNG 554
           Y+ +D  R +PVTALVCNFS  +A KPALLKH+EITTFFHELGHGIHDLVG N IGRFNG
Sbjct: 484 YV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNG 542

Query: 555 PGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFAL 614
           PGA PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE LL+SLIATKHVNGALFAL
Sbjct: 543 PGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFAL 602

Query: 615 RQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDS 674
           RQL FGLFDM VHT  D   ++++D+  LWN LR+E+SLVENGD++ KG++SFGHIMS +
Sbjct: 603 RQLTFGLFDMTVHTCKD---LESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGA 659

Query: 675 YSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGRE 734
           YSAGYYGYMWAEVFA DMY++KFA DPLN   G+ YRDI+L+RGG+ E +DNL+EFLGRE
Sbjct: 660 YSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGRE 719

Query: 735 PSKEAFLKELGL 746
           P+ EAFLKELGL
Sbjct: 720 PNNEAFLKELGL 731

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/729 (64%), Positives = 567/729 (77%), Gaps = 21/729 (2%)

Query: 19  NKSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSD 78
           ++   LSLV IPA +  +Y+      R Y+     M  +AFIAPQ +P W+++P R+L D
Sbjct: 12  SRKSFLSLVCIPATSYLVYN------RLYS----NMTISAFIAPQAAPSWNWNPSRLLFD 61

Query: 79  AKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDAS 138
           A+ +ID SN  Y+ + +++ P++EN V P +  EN+ S  IN+L FLQHVS+D  IR+AS
Sbjct: 62  AECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREAS 121

Query: 139 LEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHKD 198
           L+ATEL+  F+IE SLR+D+F QFDKI+                  D+E +K++EK HKD
Sbjct: 122 LKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDF----VKEYDFETWKFIEKVHKD 177

Query: 199 YVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFE 258
           YVRSGLNL                 NSLQ+SKNLGEQ E +AFT+EEL+GVSD V +QFE
Sbjct: 178 YVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFE 237

Query: 259 TYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRY 318
            + DE+TGE+KFKVTFKYPDIFPVLKTAKNP TR+ AF ADQNKVP+NE LF++TLKLR 
Sbjct: 238 KFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRN 297

Query: 319 QLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQEL 378
           +L   L Y TYANYNL+ KMAK QETV++FL DLK +LKPLA KEI +LK IK+ E +EL
Sbjct: 298 ELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKEL 357

Query: 379 NMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEE 438
           N  YD HYYI+DHRYYDNKYLKD FNVDLE ISEYYP+E TI GMLKIYE +  LKF EE
Sbjct: 358 NREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEE 417

Query: 439 TDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDK 498
           T    KS W  +DVKQLAVWKMD+P KPEFVGWIYFDLHPR+GKYGHAANFG++ SY+D 
Sbjct: 418 TKN--KSVW-HEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDI 474

Query: 499 DS-KRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGA 557
           ++ KR YPVTALVCNFS +TA +P+LLKHNEITTFFHELGHGIHDLVG N + RFNGPGA
Sbjct: 475 ETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGA 534

Query: 558 VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQL 617
            PWDFVEAPSQMLEFWTWN NEL SLS HY++ EKIP+ LL SLI TKHVNGALFALRQL
Sbjct: 535 TPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQL 594

Query: 618 HFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSA 677
           HFGLFDM VHTT   N +++++L++LWN LREEI LVE G E++KGYDSFGHIMSDSYSA
Sbjct: 595 HFGLFDMTVHTT---NNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSA 651

Query: 678 GYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSK 737
           GYYGYMWAEVFA DMY++KF+ +PL+++ G++YRDI+LA GG+ E  DNL++FLGREPSK
Sbjct: 652 GYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSK 711

Query: 738 EAFLKELGL 746
            AFLKELGL
Sbjct: 712 NAFLKELGL 720

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/732 (63%), Positives = 563/732 (76%), Gaps = 9/732 (1%)

Query: 18  KNKSILLSLVAIPAV--AIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERI 75
           ++K  LL  V +P    A   ++Q+++     ++   +M+          P+W+F   +I
Sbjct: 19  RSKLTLLPFVVLPTALFATSHFYQSSRSYSSTSSGLSRMSPQLVPPAGALPRWEFPSAKI 78

Query: 76  LSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIR 135
             +A +II+++N FY+ +V I NPSI+N V P +N EN   L +NQL FLQHVS DK IR
Sbjct: 79  GEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIR 138

Query: 136 DASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKC 195
           +AS +ATEL+ NF+IE SLR+D+F QFDKI+             +   + +EI+K+VEKC
Sbjct: 139 EASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEF---SHDEEQFEIYKFVEKC 195

Query: 196 HKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMK 255
           HKD+VR+GLNLS              A NSL+FSKNLGEQ EF+ F+KE+L+GVSD VM+
Sbjct: 196 HKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDGVSDTVME 255

Query: 256 QFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLK 315
           QFE   DE T E  +KVTFKYPDIFPVLK AKN  TRK AF  DQNKVP+NE+LF+ TLK
Sbjct: 256 QFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLK 315

Query: 316 LRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEA 375
           LR +L  +LGYDTYANYNL+IKMAK Q TV +FL DLKDKLKPL EKEI +LK+IK+ E 
Sbjct: 316 LRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGILKSIKEAEC 375

Query: 376 QELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKF 435
           +EL + +D  YYIWDHRYYD KYLKD FNVD E I+EYYP++STI+GMLKIYETV  LKF
Sbjct: 376 KELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKF 435

Query: 436 IEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSY 495
           +EE D   K+ W  +DVKQ+AVWKMD+   P FVGWIYFDLHPR+GKYGHAANFG+A SY
Sbjct: 436 VEEKDTAKKNVW-NEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASSY 494

Query: 496 IDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGP 555
           I +D  R YPVTALVCNFS ++A KP+LLKHNEITTFFHELGHGIHDLVG N   RFNGP
Sbjct: 495 IREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGP 554

Query: 556 GAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALR 615
           GA PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE LL+SLIATKHVNGALFALR
Sbjct: 555 GATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALR 614

Query: 616 QLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSY 675
           QLHFGLFDM VHT+ D   + ++DL++LW  LR+EISLVENG +  KGYDSFGHIMSDSY
Sbjct: 615 QLHFGLFDMTVHTSKD---VASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSY 671

Query: 676 SAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREP 735
           SAGYYGYMWAEVFATDMY +KFA +PL++  G++YRDI+LA GG+ E +DNLKEFLGREP
Sbjct: 672 SAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREP 731

Query: 736 SKEAFLKELGLQ 747
           SK+AFLKELGLQ
Sbjct: 732 SKDAFLKELGLQ 743

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/712 (66%), Positives = 561/712 (78%), Gaps = 18/712 (2%)

Query: 42  QGLRFYTASQVKM------NEAAFIAP-QLSPKWDFSPERILSDAKKIIDTSNDFYNAMV 94
           Q  R Y+ + + M      N+  FIAP    P W ++P++IL + K  I+ +N +YN++ 
Sbjct: 40  QSKRTYSPNNIIMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSIS 99

Query: 95  AIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISL 154
            IE+PSIEN +IP +N+EN+  L INQLTFLQHVS DK IRDASLEAT L+ + DI  SL
Sbjct: 100 EIESPSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSL 159

Query: 155 RYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXX 214
           R+++++QF+K++                   +E +K++EK HKD +R+GL          
Sbjct: 160 RWEIWEQFEKVWETVQNDDDFLKN-----HQFETYKFIEKIHKDSLRNGL--KSERNYQL 212

Query: 215 XXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTF 274
                  + ++L FS NLGEQNE+V+FTKEEL+GVS+ VM QFE + D +T E+K+KVTF
Sbjct: 213 KYIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTF 272

Query: 275 KYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNL 334
           KYPDIFPVLKTAKNP TRKIAF  DQNKVPENEKL  + LKLR +L   LGY TYANYNL
Sbjct: 273 KYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNL 332

Query: 335 DIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYY 394
           DIKMAKNQETV++FL DLK+KLKPLAEKEI++LK +KK E +EL + YD HYYIWDHRYY
Sbjct: 333 DIKMAKNQETVLKFLNDLKEKLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYY 392

Query: 395 DNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQ 454
           DNKYLKD FNVD+EKISEYYP+ESTI GMLKIYETV+NLKFIEETD   K+ W   DVKQ
Sbjct: 393 DNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWH-PDVKQ 451

Query: 455 LAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFS 514
           L+VW MDD + P FVGWIYFDL+PR+GKYGHAANFG+A SYI +++KR YPVTALVCNFS
Sbjct: 452 LSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFS 511

Query: 515 AATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWT 574
             T +KPALLKH+EITTFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWT
Sbjct: 512 KPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWT 571

Query: 575 WNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQ 634
           WNKNELLSLSKHYKTGEKIPE LL+SLI+TKHVNGALFALRQLHFGLFDM VHTT D   
Sbjct: 572 WNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKD--- 628

Query: 635 IDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYY 694
           I+N+DL++LWN  REEI LVENG+   KGY+SFGHI+SDSYSAGYYGYMWAEVFA DMY+
Sbjct: 629 IENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYH 688

Query: 695 SKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGL 746
           +KFA +PL+   GI+YRD+ILA+GG+ E NDNL EFLGREPS + FLKELGL
Sbjct: 689 TKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL 740

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/748 (62%), Positives = 565/748 (75%), Gaps = 20/748 (2%)

Query: 8   IIKSGIGKS-FKNKSILLSLVAIPA-VAIGIYHQNN---QGLRFYT--ASQVKMNEAAFI 60
           II   +G + F++K    +L+A+P  V+    H NN     +R Y+  A+    N  +  
Sbjct: 8   IIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLT 67

Query: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120
            PQ  P W+F PE ILS  K+ I  +  FY+ +VAI+NP+IEN ++P IN ENEN L IN
Sbjct: 68  PPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLIN 127

Query: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXT 180
           QLTFLQHVS+DK IRDAS+EAT L+ +F+IE   R D+FKQFD I+              
Sbjct: 128 QLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEF---- 183

Query: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVA 240
              +D+EI+++VEKCHKDYVR+GLNL               A N L+FSKNLGEQ E++ 
Sbjct: 184 ---EDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYIL 240

Query: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300
           FT EEL+GV + V++QFE   DE  G QK KVT+KYPDIFPVLK A+NP TR  AF  DQ
Sbjct: 241 FTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQ 299

Query: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360
           NKVPENE LF DTLKLR +L  +LGYDTYANYNLDIKMAKN +TV+ F+ DL  KL+  A
Sbjct: 300 NKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPA 359

Query: 361 EKEIEVLKAIKKTEAQ-ELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVEST 419
           +KE+++LK +KK E + E NM YD  YYIWDHRYYDNKYLK+ FNVD EKI+EYYP+EST
Sbjct: 360 KKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLEST 419

Query: 420 IQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPR 479
           I GMLKIYET++ LKF+E   K+ K TW  DDVKQLAVWK+D P  PEFVGWI+FDLHPR
Sbjct: 420 IDGMLKIYETLLKLKFVEV--KENKKTWH-DDVKQLAVWKLDTPENPEFVGWIFFDLHPR 476

Query: 480 EGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHG 539
           +GKYGHAANFG++ SYI  +  R YP+TALVCNFS +T DKP+LLKH+EITTFFHELGHG
Sbjct: 477 DGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHG 536

Query: 540 IHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLE 599
           IHDLVGNN IGRFNGPGAVPWDFVEAPSQMLEFWTWN  ELLSLS++YK   KI   LLE
Sbjct: 537 IHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLE 596

Query: 600 SLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDE 659
           SLI TKHVNGALFALRQLHFGLFDMKVH  + + ++D +D+ +LWN LRE+I L+ NGD+
Sbjct: 597 SLIKTKHVNGALFALRQLHFGLFDMKVHMMSAE-ELDKLDIKKLWNDLREKICLISNGDQ 655

Query: 660 MNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGG 719
              GY+SFGHIMS SYSAGYYGYMWAEVFATDMYY+KF  DPLN + G++YRDI+LARGG
Sbjct: 656 PTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715

Query: 720 IRETNDNLKEFLGREPSKEAFLKELGLQ 747
           + E +DNL+EFLGR+P+K+AFL+ELGL 
Sbjct: 716 LYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/723 (62%), Positives = 551/723 (76%), Gaps = 26/723 (3%)

Query: 25  SLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAKKIID 84
           SLV IP +A   +         + A +  M +  F+ PQ +P W+++ E +L    + ID
Sbjct: 15  SLVVIPTLAFASFQ--------FNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQTHEAID 66

Query: 85  TSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATEL 144
           +SN+  +++ +I NPS+ENFV P ++ EN  S   NQLTFLQHVS DK +RD S + TEL
Sbjct: 67  SSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTEL 126

Query: 145 ITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKD-YEIFKYVEKCHKDYVRSG 203
           I NF IE SLR+ +F+QFD ++                 KD +EI+K+VEKCHKD++RSG
Sbjct: 127 IENFGIESSLRFKLFRQFDIVWNQLKDDAQFK-------KDHFEIYKFVEKCHKDFLRSG 179

Query: 204 LNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDE 263
           LNL               + NSLQFSKNLGEQNEF+ FTKEEL GVS++VMKQFET   +
Sbjct: 180 LNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV--D 237

Query: 264 QTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKI 323
           + G  K+KVTFKYPDIFPVLK+AKN  TRK AF  DQNKVP+NE LF++TL+LR  L ++
Sbjct: 238 EDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAEL 297

Query: 324 LGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYD 383
           L YD+YA+YNLDIKMAK +E V+ FL DLK+KLKPL EKE+  LK +K+ E +ELN  YD
Sbjct: 298 LNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYD 357

Query: 384 DHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDL 443
             YYIWD+RYYDN+YLK  F +D EKI+EY+P+ESTI+GML+IYETV+ LKFIEE + D 
Sbjct: 358 RRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGD- 416

Query: 444 KSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRI 503
             TW  D VK+L+VWKMDD + P FVGWIYFDLHPREGKYGHAANFG++ S++  D  R 
Sbjct: 417 --TWHPD-VKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRS 472

Query: 504 YPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFV 563
           YPVTALVCNFS  T DKPALLKH+E+TTFFHELGHGIHDLVG N IGRFNGP A PWDFV
Sbjct: 473 YPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFV 532

Query: 564 EAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFD 623
           EAPSQMLEFWTWNK EL SLSKHY+T EKIP+SLL+SL+ TKH+NGALFALRQLHFGLFD
Sbjct: 533 EAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFD 592

Query: 624 MKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYM 683
           MKVHTT D   I  +++ +LWN LREEI L++NGD   KG++SFGHIMSDSYSAGYYGYM
Sbjct: 593 MKVHTTKD---ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYM 649

Query: 684 WAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKE 743
           WA+VFA+DMYY+KF +DPLN+  G++YRDIILARGG+ E  DNL EFLGR+P+ +AFLKE
Sbjct: 650 WADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKE 709

Query: 744 LGL 746
           LGL
Sbjct: 710 LGL 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/705 (63%), Positives = 538/705 (76%), Gaps = 15/705 (2%)

Query: 46  FYTASQVKM-NEAAF-IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103
            YT S   M N  +F IAPQ  P W F+P  I     +II+ SN+FY++M  +E+PS+ N
Sbjct: 19  LYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSN 78

Query: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163
           FV P + FENE    INQLTFLQHVS DK IRDAS+ ++  +   +I++SLR+D+F QF 
Sbjct: 79  FVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFA 138

Query: 164 KIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXAL 223
           +++              A   + E FKYVEK +KDY+ SGL L               ++
Sbjct: 139 RVWQDVQSK--------ADSVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISV 190

Query: 224 NSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPV 282
           NS+ FSKNLGEQ E++ FTKE+LEGV D ++ QFET  +D+ + E  +KVTFKYPDIFPV
Sbjct: 191 NSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPV 250

Query: 283 LKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQ 342
           +K A +  TRK AF ADQNKVPENE + +DTLKLR +L  +LGYDTYANYNL  KMA++ 
Sbjct: 251 MKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDS 310

Query: 343 ETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDK 402
            TVM FL DLKDKL PL  KE++VL+ +K  + ++LN   D +YYIWDHRYYDNKYL + 
Sbjct: 311 TTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLEN 370

Query: 403 FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDD 462
           FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  D   KS W  DDVKQ+AVW MDD
Sbjct: 371 FNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWH-DDVKQIAVWNMDD 429

Query: 463 PSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPA 522
           P  P FVGWIYFDLHPR+GKYGHAANFG++ S++  D+ R YPVTALVCNFS +T DKP+
Sbjct: 430 PKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPS 489

Query: 523 LLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLS 582
           LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL++
Sbjct: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIN 549

Query: 583 LSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQ 642
           LS HYKTGEKIPESL+ SLI TKHVNGALF LRQLHFGLFDMKVHT  D   + N+ +  
Sbjct: 550 LSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LQNLSICD 606

Query: 643 LWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPL 702
            WN LR++ISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPL
Sbjct: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666

Query: 703 NTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747
           N K+GI+YRDI+LARGG+ + NDNLKEFLGREPSK+AFLKELGLQ
Sbjct: 667 NAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/705 (63%), Positives = 538/705 (76%), Gaps = 15/705 (2%)

Query: 46  FYTASQVKMNEAAF--IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103
            YT S   M+ A    IAPQ  P W F+P  I    K+IID SN+FY +M  +E P++ N
Sbjct: 19  LYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTN 78

Query: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163
           FV P + FENE    INQLTFLQHVS DK IRDAS+ ++  +   +I++SLR+D++ QF 
Sbjct: 79  FVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFA 138

Query: 164 KIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXAL 223
           +++                  + E FKY+EK +KDY+ SGL L               ++
Sbjct: 139 RVWQDAQSKSDSI--------ERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISV 190

Query: 224 NSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPV 282
           NS+ FSKNLGEQ E++ FTKE+LEGV D V+ QFET  +D+   E  +KVTFKYPDIFPV
Sbjct: 191 NSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPV 250

Query: 283 LKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQ 342
           +K A +  TRK AF ADQNKVPENE + +DTL+LR +L  +LGYDTYANYNL  KMAK+ 
Sbjct: 251 MKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDS 310

Query: 343 ETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDK 402
            TVM+FL DLKDKL PL +KE+E+L+ +K  + ++LN   D +YYIWDHRYYDNKYL + 
Sbjct: 311 TTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLEN 370

Query: 403 FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDD 462
           FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  D   KS W  DDVKQLAVW MDD
Sbjct: 371 FNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWH-DDVKQLAVWNMDD 429

Query: 463 PSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPA 522
           P  P+FVGWIYFDLHPR+GKYGHAANFG++ S++  DS R YPVTALVCNFS +T DKP+
Sbjct: 430 PKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPS 489

Query: 523 LLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLS 582
           LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ 
Sbjct: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELID 549

Query: 583 LSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQ 642
           LS HY+TGEKIPESL++SLI TKHVNGALF LRQLHFGLFDMKVHT  D   + N+ + +
Sbjct: 550 LSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LQNLSICE 606

Query: 643 LWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPL 702
            WN LR++ISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPL
Sbjct: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666

Query: 703 NTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747
           NTK+GI+YRDI+LARGG+ +  D+LK+FLGREPSK+AFLKELGLQ
Sbjct: 667 NTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQ 711

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/709 (62%), Positives = 536/709 (75%), Gaps = 23/709 (3%)

Query: 46  FYTASQVKMNEAAF--IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103
            YT     M  AA   IAPQ  P W F+P  I     +IID SN FY  M  +E+PS+ N
Sbjct: 19  LYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTN 78

Query: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163
           F+ P + FENE    IN+LTFLQHVS DK IRDAS++++  +   +I++SLR+D+F QF 
Sbjct: 79  FIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFA 138

Query: 164 KIFXXXXXXXXXXXXXTATPK----DYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXX 219
           +++              A PK      E FKY+EK +KD++ SGL L             
Sbjct: 139 RVWQD------------AQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKK 186

Query: 220 XXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQK-FKVTFKYPD 278
             ++NS+ FSKNLGEQ E++ FTKE+LEGV D ++ QFET   E+ GE   +KVTFKYPD
Sbjct: 187 KISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPD 246

Query: 279 IFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKM 338
           IFPV+K A +  TRK AF ADQNKVPENE + +DTLKLR +L  +LGY+TYA+YNL  KM
Sbjct: 247 IFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKM 306

Query: 339 AKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKY 398
           AK+  TVM+FL DLK KL PL +KE++VL+ +K  + +      D +YYIWDHRYYDNK+
Sbjct: 307 AKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKH 366

Query: 399 LKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVW 458
           L + FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  +   KS W  +DVKQLAVW
Sbjct: 367 LLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWH-EDVKQLAVW 425

Query: 459 KMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATA 518
            MDDP  P F+GWIYFDLHPR+GKYGHAANFG++ S++  DSKR YPVTALVCNFS +T 
Sbjct: 426 NMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTK 485

Query: 519 DKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKN 578
           DKP+LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKN
Sbjct: 486 DKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKN 545

Query: 579 ELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNM 638
           EL+SLS HYKTGE+IPESL++SLI TKHVNGALF LRQLHFGLFDMKVHT  D   ++N+
Sbjct: 546 ELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LENL 602

Query: 639 DLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFA 698
            +   WN LR+EISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFA
Sbjct: 603 SICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662

Query: 699 KDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747
           KDPLNTK+G++YRDI+LARGG+ + NDNLKEFLGREPSK+AFLKELGLQ
Sbjct: 663 KDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/688 (62%), Positives = 529/688 (76%), Gaps = 13/688 (1%)

Query: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120
           APQ  P W F+P  I    K+II+ SN FY++M  +E+P++ NFV P + FENE    IN
Sbjct: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95

Query: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXT 180
           QLTFLQHVS DK IRDAS++++  +   +I++SLR+D+F QF +++              
Sbjct: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQ-------- 147

Query: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVA 240
           A   + E F+Y+EK +KDY+ SGL L               ++NS+ FSKNLGEQ EF+ 
Sbjct: 148 ADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFIT 207

Query: 241 FTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNAD 299
           FTKE+LEGV D ++ QFET  + + + E  +KVTFKYPDIFPV+K A +  TRK AF AD
Sbjct: 208 FTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLAD 267

Query: 300 QNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPL 359
           QNKV ENE + +DTLKLR ++  +LGYDTYANYNL  KMAK+  TVM+FL DLK KL PL
Sbjct: 268 QNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPL 327

Query: 360 AEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVEST 419
            EKE+++L+ +K  + ++ N   D +YYIWDHRYYDNKYL + FNVDLEKISE++P+E+T
Sbjct: 328 GEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETT 387

Query: 420 IQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPR 479
           I GML+IYET+ NLKFIE  +   KS W  +DVKQLAVW MDDP  P F+GWIYFDLHPR
Sbjct: 388 ITGMLQIYETLFNLKFIETKNPQEKSVWH-EDVKQLAVWNMDDPKSPRFIGWIYFDLHPR 446

Query: 480 EGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHG 539
           +GKYGHAANFG++ S++  D+ R YPVTALVCNFS +T DKP+LLKHNEI TFFHELGHG
Sbjct: 447 DGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHG 506

Query: 540 IHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLE 599
           IHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIPE L++
Sbjct: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLID 566

Query: 600 SLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDE 659
           SLI TKHVNGALF LRQLHFGLFDMKVH+  D   + N+ +   WN LR++ISL+ NG  
Sbjct: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVHSCKD---LQNLSICDTWNQLRQDISLMSNGGT 623

Query: 660 MNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGG 719
           ++KGY SFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPLNTK+GI+YRDI+LARGG
Sbjct: 624 LSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGG 683

Query: 720 IRETNDNLKEFLGREPSKEAFLKELGLQ 747
           +R+ ND+LKEFLGREPSK+AFLKELGLQ
Sbjct: 684 LRDINDSLKEFLGREPSKDAFLKELGLQ 711

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/726 (54%), Positives = 524/726 (72%), Gaps = 23/726 (3%)

Query: 21  SILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAK 80
           S  +S + +PA+AI        G R  +    + N ++ ++P+L+P WDF+ + I+S A+
Sbjct: 14  SATVSFLLLPALAIA-------GNR--SVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQ 64

Query: 81  KIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLE 140
           K ID    FY+++ ++E P +ENFV+  I+ E+E    ++QLTFLQHVS DK +RDAS+E
Sbjct: 65  KAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIE 124

Query: 141 ATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXXXXXTATPKDYEIFKYVEKCHKDYV 200
           AT+LI  + IE S RYD++ QF K++                  D E++ Y+E  +KDY+
Sbjct: 125 ATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE------NLKKNDPELYWYMENVNKDYI 178

Query: 201 RSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY 260
            +G+ L               A NSL FS NLGEQN+++AFTK+EL GVS+  + QFE  
Sbjct: 179 HAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKV 238

Query: 261 TDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQL 320
            ++  G +K+K+TFKYPDI PVL TAKNP TRK A+  DQNKVP+NE++ I+TLKLR +L
Sbjct: 239 IED--GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNEL 296

Query: 321 GKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNM 380
            +I G+ TYA+Y L++KMAK QETV  FL DLKDKL P  +K++E LK++K+ E +EL +
Sbjct: 297 AEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGL 356

Query: 381 AYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETD 440
            Y+  +  WD+RYYD+KYLK+ F+VD E++++Y+P++ TI GML IY+ + NLKF+EET 
Sbjct: 357 PYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETR 416

Query: 441 KDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDS 500
           +  K+ W  +DVKQ AVW +D    PEFVGWIYFDLHPREGKYGHAANFG+   Y+ ++ 
Sbjct: 417 ECGKNVWH-EDVKQFAVWDLDK-CNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEG 474

Query: 501 KRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPW 560
            R YPVT LVCNFS  ++ +PALLKH E+ TFFHELGHGIH LVG + IG  NGP ++PW
Sbjct: 475 TRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPW 534

Query: 561 DFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFG 620
           DFVEAPSQMLEFW WNK+++L LSKHY+TGE+IP+ L++SLI TKHVN  L  LRQLHF 
Sbjct: 535 DFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFS 594

Query: 621 LFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYY 680
           LFDM VHT   D ++D +D+  LWN LREE++L+ NGD + KGYDSF HIMS  YSAGYY
Sbjct: 595 LFDMTVHT---DKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMS-GYSAGYY 650

Query: 681 GYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAF 740
           GYMW+EVFA DMY++ FA +PL+T  G  YRDIILA+GG+R+  D+L+EFLGREP+ +AF
Sbjct: 651 GYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAF 710

Query: 741 LKELGL 746
           LKELGL
Sbjct: 711 LKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/691 (47%), Positives = 466/691 (67%), Gaps = 14/691 (2%)

Query: 57  AAFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENS 116
           A+ + PQ +P W+FS + ++S + ++I+ +   Y+ ++  + P+I+N+++P I  E E  
Sbjct: 5   ASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETD 64

Query: 117 LAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXX 176
           L  NQL FL++VS D  IR+AS  AT ++ ++ I ++ +YD+++ FD+++          
Sbjct: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFK 124

Query: 177 XXXTATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQN 236
                  +++E+++Y+EK    Y RSG+ +               A   L+FS NLGE+ 
Sbjct: 125 K------ENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEV 178

Query: 237 EFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAF 296
           E++AFTKEELEGV D V+ QFE     + G +KFKVTFKYPDI PVL+ A NP TR+ A 
Sbjct: 179 EYIAFTKEELEGVPDTVLNQFEKII--EGGVEKFKVTFKYPDIGPVLRLASNPETRRRAS 236

Query: 297 NADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKL 356
            AD+N+V  NE L  +TL+LR +L  +LG+  +A YNLD KMAKN+ETV++FL DL +KL
Sbjct: 237 MADENRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKL 296

Query: 357 KPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPV 416
            P+ + ++E+LK  K  + +  N+ +D  +Y WD  YY NK L++++NV+ + +++Y+PV
Sbjct: 297 LPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPV 356

Query: 417 ESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDL 476
           ES I+GML IY T+  LKF+E TD+  KS W  +DVKQ AVW +DD   P+F GW+YFDL
Sbjct: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWH-EDVKQFAVWNIDDEDNPKFQGWLYFDL 415

Query: 477 HPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHEL 536
           HPR+GKYGHAANFGM  +Y  +D  + YPVT LV NFS  T  +PALLK  E+TTFFHEL
Sbjct: 416 HPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHEL 475

Query: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596
           GHGIHDLVG+N +   NGPG+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+S
Sbjct: 476 GHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKS 535

Query: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656
           LL++  +   +N  L  L QL  GLFDM VHT          ++ +LWN L  EI L+  
Sbjct: 536 LLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT----RDYKGAEVRKLWNDLTREIGLMNL 591

Query: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716
            +  + GYDSFGHIM+   +  YYGY+W++VFA DMY +KF  +P N   G+EYRD ILA
Sbjct: 592 KNYTSTGYDSFGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILA 650

Query: 717 RGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747
            GG+ +  DNL++FLGR+P+ +AFL+ LGL+
Sbjct: 651 TGGLYDMTDNLRKFLGRDPNNKAFLRGLGLK 681

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/690 (46%), Positives = 455/690 (65%), Gaps = 14/690 (2%)

Query: 58  AFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENP-SIENFVIPSINFENENS 116
           + + PQ  P W+++   ++  A  +   S+  Y ++ + ++  +++N++ P +  + E  
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 117 LAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFXXXXXXXXXX 176
           L  NQL FL++VS D  +R+ASL   +++  +   IS +YD++  F+ I+          
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130

Query: 177 XXXTATPKDYEIFKYVEKCHKDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLGEQN 236
                   +YE++KY+EK    Y R+  NL+              ++++LQFS NLGE+ 
Sbjct: 131 VT------NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEET 184

Query: 237 EFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAF 296
           E++ FT+EELEGVS  V+ QFE     + G +K KVTFKYPDI PVL+TA NP TR+ A+
Sbjct: 185 EYITFTEEELEGVSPLVLDQFERII--EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAY 242

Query: 297 NADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKL 356
            ADQN+V  NE+L  +TL LR ++ ++ GY  YA YNL  KMAKN+ETV+ FL DL ++L
Sbjct: 243 VADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERL 302

Query: 357 KPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPV 416
            P+ EK+ E+LK+ K  + +  N+ +D   Y WD+ YY+NK L++K+ +D E +++Y+P+
Sbjct: 303 LPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPI 362

Query: 417 ESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDL 476
           ES I+GML  Y+T+  LKF+E TD   K+ W  +DVKQ AVW +DD   PEF GWIYFDL
Sbjct: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWH-EDVKQFAVWNIDDEDCPEFQGWIYFDL 421

Query: 477 HPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHEL 536
           +PR+GKY HAANFGMA ++  KD  + YPVT LVCN +  T  + A+L+  EITT FHEL
Sbjct: 422 YPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHEL 481

Query: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596
           GHGIH LV NN +   N  G+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP S
Sbjct: 482 GHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPS 541

Query: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656
           LL++   +  +   L+ L QL  GLFDM VHT     +   +++ +LWN +R EISL+ +
Sbjct: 542 LLDAWFNSSGLGSGLYYLGQLRLGLFDMYVHT----REYHGLEVRKLWNDMRREISLINS 597

Query: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716
            +  + GY++FGHIM+ SYSAGYYGY+W++VFA DMY +KF  +P N+  G +YRD ILA
Sbjct: 598 QNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILA 657

Query: 717 RGGIRETNDNLKEFLGREPSKEAFLKELGL 746
            GG+ + NDNL++FLGREP+  AFL+ LG 
Sbjct: 658 PGGLYDMNDNLRKFLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  384 bits (987), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 271/417 (64%), Gaps = 9/417 (2%)

Query: 330 ANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIW 389
           A Y L++K AKN + V  FL DL++KLKP +      LK +K+ E +EL   YD   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 390 DHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAG 449
           D  YY+ K L+D F+VD E+ ++Y+P+E TI+ ML  Y T+    F+EET+   ++ W  
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 450 DDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTAL 509
           DD KQ +VWKMDD   P+F GW+YFDLHPR+GK+GH A F    + + ++  R+YPVT+L
Sbjct: 169 DD-KQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSL 227

Query: 510 VCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQM 569
           VCNFS  + +KPALLKH E+  FFHELGHG H L+    +        VP DF+EAPSQM
Sbjct: 228 VCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQM 285

Query: 570 LEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTT 629
           LE+W W K+ +  LSKH +TGE+IPESL++ ++ +K  N A+  L Q+   L DM VH  
Sbjct: 286 LEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKH 343

Query: 630 TDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFA 689
                 + +DL  LWN L E++ L++N  E  + Y SF HI+ + Y+AGYYGY W++VFA
Sbjct: 344 V--GSYETLDLNALWNNLCEDVILIKNP-EPTRAYCSFSHIV-EGYAAGYYGYQWSKVFA 399

Query: 690 TDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGL 746
            DMY+S+F K  L+   G  Y D I+ARGG+ E  DNL EFL REP+ EA+L++ GL
Sbjct: 400 ADMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  197 bits (502), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 140/473 (29%), Positives = 229/473 (48%), Gaps = 46/473 (9%)

Query: 280 FPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMA 339
           F +LK   +P  RK  + A  +   +  +   + +K+R  L   +G + YA Y +D KMA
Sbjct: 291 FLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMA 350

Query: 340 KNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQE-----------LNMAYDDHYYI 388
           KN + V EFL  L D LKP A KE++ +  +   E  E               +D  YY 
Sbjct: 351 KNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYT 410

Query: 389 WDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWA 448
             HR      L D + +D+     YYP+ + IQG+  I+E++  ++F E        TW+
Sbjct: 411 AIHRNKQKHLLLDDYALDV-----YYPLGNVIQGLSDIFESIYGIRF-EPAVAGKGETWS 464

Query: 449 GDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPS---YIDKD------ 499
             DV++L V       K   +G IY DL  R+GK  +AA+F +  S   Y  +D      
Sbjct: 465 S-DVRRLNVVS----EKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQ 519

Query: 500 -------SKRIYPVTALVCNFSAA---TADKPALLKHNEITTFFHELGHGIHDLVGNNGI 549
                  +K   P+ +L+CNF+     + +   LL  NEI T FHE+GH IH ++G   +
Sbjct: 520 LGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRL 579

Query: 550 GRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNG 609
              +G      DFVE PS ++E +  +   L  +  HYKTG+++P +LL   +       
Sbjct: 580 QNVSGT-RCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLK 638

Query: 610 ALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGH 669
                 Q    + D +++       ID++D+V++++ L +E+ ++ + DE N     FGH
Sbjct: 639 DCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEVLVD-DESN-WCAKFGH 696

Query: 670 IMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRE 722
           +    Y A YY Y++    A+ ++   F KDP +   G ++++ +L  GG+RE
Sbjct: 697 LF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  189 bits (479), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 141/516 (27%), Positives = 251/516 (48%), Gaps = 43/516 (8%)

Query: 234 EQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKV-TFKYPDIFPVLKTAKNPNTR 292
           + N  V+  + +  G+  +++ Q E    +    + +K+ T+ Y   F +LK+  +   R
Sbjct: 257 DNNVVVSCNQLDSLGIDPELLSQIE----KDIAGKNYKIPTYGYIP-FALLKSCPSEEIR 311

Query: 293 KIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDL 352
           +  + A  N   E  K   D +KLR  L ++LG  +YA Y L+ KMAKN + V+EF+  L
Sbjct: 312 EKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTL 371

Query: 353 KDKLKPLAEKEIEVLKAIKKT-EAQELNMAYDD---HYYIWDHRYYDNKYLKDKFNVDL- 407
            D  KP+A KE++ +   K T ++   N++  D       WD  YY     +     +L 
Sbjct: 372 MDFTKPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIEREQTSAKNLY 431

Query: 408 --EKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSK 465
             E++ +Y+ + + +QG+  +++ +  +K   +  K +  TW+  +V+++ V   D+   
Sbjct: 432 GSEEVLKYFTLGNVMQGLSNLFQKIYGIKLELDVPK-IGETWS-PEVRKINVISEDEG-- 487

Query: 466 PEFVGWIYFDLHPREGKYGHAANFGMAPSY---------------IDKDSKRI-YPVTAL 509
              +G IY DL  R GK  +AA+F +  S                ID    R   P+ +L
Sbjct: 488 --LIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISL 545

Query: 510 VCNFSA---ATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAP 566
           VCNFS    +  D    L   E+ T FHE+GH +H ++G   +   +G      DFVE P
Sbjct: 546 VCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELP 604

Query: 567 SQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKV 626
           S ++E++  +   L ++ KHY T E +   +LE  +             Q    + D  +
Sbjct: 605 SILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTL 664

Query: 627 HTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAE 686
           H  T  + +D++D+V+L+  L  ++ ++   D+ +     FGH+    YSA YY Y++  
Sbjct: 665 HGETISSHLDHLDVVKLYQDLERQLGVLV--DDKSNWCGKFGHLF--GYSAVYYSYLFDR 720

Query: 687 VFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRE 722
             A+ ++ + F ++P +  SG +YR+ +L  GG R+
Sbjct: 721 AIASKIWGALFERNPFSRASGDKYRNSVLQWGGSRD 756

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  182 bits (463), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 133/476 (27%), Positives = 233/476 (48%), Gaps = 39/476 (8%)

Query: 273 TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTL-KLRYQLGKILGYDTYAN 331
           TF Y   + +L++  + N R   ++A  +   E +   +D L KLR  L  I+G  ++A+
Sbjct: 274 TFGYIP-YSILRSCPDDNIRMKVWSA-LHSCSEKQIARLDQLIKLRSVLANIMGKKSFAH 331

Query: 332 YNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYI--- 388
           Y L+ KMAK  E V  F+  L D  KP A +E++ +  +K         A   H  +   
Sbjct: 332 YQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKAKHVPGNKPAESMHEILEMV 391

Query: 389 --WDHRYYDNKY-LKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKS 445
             WD  +Y + + L+ +   + E+IS Y+ +   IQG+  +++ +  + ++E        
Sbjct: 392 KPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSNLFKQIYGI-YLEPVVPKTGE 450

Query: 446 TWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSY---------- 495
           TW+  +V+++ V       K   +G +Y DL  R+GK  + A+F +  S           
Sbjct: 451 TWS-PEVRRINVVS----EKEGVIGVVYCDLFERQGKTANPAHFTVCCSRQIYDGETDLS 505

Query: 496 ---IDKDSKR---IYPVTALVCNFSAATADKP---ALLKHNEITTFFHELGHGIHDLVGN 546
              + ++SK      PV +LVCNFS  T  +     LL+ +EI T FHE+GH +H ++G 
Sbjct: 506 TIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLSEIETLFHEMGHAMHSMLGR 565

Query: 547 NGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKH 606
             +   +G      DFVE PS ++E +  +   L  ++ HY TGE IPE LL S  +   
Sbjct: 566 TKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVK 624

Query: 607 VNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDS 666
                 A  Q    + D ++H  +   ++  +D+V+L++ L  ++ ++   D+ +     
Sbjct: 625 FLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLERQLEVL--SDDKSNWCGR 682

Query: 667 FGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRE 722
           FGH+    Y A YY Y++    A+ ++   FA DP   +SG ++++ +L  GG R+
Sbjct: 683 FGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGEKFKNSVLKWGGSRD 736

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  179 bits (455), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 134/519 (25%), Positives = 250/519 (48%), Gaps = 51/519 (9%)

Query: 235 QNEFVAFTKEELE--GVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTR 292
           ++EF+    EEL+  GVS  +++Q  T          +KV       + +L++ KN N R
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTTTVRGT----HYKVPAYGTAPYIILRSCKNENAR 315

Query: 293 KIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDL 352
           K  + A  +   +        +K+R  L  I+G   +A Y L  KMAK+ E V+ F+  L
Sbjct: 316 KAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRL 375

Query: 353 KDKLKPLAEKEIEVLKAIK-----------KTEAQELNMAYDDHYYIWDHRYYDNKYLKD 401
            +  KP+A +E+++L  +K           + E  E    +D  YY+   +    +  K+
Sbjct: 376 MEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYV--AKSQQTRKAKN 433

Query: 402 KFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMD 461
           +   + E I+ Y+ + S ++G+  +++++  +  +E        TW+ + V+++ V   +
Sbjct: 434 QL-TNHEPINAYFTLGSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSE-VRRVNVKTEN 490

Query: 462 DPSKPEFVGWIYFDLHPREGKYGHAANFGMAPS---YIDKDSKRIY-------------P 505
           +      +G +Y DL  R+ K    A+F +  S   Y +++   I              P
Sbjct: 491 N----NIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLP 546

Query: 506 VTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEA 565
           + +LVCNF+  + ++  LL+ +EI T FHE+GH +H ++G   +   +G      DFVE 
Sbjct: 547 IISLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVEL 605

Query: 566 PSQMLEFWTWNKNELLSLSKHYKTGEKIPESLL-ESLIATKHV-NGALFALRQLHFGLFD 623
           PS ++E +  +   L  + +HY T EK+PE LL E L +T+++ N   FA  Q    + D
Sbjct: 606 PSIIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLD 663

Query: 624 MKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYM 683
            +++       + ++D+V+L++ L   + ++   D+       FGH+    Y A YY Y+
Sbjct: 664 QRLYDNNIIFHVRDLDVVELYHDLERNLEVLV--DDQTNWCGKFGHLF--GYGATYYSYL 719

Query: 684 WAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRE 722
                A  ++   F  DP +   G  +++ +L  GG+R+
Sbjct: 720 LDRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGLRD 758

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  179 bits (453), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 130/481 (27%), Positives = 229/481 (47%), Gaps = 37/481 (7%)

Query: 268 QKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYD 327
           + +K+    P  + VLK  KN   R   + A  +   E        +KLR  L  ++G +
Sbjct: 277 ENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVKLRAMLANLMGAE 336

Query: 328 TYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYY 387
           +++ Y L  K+AK  + V  F+  L   ++P  EKE++ +  +K+ +  ++N    D   
Sbjct: 337 SFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKREDQGKINCGEMDGVL 396

Query: 388 I----WDHRYYDNKYLKDKFNVD---LEKISEYYPVESTIQGMLKIYETVMNLKFIEETD 440
                WD  YY + Y K K   +    E +S Y+ +    +G+  +   +  +K +E   
Sbjct: 397 STVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDLLTQIYGIK-LEPAI 455

Query: 441 KDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPS---YID 497
                TW  +DV+++ V   ++      +G IYFDL  R GK  + A+F +  S   Y +
Sbjct: 456 PVSGETWF-NDVRKINVISEEEG----IIGIIYFDLFERYGKTSNPAHFTVCCSREMYPE 510

Query: 498 KDSKRI-------------YPVTALVCNFSAAT--ADKP-ALLKHNEITTFFHELGHGIH 541
           +++  I              P+ +LVCNFS  T  +DK   LL  +EI T FHE+GH IH
Sbjct: 511 ENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIETLFHEMGHAIH 570

Query: 542 DLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESL 601
            ++G   +   +G      DFVE PS ++E +  +   L  +S HY+TGEKI E  L+  
Sbjct: 571 SMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETGEKIAEKKLQFH 629

Query: 602 IATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMN 661
           +       +     Q    + D ++H+    + +DN+++V+++  L   + ++   D+ +
Sbjct: 630 LKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERRLQVLV--DDRS 687

Query: 662 KGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIR 721
                FGH+    Y A YY Y++    A  ++   FA DP N  +G ++++ +L  GG +
Sbjct: 688 NWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKFKESLLKWGGSK 745

Query: 722 E 722
           +
Sbjct: 746 D 746

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 232/497 (46%), Gaps = 70/497 (14%)

Query: 268 QKFKV-TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGY 326
           Q +KV TF Y   + +LK+ +    RK  + A  +   +  K     +KLR  L  ++  
Sbjct: 276 QNYKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMHK 334

Query: 327 DTYANYNLDIKMAKNQETVMEFLVDL--------------------KDKLKPLAEKEIEV 366
            +YA Y L+ KMAKN + V +F++ L                    KD  KPLA K  E+
Sbjct: 335 GSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDEI 394

Query: 367 LKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLK-DKFNVDLEK-ISEYYPVESTIQGML 424
           LK ++                 WD  YY  KYL+ +  N    K IS Y+ + + IQG+ 
Sbjct: 395 LKLVRP----------------WDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVIQGLS 438

Query: 425 KIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYG 484
            +++ +  +K +E    D   TW+  DV++L V   ++      +G IY DL  R GK  
Sbjct: 439 DLFQHIYGIK-LEPAIADEGETWS-PDVRRLNVISEEEG----IIGIIYCDLFERSGKTS 492

Query: 485 HAANFGMA------PSYIDKDSKRI----------YPVTALVCNFSA---ATADKPALLK 525
           + A+F +       P+  D  + ++           PV +LVCNF+    A+      L+
Sbjct: 493 NPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFLQ 552

Query: 526 HNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSK 585
            +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L  + K
Sbjct: 553 LSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIGK 611

Query: 586 HYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWN 645
           HY+TGE +   +L+S + T +         Q    + D   H     + IDN D+V+ + 
Sbjct: 612 HYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNYQ 671

Query: 646 GLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTK 705
            L   + ++   D+ +     FGH+    Y A YY Y++    A+ ++Y+ F  DP + K
Sbjct: 672 ALERRLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRK 727

Query: 706 SGIEYRDIILARGGIRE 722
           +G +++  +L  GG+++
Sbjct: 728 NGDKFKKHLLKWGGLKD 744

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  177 bits (450), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 139/534 (26%), Positives = 258/534 (48%), Gaps = 58/534 (10%)

Query: 235 QNEFVAFTKEELE--GVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTR 292
           ++++V    +EL+  GVS  ++ Q           Q +KV       F +L++  N N R
Sbjct: 242 RSDYVKIPCKELDSSGVSTLLLNQL----SRDLKNQNYKVPAYGYAAFSILRSCPNENVR 297

Query: 293 KIAFNADQNKVPENEKLFIDTLK----LRYQLGKILGYDTYANYNLDIKMAKNQETVMEF 348
              + A  +  PE +   I  LK    LR  L  I+G  +YA Y L  KMAK+   V  F
Sbjct: 298 MKIWTA-MHSCPEKQ---ISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGF 353

Query: 349 LVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYI-----WDHRYYD--NKYLKD 401
           +  L D  KPLA +E+ VL  +K      +N+   D   +     WD  +Y   N   + 
Sbjct: 354 VQSLVDVTKPLAAEELRVLAKLKSGHLG-VNVPQSDADVLRFVRPWDRDFYSTLNALQQQ 412

Query: 402 KFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMD 461
           +  ++ E IS Y+ + + +QG+ +++E +  ++ +E        TW+  +V+++ V    
Sbjct: 413 RKTLENEHISSYFSLGTVMQGLSRLFEDIYGIR-LEPVVAKAGETWS-PEVRRINVVS-- 468

Query: 462 DPSKPEFVGWIYFDLHPREGKYGHAANFGMA------PSYIDKDSKRI----------YP 505
              K   +G +Y DL  R+GK  + A+F +       P   D  + ++           P
Sbjct: 469 --EKEGIIGVVYCDLFERQGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLP 526

Query: 506 VTALVCNFSAATADKP--ALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFV 563
           V +LVC+F+  +A +    LL+ +++ T FHE+GH +H ++G   +   +G      DFV
Sbjct: 527 VISLVCSFAQNSASRQGVCLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFV 585

Query: 564 EAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFD 623
           E PS ++E +  +   L  + +HY T + IP  LL+      +         Q    + D
Sbjct: 586 ELPSILMEHFARDSRVLSRIGRHYATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLD 645

Query: 624 MKVHTT---TDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYY 680
            ++H++   TD      +D+V+L++G+ +++ ++   D+ +     FGH++   Y A YY
Sbjct: 646 QELHSSKALTD----GKLDVVKLYHGVEKDMEVL--ADDQSNWCGRFGHLL--GYGASYY 697

Query: 681 GYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGRE 734
            Y++    A+ ++   FA+DP N ++G ++++ +L  GG ++  + + + L R+
Sbjct: 698 SYLFDRAIASKIWQHLFAEDPFNRENGEKFKESVLKWGGSKDPWECVADALDRK 751

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 138/507 (27%), Positives = 230/507 (45%), Gaps = 53/507 (10%)

Query: 245 ELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVP 304
           E  G S  V++Q    T +  G   +K+       + +L    +   R+  + A  +   
Sbjct: 265 ESSGTSHLVLRQL---TKDTMG-NNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSE 320

Query: 305 ENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEI 364
           +  K     L+LR +L  I+G   Y +Y L+ KMAK+ E V  FL  L D  KPLA  E+
Sbjct: 321 KQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGEL 380

Query: 365 EVLKAIKK-----TEAQELNMAYDDHYYIWDHRYYDN---KYLKDKFNVD-LEKISEYYP 415
           E L  +K+     +E   L +        WD  YY +    + +    VD    I+ Y+ 
Sbjct: 381 EELAKLKRNVENLSETNTLKLMRP-----WDRDYYSSLSPNFTRPNHRVDGFTSINTYFS 435

Query: 416 VESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFD 475
           +   +QG+  ++  +  +  ++        TWA  DV++L V    +      +G IY D
Sbjct: 436 LGVVMQGISDLFRDIYGIS-LKPVVAQAGETWA-PDVRKLQVISETEG----IIGLIYCD 489

Query: 476 LHPREGKYGHAANFGMAPSYI---------------DKDSKRI-YPVTALVCNFSAATAD 519
           L  R GK    ++F +  S                 + D  R   PV +L+CNF A    
Sbjct: 490 LLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHG 549

Query: 520 KP---ALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWN 576
           K     LL+ +++ T FHE+GH +H ++G   +   +G   V  DFVE PS ++E +  +
Sbjct: 550 KNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKD 608

Query: 577 KNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQID 636
           +  LL +S +Y TGE IPE LL +     +         Q+   + D ++H+ TD +   
Sbjct: 609 RRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD--- 665

Query: 637 NMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSK 696
             D++ +++GL  E+ ++   D+       FGH+    Y A YY Y+     A  ++   
Sbjct: 666 --DIIAVYHGLEREMEVLV--DDQTNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHL 719

Query: 697 FAKDPLNTKSGIEYRDIILARGGIRET 723
           F KDP +  SG ++++ +L  GG R+ 
Sbjct: 720 FKKDPFSRSSGEKFKEGVLKWGGSRDA 746

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 135/499 (27%), Positives = 235/499 (47%), Gaps = 74/499 (14%)

Query: 268 QKFKV-TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGY 326
           Q +K+ TF Y   + +LK+ +    RK  + A  +   +  K     +KLR  L  ++  
Sbjct: 273 QNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNK 331

Query: 327 DTYANYNLDIKMAKNQETVMEFLVDL--------------------KDKLKPLAEKEIEV 366
           ++YA Y L+ KMAKN + V +F++ L                    KD  KPLA K  ++
Sbjct: 332 ESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDLKKPLATKTDDI 391

Query: 367 LKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLK----DKFNVDLEKISEYYPVESTIQG 422
           L+ ++                 WD  YY  KYL+    D  N   ++IS Y+ + + I+G
Sbjct: 392 LRLVRP----------------WDRDYYTGKYLQLNPSDAPNA--KEISYYFTLGNVIEG 433

Query: 423 MLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGK 482
           +  +++ +  ++ +E    D   TW+  DV++L V   ++      +G IY DL  R GK
Sbjct: 434 LSDLFQHIYGIR-LEPEIADEGETWS-PDVRRLNVISEEEG----IIGIIYCDLFERNGK 487

Query: 483 YGHAANFGMA------PSYIDKDSKRI----------YPVTALVCNFSA---ATADKPAL 523
             + A+F +       P+  D  + ++           PV +LVCNF+    A+      
Sbjct: 488 TSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCF 547

Query: 524 LKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSL 583
           L+ +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L  +
Sbjct: 548 LQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKI 606

Query: 584 SKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQL 643
           SKHY+TGE I   +L+S + T +         Q    + D   H     + IDN D+V+ 
Sbjct: 607 SKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKN 666

Query: 644 WNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLN 703
           +  L   + ++   D+ +     FGH+    Y A YY Y++    A+ ++Y+ F  DP +
Sbjct: 667 YQALERRLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYS 722

Query: 704 TKSGIEYRDIILARGGIRE 722
            K+G +++  +L  GG+++
Sbjct: 723 RKNGDKFKKHLLKWGGLKD 741

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  176 bits (445), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 134/484 (27%), Positives = 231/484 (47%), Gaps = 44/484 (9%)

Query: 268 QKFKV-TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGY 326
           Q +KV TF Y   + +LK+ +N   RK  + A  +   +  K     +KLR  L  ++  
Sbjct: 273 QNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHK 331

Query: 327 DTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDH- 385
            +YA Y L+ KMAKN + V +F++ L   +    EK    LK I + +A++L      + 
Sbjct: 332 TSYAEYQLEGKMAKNPKDVQDFILTL---MNNTIEKTANELKFIAELKAKDLKKPLTTNT 388

Query: 386 ------YYIWDHRYYDNKY--LKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIE 437
                    WD  YY  KY  L    + + ++IS Y+ + + IQG+  +++ +  ++ +E
Sbjct: 389 DEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQIYGIR-LE 447

Query: 438 ETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMA----- 492
               D   TW+  DV++L V   ++      +G IY DL  R GK  + A+F +      
Sbjct: 448 PAITDEGETWS-PDVRRLNVISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQI 502

Query: 493 -PSYIDKDSKRI----------YPVTALVCNFSA---ATADKPALLKHNEITTFFHELGH 538
            PS  D  + ++           PV +LVCNFS    A+      L+ +E+ T FHE+GH
Sbjct: 503 YPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLFHEMGH 562

Query: 539 GIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLL 598
            +H ++G   +   +G      DFVE PS ++E +  +   L  + KHY TGE I   +L
Sbjct: 563 AMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETIQADML 621

Query: 599 ESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGD 658
           +  + + +         Q    + D   H     + IDN D+V+ +  L   + ++   D
Sbjct: 622 QRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKVLV--D 679

Query: 659 EMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARG 718
           + +     FGH+    Y A YY Y++    A+ ++Y+ F  DP + K+G +++  +L  G
Sbjct: 680 DQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWG 737

Query: 719 GIRE 722
           G+++
Sbjct: 738 GLKD 741

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  175 bits (444), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 147/568 (25%), Positives = 260/568 (45%), Gaps = 49/568 (8%)

Query: 197 KDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLG-EQNEFVAFTKEELEGVSDDVMK 255
           +D+ +SG+ +S              +L    F  N    + +++    +E +   D    
Sbjct: 207 EDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPAL 266

Query: 256 QFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRK---IAFNADQNKVPENEKLFID 312
           +++   D      K     K P  +  L   K+   RK   +AF++  NK  E       
Sbjct: 267 KYKLSKDLSGKYYKIPTYGKIP--YTALLKCKDEELRKKLWVAFHSCSNKQIER---LTK 321

Query: 313 TLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKK 372
            +K R +L K+L   +Y+ Y L+ KMAK  + V  FL  L   + P   KE+E +   KK
Sbjct: 322 IIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKELEPISN-KK 380

Query: 373 TEAQELNMAYDDHYYI-----WDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIY 427
             ++  ++   +   +     WD  YY+      +    +  I EY+ + + I G+  ++
Sbjct: 381 CLSEGFSLETSEQSILNNIKPWDRDYYNPIQATSEGAYQM-LIMEYFTLGNIIHGLSNLF 439

Query: 428 ETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAA 487
            ++  ++F E    +   TW+  DV++L V   D+      +G IY DL  REGK    +
Sbjct: 440 NSIYGIRF-EPGKIEDGETWS-KDVRKLNVISEDEG----LIGVIYCDLFEREGKSESPS 493

Query: 488 NFGMAPSY---------------IDKDSKRIY--PVTALVCNFSAATAD---KPALLKHN 527
           ++ +  S                ++  + + +  P+ +LVCNF    A    +   L+H+
Sbjct: 494 HYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHH 553

Query: 528 EITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHY 587
           EI T FHE+GH +H ++G       +G   V  DFVE PS ++EF+  N   L+ +S+HY
Sbjct: 554 EIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHY 612

Query: 588 KTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGL 647
            +GE I   +L   +       A     Q    L D ++H   + N +DN+D+V++++ L
Sbjct: 613 DSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLH-AENANSLDNIDVVEIYHNL 671

Query: 648 REEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSG 707
            +E+S++ + +    G   FGH+    Y A YY Y++    AT ++ S F  DP + K G
Sbjct: 672 EKELSVLPDTESNWCG--RFGHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGG 727

Query: 708 IEYRDIILARGGIRETNDNLKEFLGREP 735
             +++ +L  GG ++    + + LG EP
Sbjct: 728 NIFKEQLLKWGGSKDPWKCVADVLG-EP 754

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  175 bits (443), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 125/465 (26%), Positives = 220/465 (47%), Gaps = 37/465 (7%)

Query: 282 VLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKN 341
           +LK+  + + RK  + A  N      +     ++LR  L  +LG  +Y++Y LD KMA +
Sbjct: 277 ILKSCPDEDIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGS 336

Query: 342 QETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYI---WDHRYYDNKY 398
            E V  F+  L +  KPLA +E+E +   K       +M+ ++   I   WD  Y+ +KY
Sbjct: 337 PENVKGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKY 396

Query: 399 LKDK--FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLA 456
             D     +  E++  Y+ + + I G+ ++++ +  +  ++ +  +   TW+ D      
Sbjct: 397 DSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGIT-LQPSRTENGETWSPD------ 449

Query: 457 VWKMDDPSKPE-FVGWIYFDLHPREGKYGHAANFGMAPS---YIDKDSKRI--------- 503
           V ++D  S+ E  VG IY DL  R GK  + A+F +  S   Y D++             
Sbjct: 450 VRRLDVISEEEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDG 509

Query: 504 ----YPVTALVCNFSAAT---ADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPG 556
                PV +LVCNFS       ++   L  NEI T FHE+GH +H ++G   +   +G  
Sbjct: 510 TVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTR 569

Query: 557 AVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQ 616
               DFVE PS ++E +  +   L ++  HY+T E  PE+LL   +             Q
Sbjct: 570 CAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQ 628

Query: 617 LHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYS 676
               + D K+H +   + I+ +D  +++  L   + ++   D+ +     FGH+    Y 
Sbjct: 629 AKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVL--ADDESNWCGRFGHLF--GYG 684

Query: 677 AGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIR 721
           A YY Y++    A+ ++ S F  DP N   G ++++ +L  GG++
Sbjct: 685 ATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGLK 729

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  173 bits (439), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/471 (25%), Positives = 226/471 (47%), Gaps = 40/471 (8%)

Query: 280 FPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTL-KLRYQLGKILGYDTYANYNLDIKM 338
           + VL+   +   RK  + A  +  P+ + + +D L +LR  L  ++G  +YA Y L+ KM
Sbjct: 297 YSVLRACPDEIVRKKLWTA-MHSCPDKQIVRLDQLVRLRAVLAFLMGKKSYAEYQLEGKM 355

Query: 339 AKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTE-----AQELNMAYDDHYYIWDHRY 393
           AK+ E V +F+  L    +P A++E+  +  +K+       ++  N+   D    WD  +
Sbjct: 356 AKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKHMDLPPSETSNLDTLDIVRPWDRDF 415

Query: 394 YDNKY---LKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGD 450
           Y   Y    + +  +D ++IS Y+ + + +QG+  ++  +  ++ +E        TW+  
Sbjct: 416 YHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGLSDLFHQIYGIR-LEPVIAQKGETWS-P 473

Query: 451 DVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSY--------------- 495
           +V++L V   ++      +G +Y DL  R+GK  + ++F +  S                
Sbjct: 474 EVRRLNVVSDEEG----VIGVVYCDLFERDGKTSNPSHFTVCCSRQIYPKENDLSTIQIG 529

Query: 496 IDKDSKRI-YPVTALVCNFSAAT---ADKPALLKHNEITTFFHELGHGIHDLVGNNGIGR 551
            +KD  +   P+ +LVCNF+++         LL  +EI T FHE+GH +H ++G   +  
Sbjct: 530 TNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLHISEIETLFHEMGHAMHSMLGRTRLQN 589

Query: 552 FNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGAL 611
            +G      DFVE PS ++E +  +   L  + KH  TGE +PESLL + +         
Sbjct: 590 LSGTRCAT-DFVELPSILMEHFARDTRVLRQIGKHCNTGEPVPESLLTNYLQDLQYMQYC 648

Query: 612 FALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIM 671
               Q    + D ++H       +D +D+V L+  L  E+ ++   D+ +     FGH+ 
Sbjct: 649 ETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQNLERELRVLV--DDQSTWCGRFGHLF 706

Query: 672 SDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRE 722
              Y A YY Y++    A+ ++ S F +DP +   G  +++ +L  GG ++
Sbjct: 707 --GYGATYYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKEYVLKWGGAKD 755

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 144/579 (24%), Positives = 279/579 (48%), Gaps = 70/579 (12%)

Query: 197 KDYVRSGLNLSXXXXXXXXXXXXXXALNSLQFSKNLG-EQNEFVAFTKEELE--GVSDDV 253
           +D+ +SG++++              ++   +F  N    ++E+V  +  ELE  G+S  +
Sbjct: 204 EDFEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLL 263

Query: 254 MKQFETYTDEQTGEQKFKV-TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFID 312
           +     +    T  Q +KV T+ Y   F +L++  + N R   + A  +  PE +   + 
Sbjct: 264 L----NHLSRDTKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTA-VHSCPEKQITRLK 317

Query: 313 TL-KLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIK 371
            L KLR  L +I+G ++Y++Y L+ KMAK+   V  F+  L + +KPLA +E+  L  +K
Sbjct: 318 HLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLK 377

Query: 372 KTEAQELNMAYDDHYYI-----WDHRYYDN--KYLKDKFNVDLEKISEYYPVESTIQGML 424
            +   +L +   D   +     WD  +Y       + +  ++ E+I+ Y+ + + +QG+ 
Sbjct: 378 SSHL-DLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLS 436

Query: 425 KIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYG 484
            + E +  ++ +E     +  TW+  +V+++ V       +   +G +Y DL  R+GK  
Sbjct: 437 SLLEDIYGIR-LEPAVAKVGETWS-PEVRRINVVS----DQEGVIGVVYCDLFERQGKTS 490

Query: 485 HAANFGMA------PSYIDKDSKRI-----------YPVTALVCNFSAATADKP--ALLK 525
           + A+F +       P   D  + ++            PV +LVC+FS  +  K    LL+
Sbjct: 491 NPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQ 550

Query: 526 HNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSK 585
            +E+ T FHE+GH IH ++G   +   +G      DFVE PS ++E +  +   L  + K
Sbjct: 551 LSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFAHDSRVLSRIGK 609

Query: 586 HYKTGEKIPESLLESLIATKHVNGALF-------ALRQLHFGLFDMKVHTT---TDDNQI 635
           HY T E +P+ LL       H+N              Q    + D ++H+    TD    
Sbjct: 610 HYITNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTD---- 658

Query: 636 DNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYS 695
             +D+V++++ + +++ ++   D+ +     FGH++   Y A YY Y++    A+ ++  
Sbjct: 659 GPVDVVEIYHEVEKQMGVLT--DDKSNWCGRFGHLL--GYGASYYSYLFDRAIASKVWQH 714

Query: 696 KFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGRE 734
            FA DP + KSG ++++ +L  GG R+  + + + L ++
Sbjct: 715 LFANDPFSRKSGEKFKNSVLRWGGSRDPWNCIADALDKQ 753

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 134/502 (26%), Positives = 239/502 (47%), Gaps = 45/502 (8%)

Query: 245 ELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVP 304
           E  GVS  V++Q    + + +G+     T+ Y   + +++T  +   RK  + A     P
Sbjct: 262 EASGVSQMVLQQL---SKDLSGKFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCP 316

Query: 305 ENE-KLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKE 363
           E + K     ++LR QL  I+G   YA Y L+ KMAK+ + V  F+  L +  KPLA +E
Sbjct: 317 EKQIKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEE 376

Query: 364 IEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYL----KDKFNVDLEKISEYYPVEST 419
           ++ L  +K     +           WD  Y+ +  L    +    +  + ++ Y+ +   
Sbjct: 377 LKPLADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVV 436

Query: 420 IQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPR 479
           IQG+  +++++  ++ +E        TW   +V+++ V    +      +G IY DL  R
Sbjct: 437 IQGLSDLFQSIYGIR-LEPVVAKTGETW-DPEVRKIQVISEANG----VIGVIYCDLFER 490

Query: 480 EGKYGHAANFGMAP-----------------SYIDKDSKRIYPVTALVCNFSAATA--DK 520
           +GK  + A+F +                   S+ DK SK   PV +LVCNFS   A  D 
Sbjct: 491 QGKTPNPAHFTVCCSRQIYPNETDYSTIQVGSHPDK-SKFQMPVISLVCNFSHTQADDDS 549

Query: 521 PALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNEL 580
             LL+ +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L
Sbjct: 550 ICLLQLSEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVL 608

Query: 581 LSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDL 640
             +S HY TGE++P+ +L +               Q+   + D ++H+ TD+++    D+
Sbjct: 609 SRISSHYATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSE----DI 664

Query: 641 VQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKD 700
           V +++GL +E+ ++   D+ +     FGH+    Y A YY Y+     A  ++   F  D
Sbjct: 665 VTVYHGLEKELQVLV--DDRSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHD 720

Query: 701 PLNTKSGIEYRDIILARGGIRE 722
           P +   G ++++ +L  GG R+
Sbjct: 721 PFSRAGGEKFKNSVLKWGGSRD 742

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 135/497 (27%), Positives = 228/497 (45%), Gaps = 70/497 (14%)

Query: 268 QKFKV-TFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGY 326
           Q +KV TF Y   F +LK+ +    RK  + A  +   +  K     +KLR  L  ++  
Sbjct: 273 QNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHK 331

Query: 327 DTYANYNLDIKMAKNQETVMEFLVDL--------------------KDKLKPLAEKEIEV 366
            +YA Y L+ KMAKN + V +F++ L                    KD  KPL     E+
Sbjct: 332 GSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEI 391

Query: 367 LKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLK-DKFNVDLEK-ISEYYPVESTIQGML 424
           LK ++                 WD  YY  KY++ +  NV   K IS Y+ + + IQG+ 
Sbjct: 392 LKLVRP----------------WDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLS 435

Query: 425 KIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYG 484
            +++ +  ++ +E    D   TW+  DV++L V   ++      +G IY DL  R GK  
Sbjct: 436 DLFQQIYGIR-LEPAIADEGETWS-PDVRRLNVISEEEG----IIGIIYCDLFERNGKTS 489

Query: 485 HAANFGMA------PSYIDKDSKRI----------YPVTALVCNFSA---ATADKPALLK 525
           + A+F +       P   D  + ++           PV +LVCNFS    A+      L+
Sbjct: 490 NPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQ 549

Query: 526 HNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSK 585
            +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L  + K
Sbjct: 550 LSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGK 608

Query: 586 HYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWN 645
           HY+TGE I + +L+  + T +         Q    + D   H     + IDN ++V  + 
Sbjct: 609 HYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQ 668

Query: 646 GLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTK 705
            L   + ++   D+ +     FGH+    Y A YY Y++    A+ ++Y+ F  DP +  
Sbjct: 669 ALERHLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRN 724

Query: 706 SGIEYRDIILARGGIRE 722
           +G +++  +L  GG+++
Sbjct: 725 NGDKFKKHLLKWGGLKD 741

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  167 bits (423), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 120/438 (27%), Positives = 221/438 (50%), Gaps = 44/438 (10%)

Query: 314 LKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKT 373
           +KLR  L  +L   ++A Y L+ KMAK  + V +F+  L D ++P A +E++ +  +K  
Sbjct: 320 VKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADLK-- 377

Query: 374 EAQELNMAYDDHYYI-------WDHRYYDNKYLKDKFNVDL---EKISEYYPVESTIQGM 423
             +ELN+   D           WD  YY   + K K +V+L     I+ Y+ + + ++G+
Sbjct: 378 -CKELNIPTSDSTTAILDLISPWDREYYTTIHSKAK-DVNLYENHPINMYFTMGNIMKGL 435

Query: 424 LKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKY 483
             I++ +  ++ +E    +   TW+  +V++L V    +      +G +Y DL  R GK 
Sbjct: 436 SHIFQRIYGIR-LEAVVPEEGETWS-PEVRRLNVISETE----GLIGVVYCDLFERAGKT 489

Query: 484 GHAANFGMAPS---YIDKDSKRI-------------YPVTALVCNFSAA--TADKP-ALL 524
            + A+F +  S   Y D++                  PV +LVCNFS+   + DK   LL
Sbjct: 490 SNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLL 549

Query: 525 KHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLS 584
           + NEI T FHE+GH +H ++G + +   +G      DFVE PS ++E +  +K  L  + 
Sbjct: 550 QLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEIG 608

Query: 585 KHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLW 644
            HY+T E++ E ++E+ +             Q    + D ++++      +D++D+V+++
Sbjct: 609 FHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKIY 668

Query: 645 NGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNT 704
             L E++ ++   D  +     FGH+    Y A YY Y++    A+ ++   FAKDP + 
Sbjct: 669 QTLEEDLKVLV--DNKSNWCGKFGHLFG--YGASYYSYLFDRAIASKVWDQLFAKDPFSR 724

Query: 705 KSGIEYRDIILARGGIRE 722
           + G ++++ +L  GG+R+
Sbjct: 725 EGGEKFKNCVLKWGGLRD 742

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 134/486 (27%), Positives = 234/486 (48%), Gaps = 44/486 (9%)

Query: 265 TGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKIL 324
           TG+  +K+    P  + +L    N   RK  +    +   E  +     + LRY+L K+L
Sbjct: 292 TGKH-YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLL 350

Query: 325 GYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAY-D 383
              ++A Y L  KMAKN E V +F+  L D  KPLA KE+  L  +K   A +L +A+ +
Sbjct: 351 KKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVK---AADLGLAFKN 407

Query: 384 DHYYI------WDHRYYD--NKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKF 435
           D  +I      WD  YY   N+Y   +   DL ++  Y+ + + I G+  ++  +  ++F
Sbjct: 408 DSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRF 467

Query: 436 IEETDKDLKSTWAGDDVKQLAVWKMDDPSKPE-FVGWIYFDLHPREGKYGHAANFGMAPS 494
            E     L+ TW  +      V K++  S+ E  +G +Y DL  R  K  +AA+F +  S
Sbjct: 468 -ELAVPKLEETWLPE------VRKLNVISESEGLIGIVYCDLFERPSKKTNAAHFTICCS 520

Query: 495 Y------------IDKDSKR---IYPVTALVCNFSAA---TADKPALLKHNEITTFFHEL 536
                        +  +SK      P+ +L+CNFS +     + P  L+ +EI T FHE+
Sbjct: 521 REIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLFHEM 580

Query: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596
           GH +H ++G   +   +G      DFVE PS ++E +  +   + S+S HY + E     
Sbjct: 581 GHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHYISQEPASPE 639

Query: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656
           LL++ + +      L    Q    + D  +H+        ++++V+ +N L +++ L   
Sbjct: 640 LLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLELF-- 697

Query: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716
            D+ +     FGH+    Y A YY Y++    A+ ++ S F ++P +  SG++++D +L 
Sbjct: 698 SDDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDSVLR 755

Query: 717 RGGIRE 722
            GG R+
Sbjct: 756 WGGSRD 761

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  162 bits (409), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 116/441 (26%), Positives = 214/441 (48%), Gaps = 50/441 (11%)

Query: 314 LKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIK-K 372
           L+LR  L K++G +++A Y L+ KMA+  + V +F+  L + ++P   +E++ +  +K K
Sbjct: 332 LRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSK 391

Query: 373 TEAQELNMAYDDH-----YYIWDHRYYDNKY-LKDKFN-VDLEKISEYYPVESTIQGMLK 425
            E +E+  +  +         WD  YY + Y L+ + + +D E+IS Y+ + + IQG+  
Sbjct: 392 QEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSD 451

Query: 426 IYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGH 485
           ++E++  ++ +E        T++  +V++L V       +   +G +Y DL  R GK  +
Sbjct: 452 LFESIYGIR-LEPVVPKTGETFS-PEVRRLNVV----CEQEGVIGVVYCDLFERAGKTSN 505

Query: 486 AANFGMAPSYIDKDSKRIY----------------------PVTALVCNFSAAT---ADK 520
            ++F +        S++IY                      PV ALVCNFS++T      
Sbjct: 506 PSHFTVCC------SRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKS 559

Query: 521 PALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNEL 580
             LL+ NE+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L
Sbjct: 560 ICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVRVL 618

Query: 581 LSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDL 640
             + KH++TG  I E LL + +             Q    + D  +H        D+ D+
Sbjct: 619 ERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDV 678

Query: 641 VQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKD 700
              +  L  ++ ++   D+ +     FGH+    Y A YY Y++    A+ ++ S F+ D
Sbjct: 679 TAAYQQLERDMKVLV--DDKSNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSD 734

Query: 701 PLNTKSGIEYRDIILARGGIR 721
           P +  +G ++++ +L  GG R
Sbjct: 735 PYSRVNGEKFKECVLKWGGSR 755

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  154 bits (388), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 120/441 (27%), Positives = 208/441 (47%), Gaps = 45/441 (10%)

Query: 314 LKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKT 373
           + LR +L K+LG   +A Y L  KMAK  E V  FL  L    +  A  E++ L A+ K+
Sbjct: 320 ISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPL-AVLKS 378

Query: 374 EAQELNMAYDDHYYI-----WDHRYYDN-KYLKDKFNVDL---EKISEYYPVESTIQGML 424
           E       +     +     WD  YY + + L  + +  L   E IS  + +   +QG+ 
Sbjct: 379 ELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVMQGLS 438

Query: 425 KIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYG 484
            ++E +  +K +  T K    TW+  DV+++ V    D      +G +Y DL  REGK  
Sbjct: 439 DLFEKIYGIKLVPATPKT-GETWS-PDVRRIDVVDEHDG----LIGVMYCDLFEREGKTP 492

Query: 485 HAANFGMAPS---YIDK-DSKRI------------YPVTALVCNFSAATAD-------KP 521
           + A+F +  S   Y+++ D+  I             PV +LVC+F     +       + 
Sbjct: 493 NPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQM 552

Query: 522 ALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELL 581
            LL+ NEI T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L 
Sbjct: 553 CLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVLS 611

Query: 582 SLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLV 641
           S+S HYKTG+ +   +L++               Q+     D ++H   D     ++D++
Sbjct: 612 SISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELH-NLDHTTDGSIDVI 670

Query: 642 QLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDP 701
            +++ L   ++++   D+ +     FGH+    Y A YY Y++    A+ ++   F +DP
Sbjct: 671 AIYHRLERRLAVLP--DDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKIWDHLFEQDP 726

Query: 702 LNTKSGIEYRDIILARGGIRE 722
            N  +G ++++ +L  GG R+
Sbjct: 727 FNRTNGTKFKEGLLQWGGSRD 747

>CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} similar
            to uniprot|P52593 Saccharomyces cerevisiae YML103c NUP188
            nuclear pore protein
          Length = 1670

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 222  ALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFET----YTDEQTGEQKFKVTFKYP 277
            A N+   ++NL E N+F+     +LE + D  +    +     T ++  ++++K+  +  
Sbjct: 1040 AFNTWSNARNLDEDNDFIVSLLNKLENLMDATVGTNSSDDSQVTHDKELKRRYKLIARIV 1099

Query: 278  DIFPV-LKTAKNPNTRKIAFNADQNKVPENEKLFI 311
            +IF + + T+KNPN+  ++       VP  +K F+
Sbjct: 1100 EIFALYIFTSKNPNSDLMSLLESDKIVPHLQKFFL 1134

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 19/84 (22%)

Query: 525 KHNEITTFFHE----LGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNEL 580
           K +E+T F  E      H  ++      IGR  GPG VP DFV                +
Sbjct: 173 KSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV---------------SI 217

Query: 581 LSLSKHYKTGEKIPESLLESLIAT 604
           + +S  Y TG  + E +L   + T
Sbjct: 218 VDISTGYATGSDVKEDILNCNLPT 241

>Suva_7.134 Chr7 complement(263981..265441) [1461 bp, 486 aa] {ON}
           YGL129C (REAL)
          Length = 486

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 665 DSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRD--IILARGGIRE 722
           D+F   ++ S+SA Y      +V++ D+   K   D ++ ++    R+   ILA  G+  
Sbjct: 328 DNFSKFLTTSFSA-YRNTQNKQVYSLDLQMGKLIMDIISGETNFANRESSTILAISGVDR 386

Query: 723 TNDNLKEFLGREPS 736
           TN  L   LG+ P+
Sbjct: 387 TNKTLPVALGKIPA 400

>Kpol_416.7 s416 (29908..30939) [1032 bp, 343 aa] {ON}
           (29908..30939) [1032 nt, 344 aa]
          Length = 343

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 56  EAAFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMV 94
           + +F    ++P + F P++ L DAK  ++TS +F N M+
Sbjct: 186 QVSFKLSTVNPVFVFGPQKFLEDAKGTLNTSCEFVNQMI 224

>SAKL0D11220g Chr4 (931648..933747) [2100 bp, 699 aa] {ON} similar
           to uniprot|P39992 Saccharomyces cerevisiae YEL023C
           Hypothetical ORF
          Length = 699

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 34  IGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKW 68
           + + HQ  +GL  Y +S  + N+ +F++P L  KW
Sbjct: 332 VSVTHQRVEGLFKYDSSPSRRNDTSFVSPDLVEKW 366

>Smik_7.142 Chr7 complement(261679..263031) [1353 bp, 450 aa] {ON}
           YGL129C (REAL)
          Length = 450

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 665 DSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLN--TKSGIEYRDIILARGGIRE 722
           D+F  +++ +YSA Y      ++++ ++   K   D ++  TK       +ILA  G+  
Sbjct: 292 DNFSKLLTTAYSA-YRNTQNKQIYSLNLQMGKLIMDIISGETKFANNESSVILAISGVDR 350

Query: 723 TNDNLKEFLGREPS 736
           TN  L   LG+ P+
Sbjct: 351 TNKTLPVALGKLPA 364

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 354  DKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEY 413
            +K+  + EK  +VL+   +T+ +EL +  D +  + D R    K L++KFN++L +I + 
Sbjct: 1383 EKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKK 1442

Query: 414  YPVESTIQGMLK 425
               E   Q M+K
Sbjct: 1443 AFEEGKQQSMMK 1454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,273,910
Number of extensions: 3980297
Number of successful extensions: 12813
Number of sequences better than 10.0: 82
Number of HSP's gapped: 13055
Number of HSP's successfully gapped: 82
Length of query: 747
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 630
Effective length of database: 40,065,477
Effective search space: 25241250510
Effective search space used: 25241250510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)