Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E018105.425ON45341917890.0
ZYRO0F09812g5.425ON4162874267e-47
KAFR0E038705.425ON3962874133e-45
NCAS0F033105.425ON4423054145e-45
YDR363W (ESC2)5.425ON4562973972e-42
Smik_4.6285.425ON4582933842e-40
Skud_4.6315.425ON4582953822e-40
TBLA0A037105.425ON4613053711e-38
SAKL0G02266g5.425ON4842863721e-38
Kwal_55.214685.425ON4652853622e-37
KLTH0F16280g5.425ON4732873369e-34
Kpol_1027.265.425ON4432943278e-33
Suva_2.5345.425ON4521153023e-29
NDAI0B056005.425ON4571162901e-27
Ecym_55245.425ON4152902449e-22
CAGL0A02706g5.425ON3691132393e-21
KLLA0E21275g5.425ON3922942163e-18
TDEL0E020005.425ON436982149e-18
KNAG0C049805.425ON3451211904e-15
AER251W5.425ON407951561e-10
NDAI0D00470singletonON35168820.15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01810
         (453 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   693   0.0  
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   168   7e-47
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   163   3e-45
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   164   5e-45
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   157   2e-42
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   152   2e-40
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   151   2e-40
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   147   1e-38
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   147   1e-38
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   144   2e-37
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   134   9e-34
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   130   8e-33
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   120   3e-29
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   116   1e-27
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...    99   9e-22
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...    97   3e-21
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    88   3e-18
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...    87   9e-18
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...    78   4e-15
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...    65   1e-10
NDAI0D00470 Chr4 (98485..99540) [1056 bp, 351 aa] {ON}                 36   0.15 

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/419 (84%), Positives = 355/419 (84%)

Query: 20  SYVQEEQVFVNSTEQNITKVVVSEEIHNISKTKVPQTSIFIDXXXXXXXXXXXXXDQNIQ 79
           SYVQEEQVFVNSTEQNITKVVVSEEIHNISKTKVPQTSIFID             DQNIQ
Sbjct: 20  SYVQEEQVFVNSTEQNITKVVVSEEIHNISKTKVPQTSIFIDSESESETGHTSSSDQNIQ 79

Query: 80  KQYVLEVRKLHTGSKRRESDIKSNSANSTDFSDTGSLEMVNYNNTDXXXXXXXXXXXXEN 139
           KQYVLEVRKLHTGSKRRESDIKSNSANSTDFSDTGSLEMVNYNNTD            EN
Sbjct: 80  KQYVLEVRKLHTGSKRRESDIKSNSANSTDFSDTGSLEMVNYNNTDRTYRSKRRRSQREN 139

Query: 140 IIDEREIRPSGIDADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERR 199
           IIDEREIRPSGIDADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERR
Sbjct: 140 IIDEREIRPSGIDADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERR 199

Query: 200 IQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLK 259
           IQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLK
Sbjct: 200 IQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLK 259

Query: 260 IPQTYQNXXXXXXXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTS 319
           IPQTYQN                       MQLLEDEQLSQKNIENFNDSNKPFDILNTS
Sbjct: 260 IPQTYQNEISELEIILISKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTS 319

Query: 320 YNEYEKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSN 379
           YNEYEKELENWNSKDFNVT                KGNDSMNLIEISDNESSIKEHGTSN
Sbjct: 320 YNEYEKELENWNSKDFNVTNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSN 379

Query: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG
Sbjct: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  168 bits (426), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 153/287 (53%), Gaps = 35/287 (12%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +DEFFK I +        +   TPE   R YN+ ++SKL+GS ++ +Q KVLG   FA
Sbjct: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
            +LP +LN  ++  KIP+ ++ +Y  ENVTLYW  +KLLNFM C+SLKIPQ ++N     
Sbjct: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWN 331
                              +LLEDEQ      E  N        L+    E+EKEL+N +
Sbjct: 270 DITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGN--------LDARVEEFEKELKNVD 321

Query: 332 SKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNK 391
           +   N                    +++  LI++ D        G ++++KI+L+  DNK
Sbjct: 322 NSTTN--------------------HETTELIDLED-------EGDTDLMKIALVGEDNK 354

Query: 392 KIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           KIFVNVR++T + K+ +Y++  K L  +  IK+IFDH+ L+L+  IG
Sbjct: 355 KIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIG 401

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  163 bits (413), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 146/287 (50%), Gaps = 35/287 (12%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +D+FFK +   +++ S        +   R YNI +ISKL+GS  + ++ KVLG   F+
Sbjct: 130 DENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSINKSVKVKVLGKFPFS 189

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
           K+LP  L  L+   KIPS +  +Y  ENV LYWN +KLLNFM CDSL IP  ++N     
Sbjct: 190 KILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSLSIPLAFENEISNV 249

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWN 331
                             M+ L++E   ++  E   D ++  D +     E+E EL +  
Sbjct: 250 DILIVSKEFGEKLEKLDQMKTLQEEAKLERQ-EEIKDVDEGDDFV---LKEFEAELRDVA 305

Query: 332 SKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNK 391
             + N++                 G DS  L                  +K++LM  DNK
Sbjct: 306 PSNANLSLDTD-------------GEDSEPL------------------MKLALMGQDNK 334

Query: 392 KIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           KI+VNVRSST+I KLV+Y+KK KNL  N ++K++FDHD L L+  +G
Sbjct: 335 KIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVG 381

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  164 bits (414), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 165/305 (54%), Gaps = 39/305 (12%)

Query: 150 GIDADDEFFKAI-REASKRPSTL--SNSGTPEI-LNRKYNIMYISKLNGSEERRIQAKVL 205
           G D +DEFFK I +EA K PS    S   TP+    R Y+I ++S+L+G+  + +Q KVL
Sbjct: 146 GPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVL 205

Query: 206 GTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQ 265
           G   F K+LPP L  L+K   IP+ L+  YK +NVTLYWN +KLLNFM C+SL IPQ ++
Sbjct: 206 GKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFE 265

Query: 266 NXXXXXXXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIE------NFNDSNKPFDILNTS 319
           N                        +LL +E+ +Q  ++         + NKP +  NT 
Sbjct: 266 NEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKEGEKNKPKESKNTE 325

Query: 320 Y----NEYEKELENWNS-KDFNVTXXXXXXXXXXXXXXXXKGNDSMNL-IEISDNESSIK 373
           Y     E+EKEL++    KD  V                  G +  N+ I+ SDNE    
Sbjct: 326 YAKAIAEFEKELKDATELKDSQV----------------HGGENDGNMNIDGSDNEK--- 366

Query: 374 EHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSL 433
               S+++KI+L+ +DNKKI+VNVR+ST   KL +Y++  K L    +I+++FDHD L+L
Sbjct: 367 ----SSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNL 422

Query: 434 DSMIG 438
           +  +G
Sbjct: 423 EETVG 427

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  157 bits (397), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 151/297 (50%), Gaps = 33/297 (11%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +D+FFK + + +K+ +T+S   TP+   R YNI ++SKL G+  + +Q KVLG   F+
Sbjct: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
           K+LP  L+ L+K  KIP  ++ +YK ENVTLYWN +KLL FM C+SL IPQ ++N     
Sbjct: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDE--------QLSQKNIENFNDSNKPFDILNTSYNEY 323
                              +L E+E        Q  ++ +E   +  +      + Y E+
Sbjct: 288 DVTIVSKEYEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQE-----ESEYREF 342

Query: 324 EKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDS-MNLIEISDNESSIKEHGT-SNVI 381
           E EL+N                         K ND+ MN   + +  S      +   V+
Sbjct: 343 ESELKNVEE------------------TQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVM 384

Query: 382 KISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           +I+LM  DNKKI+V+VR ST   K+ +Y++  K L    R+K++FDHD L ++  I 
Sbjct: 385 RIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIA 441

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  152 bits (384), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 149/293 (50%), Gaps = 21/293 (7%)

Query: 150 GIDADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQT 209
             D +D+FFK + + +K+ +++S   TP+   R YNI ++SKL G+  + +Q KVLG   
Sbjct: 168 AYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYE 227

Query: 210 FAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXX 269
           F+++LP  L+ L K  KIP  ++ +YK ENVTLYW  +KLL+FM C+SL IPQ ++N   
Sbjct: 228 FSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVS 287

Query: 270 XXXXXXXXXXXXXXXXXXXXMQLLEDE-QLSQKNIENFND--SNKPFDILNTSYNEYEKE 326
                                +L E+E  L  K  E        K  +   + Y E+E E
Sbjct: 288 DIDVTIVSKEYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFE 347

Query: 327 LENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSN-VIKISL 385
           L N   K                     +    +N+  + ++++ ++ +  S  V+KI+L
Sbjct: 348 LRNVKEK-----------------QERTENETVINIKNLQEDDNLLENNSDSEKVMKIAL 390

Query: 386 MSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
              DNKKI+VNVR ST   K+ +Y++  K L    RIK++FDHD L +   I 
Sbjct: 391 RGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHECIA 443

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  151 bits (382), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 145/295 (49%), Gaps = 29/295 (9%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +D+FFK + + +K+ +T+S   TPE   R YNI ++SKL G+  + +Q KVLG   F+
Sbjct: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
           ++LP  L+ L+K  KIP  + S+YK  NVTLYWN +KLLNFM C+SL I Q ++N     
Sbjct: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDE--------QLSQKNIENFNDSNKPFDILNTSYNEY 323
                              +L EDE        Q  ++ +E   +  +      + Y E+
Sbjct: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQE-----ESEYREF 344

Query: 324 EKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKI 383
           E EL N                         KGN+                  T  VIK+
Sbjct: 345 EFELRNVKETQELEENEIIINTKPLQGNNSLKGNNG----------------DTEKVIKL 388

Query: 384 SLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           +LM  DNKKI VNVR+ST + K+ +Y++  K L    RI+++FDHD L++   + 
Sbjct: 389 ALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVA 443

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  147 bits (371), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 153/305 (50%), Gaps = 66/305 (21%)

Query: 157 FFKAIREASKRPS---------TLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGT 207
           FFKA++ +S  P          T  + G P+   R YN+ +ISK+ G+ ++++Q KVLG 
Sbjct: 185 FFKALKHSSSVPPSSTMKSDIKTTKDQGNPK---RIYNVRFISKIEGTLDKKVQVKVLGK 241

Query: 208 QTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNX 267
             F+K+LPP L    +  KIP+ L+  Y+  NVTLYWN SKLLNFM C+SL IPQ Y+N 
Sbjct: 242 FPFSKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENE 301

Query: 268 XXXXXXXXXXXXXXXXXXXXXXMQLLE--DEQLSQKN----------IENFNDSNKPFDI 315
                                 M L +  ++ L+QK+          +E+F         
Sbjct: 302 ISDVEIIVITKTNEKSYEDKINMSLKQNIEQNLAQKSNEIKELRKLKVESFE-------- 353

Query: 316 LNTSYNEYEKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISD--NESSIK 373
            + S  E+EKEL+   S+D                     G D+     I D  NES   
Sbjct: 354 -HNSIQEFEKELKEL-SQD---------------------GVDTKQTANIDDIPNESH-- 388

Query: 374 EHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSL 433
                  IKI+L++ DNKK++V VR+ST   +LV+YF++ K L   Q+IK+IFD++ L L
Sbjct: 389 -------IKIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDL 441

Query: 434 DSMIG 438
           +  +G
Sbjct: 442 NETVG 446

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  147 bits (372), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 149/286 (52%), Gaps = 38/286 (13%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D  D FF  I   + R ST+    +PE+  R Y I +ISKL GS +++I+ K  G   F 
Sbjct: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
           K+LP  L+ ++K  +IP  ++++YK +NVTLYWN +K+LNFM C+SL+IPQ Y +     
Sbjct: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWN 331
                              +++E+E LS  +++  N     F     + NEYE +LE   
Sbjct: 341 DITLVSKEYEMKYEAEFK-EMVENE-LSGSSVDVKNVKKDDF-----ATNEYELQLEKSE 393

Query: 332 SKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNK 391
           S +                          +L++ S+N   I++    + IK++L+  DNK
Sbjct: 394 SAE-------------------------PSLLKSSEN---IRD---GSFIKLALVGQDNK 422

Query: 392 KIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMI 437
           K+FV  RSST  +K+ DY+K  KNL S  ++K+ FDH  LSL+  +
Sbjct: 423 KMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRV 468

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  144 bits (362), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 145/285 (50%), Gaps = 39/285 (13%)

Query: 154 DDEFFKAI-REASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAK 212
           D++FF+ + REA +  STL   G+P    R YNI ++S L GS   +I  KV G   F++
Sbjct: 203 DEKFFEELQREAGRTTSTL-KEGSPATAKRVYNIKFLSNLEGSLNDKINVKVKGKHAFSE 261

Query: 213 VLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXXX 272
           +LP  L TL+K  K+   L+  Y+ ENV+LY N  K+LNFMNC+SL IP  Y+       
Sbjct: 262 ILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEG-----E 316

Query: 273 XXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWNS 332
                            ++ LE  + +  ++     S K   I   S  E+EK+LE + S
Sbjct: 317 VSDVSMTLVSRDREQEYVKTLEQSRHATPDLSREETSPK---IPGFSIEEFEKDLEGFES 373

Query: 333 KDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNKK 392
            + N                        NL+E  D   +   HGT   IKI+LM+ DNKK
Sbjct: 374 GESN------------------------NLLE--DTPQTENNHGT---IKIALMAQDNKK 404

Query: 393 IFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMI 437
           I+VNVR +T I  L ++++  KNL+S +R K +FD++ L L + I
Sbjct: 405 IYVNVRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQLSTKI 449

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  134 bits (336), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 135/287 (47%), Gaps = 38/287 (13%)

Query: 152 DADDEFFKAI-REASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTF 210
           D DD+FF+ + REAS+  ST+  S +P +  R YNI +IS L GS  RRI  KV G Q+F
Sbjct: 206 DEDDKFFEELEREASRTASTVKES-SPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSF 264

Query: 211 AKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXX 270
            ++LP  L T++K  KIP  L  +Y+ + VTLY +  K+LNFMNC+SL+IP  ++     
Sbjct: 265 DQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSD 324

Query: 271 XXXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENW 330
                                   + +L    IE   ++       + +  EYEKEL N 
Sbjct: 325 VCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPGTETP------DFTVEEYEKELRNV 378

Query: 331 NSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDN 390
              DFN                            + DN            I+I+LMS DN
Sbjct: 379 ---DFNKNTSVQNQPPPQS---------------VDDN------------IRIALMSQDN 408

Query: 391 KKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMI 437
           KKI V  R  T    L ++++K  +L   Q++ + FD++ L LDS +
Sbjct: 409 KKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKV 455

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  130 bits (327), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 152/294 (51%), Gaps = 29/294 (9%)

Query: 155 DEFFKAIREASKRPSTLSNSGTPE---ILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D+F KAIR  S   +TL+N  +P      NR YNI + SKL+GS ++++QA+VLG Q F+
Sbjct: 151 DDFSKAIRMNS---NTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFS 207

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXXXXX 271
           +++ PIL++  K+ K+    +  YK + VT+YW+++KLL FM C+SLKIP  +Q+     
Sbjct: 208 EIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHI 267

Query: 272 XXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFN----DSNKPFDILNTSYNEYEKEL 327
                              QL    ++ QK  EN N     S+K F I        E ++
Sbjct: 268 ELTIISKENEQQFEADIKAQL----EVDQK--ENTNKTEVGSSKNFGI--------ESQI 313

Query: 328 ENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSN----VIKI 383
           +  N K +                      D M++    +N   I    T++    ++K+
Sbjct: 314 DE-NKKKYEEYENELNESIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKL 372

Query: 384 SLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMI 437
           +L+ NDNKKIFVN R +T+  KL +Y+   + L  + ++K+IFD + + LDSM+
Sbjct: 373 ALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMV 426

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  120 bits (302), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +D+FFK + + +K+ +++S   TP+   R YNI + SKL G+  + +Q KVLG   F+
Sbjct: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQN 266
           ++LP  L+ L+K  KIP  ++ +YK ENVTLYWN +KLL FM C+SL IPQ ++N
Sbjct: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFEN 278

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  116 bits (290), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRK-YNIMYISKLNGSEERRIQAKVLGTQTF 210
           D +DEFFK I + +K+  +L+   TP+ L ++ YNI +ISKL+G+  + +Q KVLG   F
Sbjct: 165 DENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGKFQF 224

Query: 211 AKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQN 266
            K+LP  L  L+K   IPS L+  Y  +NV+LYWN +KLL+FM C+SL IPQ ++N
Sbjct: 225 QKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFEN 280

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score = 98.6 bits (244), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 127/290 (43%), Gaps = 51/290 (17%)

Query: 157 FFKAIREASKRPSTLSNSGT--------PEILNRKYNIMYISKLNGSEERRIQAKVLGTQ 208
           F   I + ++R S+L N+G+         EI    YN+ +ISKL GS  +RI  ++ G +
Sbjct: 136 FLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRINVRITGKK 195

Query: 209 TFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNXX 268
            F+  LP  L T +K  KI + L   Y+ +NV +Y    ++  FM CDS  I + Y +  
Sbjct: 196 KFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSS 255

Query: 269 XXXXXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILNTS--------- 319
                                   ++ +Q  +  ++  + S  P D+ +           
Sbjct: 256 IDIEVYIVPNELASEFE-------IQWKQKIETKMKRVSISASPVDLDSDGIEFGNDDFR 308

Query: 320 YNEYEKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGTSN 379
            NEYEK+L N                             S++  EI  +    K    + 
Sbjct: 309 VNEYEKDLANAR---------------------------SLDETEIQYSNQISKPDDGNE 341

Query: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHD 429
           +IK+ L+ +DNKK++VNV+ +T  +KL +++++ K L    ++ + FDHD
Sbjct: 342 LIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHD 391

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211
           D +D FF++I + S+       SG     ++ Y + +IS ++G++ + +Q K LG+  F+
Sbjct: 122 DENDLFFQSIAKRSQSLPVQDGSGAVR-QDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180

Query: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTY 264
           K++   L+ L++ +++PS +R LY+ E+V  YWN++K+L FM CD+L++PQ Y
Sbjct: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRY 233

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 35/55 (63%)

Query: 377 TSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVL 431
           +  V++++L   DNKK++VNV+ +T   ++++Y++  K L  + +I +  D + L
Sbjct: 293 SEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPL 347

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 137/294 (46%), Gaps = 38/294 (12%)

Query: 144 REIRPSGIDADDEFFKAIREA---SKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRI 200
           +E +   I+  DE F  ++E    +K  +   N+G  ++  R YNI +IS L GS+++R+
Sbjct: 109 KEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNG--KVTKRIYNINFISTLEGSQDKRV 166

Query: 201 QAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKI 260
             KV G +TF  +LP  + T ++  KIP +LR  Y    + L+    ++L F NCDSL+I
Sbjct: 167 NVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRI 226

Query: 261 PQT---YQNXXXXXXXXXXXXXXXXXXXXXXXMQLLEDEQLSQKNIENFNDSNKPFDILN 317
           P+T   Y+                           L+   L + NIE  +   +P    +
Sbjct: 227 PKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQ-SFLDESNIEEQDPLEQP--ARD 283

Query: 318 TSYNEYEKELENWNSKDFNVTXXXXXXXXXXXXXXXXKGNDSMNLIEISDNESSIKEHGT 377
             +  +EKELE+                         + +D ++L++ SD ES       
Sbjct: 284 EKFKLFEKELES-------------------APKLAERTDDVIDLLD-SDIES------- 316

Query: 378 SNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVL 431
           SN I+++L+   NK+  ++V  +T   ++ + +K   +L+ +  + +IFD++ L
Sbjct: 317 SNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEEL 370

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%)

Query: 163 EASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLL 222
           E +++ ST S +   +   + +N+M++SKL G+ +R IQ KVLG   FA +L  +L  ++
Sbjct: 170 EETRQMSTSSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVV 229

Query: 223 KVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKI 260
           +  KIP  +   Y  +NVTLYWN  KLL FM CDSLKI
Sbjct: 230 EEFKIPYPVMHQYTVDNVTLYWNGGKLLKFMTCDSLKI 267

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%)

Query: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIG 438
           VIK++L+  DN +++VNVR ST   K+ +Y+K  K L    ++ + FDH+ L L+  +G
Sbjct: 364 VIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLNETVG 422

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 70/121 (57%), Gaps = 5/121 (4%)

Query: 149 SGIDADDEFFKAI---REASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVL 205
           SG D +++FF+ +   R  S  P+  + + T  + +  Y + + S+L G+  + +Q KV+
Sbjct: 96  SGPDDEEQFFQELLRARTQSVEPAETATTST--VPSPVYRVRFQSQLEGTLGKSVQVKVI 153

Query: 206 GTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQ 265
           GT+    VLP +L+ L++  ++P  L+  Y    V +Y   +++L FMNC+SL + Q ++
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 266 N 266
           N
Sbjct: 214 N 214

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 37/58 (63%)

Query: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMI 437
           ++KI+L+S DN++++V V   T   +L++Y++  + L +   +++  D + +S ++ I
Sbjct: 273 LMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVSPETHI 330

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%)

Query: 170 TLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLLKVNKIPS 229
           T +  G  +   R YN+ +IS++ GS  RR+  KV G + FA  L   L    K + I  
Sbjct: 152 TATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRK 211

Query: 230 KLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTY 264
            L+  Y+A+ V +Y    ++  FM CDS  I + Y
Sbjct: 212 SLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPY 246

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 359 SMNLIEISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTS 418
           S+N  E++  E +  +  +S ++KI L+ +DNKK+F++VR +T + K+ ++++  K L  
Sbjct: 314 SLNETELAVREGTPADE-SSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPP 372

Query: 419 NQRIKVIFDHDVLSLDSMI 437
             ++ ++FDH+ + LD  I
Sbjct: 373 TVQLSLMFDHEEIDLDDTI 391

>NDAI0D00470 Chr4 (98485..99540) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 182 RKYN--IMYISKLNGSEERRIQAKVLG-TQTFAKVLPPILNTLLKVNKI--PSKLRSLYK 236
           R Y+  I+   ++     R++ A ++G  QTF KVL P+L+TL ++N I  P+K+  L  
Sbjct: 245 RTYDVKIILFCRIYPELPRKLFAGLVGLMQTFMKVLSPVLSTLSQLNTISTPAKIIVLLM 304

Query: 237 AENVTLYW 244
           A  V+  W
Sbjct: 305 ALTVSNVW 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,286,362
Number of extensions: 1646587
Number of successful extensions: 5994
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6152
Number of HSP's successfully gapped: 38
Length of query: 453
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 340
Effective length of database: 40,524,141
Effective search space: 13778207940
Effective search space used: 13778207940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)