Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E039601.10ON1771776252e-83
TDEL0C069301.10ON1841702466e-26
ZYRO0F18370g1.10ON2201652331e-23
NDAI0A001901.10ON1711572179e-22
KLLA0C00594g1.10ON1941662083e-20
SAKL0C00572g1.10ON3381702102e-19
KNAG0C002701.10ON1741591882e-17
NCAS0B090601.10ON1671581802e-16
KAFR0D001901.10ON185601779e-16
Kwal_33.130231.10ON1931811673e-14
TBLA0A049701.10ON181491631e-13
KLTH0F00572g1.10ON195721525e-12
Ecym_10121.10ON177641051e-05
Kpol_2002.131.10ON16443900.001
KLTH0E08558g4.138ON72650691.3
NOTE: 4 genes in the same pillar as TPHA0E03960 were not hit in these BLAST results
LIST: Skud_3.8 Smik_3.19 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E03960
         (177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...   245   2e-83
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    99   6e-26
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    94   1e-23
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    88   9e-22
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    85   3e-20
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    86   2e-19
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    77   2e-17
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    74   2e-16
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    73   9e-16
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    69   3e-14
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    67   1e-13
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    63   5e-12
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    45   1e-05
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    39   0.001
KLTH0E08558g Chr5 (781814..783994) [2181 bp, 726 aa] {ON} simila...    31   1.3  

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score =  245 bits (625), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/177 (76%), Positives = 136/177 (76%)

Query: 1   MDSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIG 60
           MDSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIG
Sbjct: 1   MDSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIG 60

Query: 61  SKIWFVTLILSIRKLYXXXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXXXXXXX 120
           SKIWFVTLILSIRKLY                       NDLTSDIILQ           
Sbjct: 61  SKIWFVTLILSIRKLYKNILKSTKLLSLLKTELTKIEKNNDLTSDIILQKIQNNNTILKK 120

Query: 121 XXXXXXXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTLEITPTK 177
                  ELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTLEITPTK
Sbjct: 121 KIKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTLEITPTK 177

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 99.4 bits (246), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 90/170 (52%), Gaps = 1/170 (0%)

Query: 3   SSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSK 62
            S +     G++  FE  L+  LES+ + FD V+F +S G+I ENNF YR LN+   GSK
Sbjct: 8   PSSLGKPTGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSK 67

Query: 63  IWFVTLILSIRK-LYXXXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXXXXXXXX 121
           +WFVTL+LS+RK L                          L +D++ +            
Sbjct: 68  LWFVTLLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAM 127

Query: 122 XXXXXXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTL 171
                 +L+Q+ +YL+IV +++FK++I K+    LE LSN V++++FFT+
Sbjct: 128 MRETLLDLLQNSVYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTM 177

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 94.4 bits (233), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 83/165 (50%), Gaps = 2/165 (1%)

Query: 8   SDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVT 67
            D NG+   FE TL+  LESI  +FD V+ L++ G+I E+N  YR LN+   GSK+WFVT
Sbjct: 48  PDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVT 107

Query: 68  LILSIRKLYXXXXXXXXXXXXXXXXXXXXXXXN--DLTSDIILQXXXXXXXXXXXXXXXX 125
           L+LS RK +                          DL   ++                  
Sbjct: 108 LLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDV 167

Query: 126 XXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170
             EL+Q   YL IV +E+FKI++S+K+   LE LS+ +++++ FT
Sbjct: 168 VLELLQTLAYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFT 212

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score = 88.2 bits (217), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 79/157 (50%), Gaps = 3/157 (1%)

Query: 17  FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLY 76
            E +++  LE I NIFD V+ L+S G+I ENN  YRNLN+ N GSKIWFVTLIL+ RKL 
Sbjct: 5   MEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKLV 64

Query: 77  XXXXXXXXXXXXXXXXXXXXXXXN---DLTSDIILQXXXXXXXXXXXXXXXXXXELIQDF 133
                                      +L S ++ +                  EL Q  
Sbjct: 65  HQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQTL 124

Query: 134 IYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170
           +YL +VS+ IFK+  S K+ + LE LSN + +++ F+
Sbjct: 125 VYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMFS 161

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 6   VFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWF 65
           + ++E+      E  L++ L S+++ FD ++ LRS G+I + NF Y+ LN+ +IGSK+W 
Sbjct: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWL 81

Query: 66  VTLILSIRK-LYXXXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXXXXXXXXXXX 124
           V+L+LSIR+ L                        +     ++ +               
Sbjct: 82  VSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141

Query: 125 XXXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFT 170
              +L+QD +Y+IIVS++IFKI++S K    LE++S++ ++LKF +
Sbjct: 142 LCMDLLQDLLYMIIVSIDIFKINLSLKFKRALELISSAATVLKFVS 187

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 87/170 (51%), Gaps = 3/170 (1%)

Query: 3   SSDVFSDENGNEE--GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIG 60
           S++   DE G ++   FE  L+  LES+TN+FD V+ L++ G+I E NF YR+LN+  +G
Sbjct: 160 SNEEHEDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLG 219

Query: 61  SKIWFVTLILSIRK-LYXXXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXXXXXX 119
           SK+W  TL+LS+RK L                        +   + II            
Sbjct: 220 SKLWLATLVLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLD 279

Query: 120 XXXXXXXXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFF 169
                   +++Q+  YL++V++++FK+ +  +    LE +S+ V++ +FF
Sbjct: 280 RQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 76/159 (47%), Gaps = 5/159 (3%)

Query: 17  FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRK-- 74
           +E  LL  LESI +IFD ++ L+S G+I + NF YR LN+ N+GSK+WF+TLILSIRK  
Sbjct: 9   WEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKNL 68

Query: 75  --LYXXXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXXXXXXXXXXXXXXELIQD 132
             L                        + L ++++L                   +L Q 
Sbjct: 69  KRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQL 128

Query: 133 FIYLIIVSLEIFKISIS-KKLNHRLEILSNSVSMLKFFT 170
            IYL IVS + F I    KK    L  +SN V++L+   
Sbjct: 129 LIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 79/158 (50%), Gaps = 4/158 (2%)

Query: 16  GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKL 75
           G E  +LN LESI NIFD V+F +S G++ E N  YR LN+ + GSK+WF+TL+LS +KL
Sbjct: 3   GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKL 62

Query: 76  YXXXXXXXXXXXXXXXXXXXXXXXND----LTSDIILQXXXXXXXXXXXXXXXXXXELIQ 131
                                   ND    L + ++ +                  EL+Q
Sbjct: 63  ITRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQ 122

Query: 132 DFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFF 169
             +YL I  + +FK+ + +K  H LE LSN +++++ F
Sbjct: 123 TMMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVF 160

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
          Anc_1.10 YCL056C
          Length = 185

 Score = 72.8 bits (177), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 46/60 (76%)

Query: 17 FESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLY 76
           E  L++ LE I  +FD ++FL++ G+IKE+NF Y+ LN+ N+GSKIW V+LILSIR+ +
Sbjct: 19 LEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCF 78

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 85/181 (46%), Gaps = 12/181 (6%)

Query: 2   DSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGS 61
           DS DV +  N   E  E+  ++ +ES+  +FD +  L+S G+I E+N+ YR LN+S   S
Sbjct: 19  DSLDV-TKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCS 77

Query: 62  KIWFVTLILSIRKLYX------XXXXXXXXXXXXXXXXXXXXXXNDLTSDIILQXXXXXX 115
           K+W ++L+LS RK                                 L+  I L+      
Sbjct: 78  KVWLLSLVLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALK-----I 132

Query: 116 XXXXXXXXXXXXELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFFTLEITP 175
                       E++Q+  YLIIV+ ++F +++ ++  + LE  S+ +++LKF  L I P
Sbjct: 133 KDVNRRLILVALEIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLFLSIYP 192

Query: 176 T 176
            
Sbjct: 193 V 193

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (81%)

Query: 25 LESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIR 73
          LESI ++FD ++FLRS GLI + N FYR LNRS +GSKIW +TL+L+IR
Sbjct: 17 LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
          conserved hypothetical protein
          Length = 195

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 43/72 (59%)

Query: 3  SSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSK 62
            D  S   G  +  ES L++ LE+I  IFD +  LRS G+I ENN FY+ LN+S   SK
Sbjct: 19 CPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSK 78

Query: 63 IWFVTLILSIRK 74
           W V+L LS R+
Sbjct: 79 AWLVSLTLSSRR 90

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
          similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 8  SDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNL--NRSNIGSKIWF 65
          SD NG+   FE  L   L S    +DL++  +S G+IK++N  Y+ L   + N GS++ F
Sbjct: 24 SDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF 83

Query: 66 VTLI 69
          + L+
Sbjct: 84 LLLV 87

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 31/43 (72%)

Query: 16 GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSN 58
          G+E  +L+ LE I ++FD ++F+++ G+I + +F YR + ++N
Sbjct: 5  GWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNN 47

>KLTH0E08558g Chr5 (781814..783994) [2181 bp, 726 aa] {ON} similar
           to uniprot|P53202 Saccharomyces cerevisiae YGR003W
          Length = 726

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 21  LLNYLESITNIFDLVFFLR-STGLIKENNFFYRNLNRSNIGSKIWFVTLI 69
           +++ +E++ ++ D  F       LI+E   FYRN  R+NIG+ + ++  I
Sbjct: 173 VVDVMETLRDVDDTYFVHEFEPFLIRETECFYRNFARNNIGNAVLYIQKI 222

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.141    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,305,225
Number of extensions: 490881
Number of successful extensions: 1662
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1676
Number of HSP's successfully gapped: 25
Length of query: 177
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 75
Effective length of database: 41,785,467
Effective search space: 3133910025
Effective search space used: 3133910025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)