Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017805.432ON50841322060.0
Kpol_1062.315.432ON51341916230.0
KAFR0E039205.432ON49741715900.0
NCAS0F033605.432ON50943615640.0
Skud_15.2825.432ON48541515590.0
KLLA0E21121g5.432ON52642215540.0
YOR119C (RIO1)5.432ON48441515470.0
CAGL0L11594g5.432ON50741215380.0
Suva_8.1725.432ON48641515270.0
Smik_15.2975.432ON48641515240.0
SAKL0G02486g5.432ON50042115190.0
TDEL0E019305.432ON50241915130.0
KLTH0F16104g5.432ON54042114980.0
AER257W5.432ON47741714810.0
KNAG0C049305.432ON49641714780.0
Kwal_55.214335.432ON47642314730.0
TBLA0A037605.432ON50441314740.0
NDAI0B056505.432ON46237914560.0
Ecym_47635.432ON53841714500.0
ZYRO0F09988g5.432ON46041412801e-173
NCAS0G015802.44ON4242571472e-09
CAGL0H08019g2.44ON4252161383e-08
Suva_14.1362.44ON4262571358e-08
KAFR0A077602.44ON4252571331e-07
Smik_14.1252.44ON4202571321e-07
TPHA0H009202.44ON4292571322e-07
NDAI0F036002.44ON4212571303e-07
Kwal_23.45632.44ON4252571276e-07
Skud_14.1292.44ON4252571277e-07
YNL207W (RIO2)2.44ON4252571171e-05
KNAG0F010602.44ON4282591171e-05
SAKL0E13552g2.44ON4192571162e-05
TDEL0A008602.44ON4192571152e-05
Kpol_400.72.44ON4252571142e-05
KLTH0B07722g2.44ON4282571081e-04
Ecym_64492.44ON4172571053e-04
ABL166W2.44ON4141431044e-04
ZYRO0C10340g2.44ON4162581045e-04
KLLA0D19008g2.44ON422257890.029
KLLA0F15576g5.200ON51287761.1
Ecym_11191.104ON791118742.1
ADL175W3.34ON47494732.2
Kpol_1049.234.6ON11039673.7
Ecym_53163.130ON76645713.9
Ecym_22086.209ON52941705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01780
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   854   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   629   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   617   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   607   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   605   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   603   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   600   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   597   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   592   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   591   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   589   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   587   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   581   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   575   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   573   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   572   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   572   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   565   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   563   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   497   e-173
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      61   2e-09
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    58   3e-08
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    57   8e-08
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    56   1e-07
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    55   1e-07
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    55   2e-07
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    55   3e-07
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    54   6e-07
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    54   7e-07
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    50   1e-05
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    50   1e-05
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    49   2e-05
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    49   2e-05
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    49   2e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    46   1e-04
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    45   3e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    45   4e-04
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    45   5e-04
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    39   0.029
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    34   1.1  
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    33   2.1  
ADL175W Chr4 (387431..388855) [1425 bp, 474 aa] {ON} Syntenic ho...    33   2.2  
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    30   3.7  
Ecym_5316 Chr5 complement(638982..641282) [2301 bp, 766 aa] {ON}...    32   3.9  
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    32   5.0  

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT 60
           MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT
Sbjct: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT 60

Query: 61  MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELI 120
           MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELI
Sbjct: 61  MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELI 120

Query: 121 PGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRK 180
           PGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRK
Sbjct: 121 PGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRK 180

Query: 181 MIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTRE 240
           MIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTRE
Sbjct: 181 MIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTRE 240

Query: 241 EIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFLR 300
           EIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFLR
Sbjct: 241 EIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFLR 300

Query: 301 MDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTDE 360
           MDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTDE
Sbjct: 301 MDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTDE 360

Query: 361 DELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           DELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ
Sbjct: 361 DELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/419 (75%), Positives = 355/419 (84%), Gaps = 9/419 (2%)

Query: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT 60
           MS + KFD+LK+  ++ +N++ILEKYGHKIKTDELS TKGKTNKDKANRATVENVLDPRT
Sbjct: 1   MSFDEKFDRLKISGND-VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRT 59

Query: 61  MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEV----LPQISELEDVLN 116
           M+ LK L NRGVI  FNGCLSTGKEANVYHAFAGDG    N +V    L +++ +E   +
Sbjct: 60  MRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQD 119

Query: 117 KELIPG-QIEVPTIK-SEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARS 174
            E   G    V  I  S+ E  +L  RKEYAIKIYKTSILVFKDRERYVDGE+RFRN+RS
Sbjct: 120 SEEDNGDNNNVADIDGSKPEGVEL--RKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177

Query: 175 QHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDH 234
           QHNPRKMIKIWAEKEFRNLRRI QSG+IPAP+PVEVK N+LVMEFL RG+GFASPRL+D+
Sbjct: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237

Query: 235 QYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPM 294
            YK R+EI +YYH LVAY+RLLYQVCRLVHADLSEYNTIVH  KLY+IDVSQSVEPEHPM
Sbjct: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297

Query: 295 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLP 354
           SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVIS +L+ F GD  S+ DLR ++ + LP
Sbjct: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357

Query: 355 VKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           +K TDEDE +DE+FRSLHLVRNL GLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS Q
Sbjct: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQ 416

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/417 (71%), Positives = 352/417 (84%), Gaps = 12/417 (2%)

Query: 1   MSLEGKFDKLKVH----ESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVL 56
           MS+E KFD LK+      S+HIN++IL+KYGHKIKT+E S ++GKTNKDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 57  DPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLN 116
           DPRTMK L+ L++RGVI  F+GCLSTGKEANVYHAFAG G+  G    L Q     + ++
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQ-----EEMS 115

Query: 117 KELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 176
             + P ++   + + ++++    +R+EYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH
Sbjct: 116 VPVDPSEL---SAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 172

Query: 177 NPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQY 236
           NPRKMIKIWAEKEFRNL+RI+QS +IPAP+P+E+K N+LVMEFL RGDGFASPRL+DH Y
Sbjct: 173 NPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPY 232

Query: 237 KTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSL 296
           K REEI +YYHTLVAYIRLLYQVC LVHADLSEYNT+VH  +LYVIDVSQSVEPEHPMSL
Sbjct: 233 KDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSL 292

Query: 297 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVK 356
           DFLRMDIKNVN YFEKMGIDIFPERIIFQFVIS  LDKF GD +SS DLR+Y+   LP+K
Sbjct: 293 DFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIK 352

Query: 357 CTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
            T +DE +DEIFRSL+LVRNL+GLEERDFDR+T+G+FDLLK+L+A DN+KNF AS Q
Sbjct: 353 ATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASEQ 409

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/436 (67%), Positives = 351/436 (80%), Gaps = 34/436 (7%)

Query: 1   MSLEGKFDKLKVH---ESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLD 57
           MSLE KFD+L +     +EH N+KIL+KY HK KTDE+S T+ KTNKDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 58  PRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEV------------- 104
           PRTM+ LK L +RGVI +FNGCLSTGKEANVYHAFAGD K+  +  +             
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 105 ------LPQISELEDVLNKELIPGQIEVPTIKSEEEQTQLKQ-RKEYAIKIYKTSILVFK 157
                 LP    L++ L  EL P  +           T++ Q +KEYA+KI+KTSILVFK
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEML-----------TKVSQDKKEYAVKIFKTSILVFK 169

Query: 158 DRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVM 217
           DRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLRRI+QSG+IP P+P+EVK N+LVM
Sbjct: 170 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVM 229

Query: 218 EFLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD 277
           EFLGRGDGFASPRL+DH YK REEI +YYHT+VAY+RL+YQ+CRLVHADLSEYN ++H D
Sbjct: 230 EFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKD 289

Query: 278 KLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTG 337
           K+Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQF+IS  L+ F G
Sbjct: 290 KMYIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNG 349

Query: 338 DPRSSVDLRNYIAHYLPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLK 397
           D R   DLR+Y+A  LP+K +++DE +DEIFRSL+LVRNL+GLEERDFDR+TDGKFDLLK
Sbjct: 350 DYRDYNDLRDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLK 409

Query: 398 TLIASDNQKNFTASTQ 413
           +LIA DN+KNF+A+ Q
Sbjct: 410 SLIAHDNEKNFSAAEQ 425

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/415 (72%), Positives = 342/415 (82%), Gaps = 26/415 (6%)

Query: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58
           MSLE +FD+L V +  S+HIN+++LEKY HKIKTDELS +K KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118
           RTM+ LK+++NRGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDEE------- 106

Query: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178
              GQ EV              RKEYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 107 --TGQYEVLETDG--------LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156

Query: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238
           RKMIKIWAEKEFRNL+RI QSG+IPAP PVEVK N+LVMEFL RG+GFASP+LRD+ Y+ 
Sbjct: 157 RKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRD 216

Query: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298
           REEI +YYHT+VAY+RLLYQVCRLVHADLSEYNTI+H+DKLY+IDVSQSVEPEHPMSLDF
Sbjct: 217 REEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDF 276

Query: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358
           LRMDIKNVN YFEKMG+ IFPER+IFQFVIS  L+KF GD  + +DL  YIA  LP+K T
Sbjct: 277 LRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKST 336

Query: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS Q
Sbjct: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQ 391

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/422 (68%), Positives = 353/422 (83%), Gaps = 11/422 (2%)

Query: 1   MSLEGKFDKLKV-HESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59
           M+++ K +KL + +  EH+N++ILE+Y + IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61

Query: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGK-----VKGNAEVLPQISELEDV 114
           TM+ LK+++NRG++  FNGCLSTGKEANVYHAFAG+ +     V+G+ + +     +E  
Sbjct: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121

Query: 115 LNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARS 174
             K L     +  +  +  ++   K +KEYA+KIYKTSILVFKDRERYVDGEFRFRN+RS
Sbjct: 122 KQKALTAESEDATSTSTATDEP--KNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRS 179

Query: 175 QHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDH 234
           QHNPRKMIKIWAEKEFRNL+RI+QSG+IP P+P+EV+ N+LVMEFL RGDGFASPRL+DH
Sbjct: 180 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDH 239

Query: 235 QYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPM 294
            YK REEI +YY+ ++AY+RLLYQVCRLVHADLSEYN+IVH+DKLY+IDVSQSV+PEHPM
Sbjct: 240 PYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPM 299

Query: 295 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLP 354
           SLDFLRMDIKNVN YF+K+GIDIFPER+IFQF+IS  LDKF GD RSS DL  Y+A  LP
Sbjct: 300 SLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLP 359

Query: 355 VKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTAS 411
           +K TDEDE +DE+FRSLHL+RNL GLEERDFDRFTDGKFDLLK+LIA++N+K   NFTAS
Sbjct: 360 LKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTAS 419

Query: 412 TQ 413
            Q
Sbjct: 420 EQ 421

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/415 (71%), Positives = 339/415 (81%), Gaps = 26/415 (6%)

Query: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58
           MSLE KFD L V +  S+HIN+++LEKY HKIKTDELS ++ KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118
           RTM+ LK+++ RGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDEE------- 106

Query: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178
              GQ EV              R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 107 --TGQYEVLETDG--------SRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156

Query: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238
           RKMIKIWAEKEFRNL+RI+QSG+IPAP+P+EVK N+LVMEFL RG+GFASP+L+D+ YK 
Sbjct: 157 RKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKN 216

Query: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298
           R+EI +YYHT+VAY+RLLYQVCRLVHADLSEYNTIVHDDKLY+IDVSQSVEPEHPMSLDF
Sbjct: 217 RDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDF 276

Query: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358
           LRMDIKNVN YFEKMGI IFPER+IFQFVIS  L+KF GD  +   L  YIA  LP+K T
Sbjct: 277 LRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKST 336

Query: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS Q
Sbjct: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQ 391

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/412 (70%), Positives = 341/412 (82%), Gaps = 9/412 (2%)

Query: 3   LEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRTMK 62
           L  KF  +KV  ++HIN++I++KYGHKIKTDELS  K KTNKDKANRATVENVLDPRTM+
Sbjct: 4   LSDKFRNVKV-STDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTMR 62

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIP- 121
            L  L+NRGVI   NGCLSTGKEANVYHAFAG            Q  E ++ ++   IP 
Sbjct: 63  FLNALVNRGVIAGLNGCLSTGKEANVYHAFAG-----SKMATEQQSDEPKEDIDANAIPS 117

Query: 122 -GQIEVPTIKSEEEQTQLKQ-RKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179
            G I++   +++  +  +++ RKEYAIKIYKTSIL+FKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 118 KGNIDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPR 177

Query: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239
           KMIKIWAEKEFRNL+RI+Q G+IP+PEP+EVK N+LVMEFL RGDGFASP+LRD+ YK R
Sbjct: 178 KMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDR 237

Query: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299
           EEI YYYH LV+Y+RLLYQVCRLVHADLSEYNTIVH +KLY+IDVSQSVEPEHPMSLDFL
Sbjct: 238 EEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFL 297

Query: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359
           RMDIKNVN YFEKMGI+IF E+ IFQFVI+  LDKF GD  S  DLR Y+A  +P+K T 
Sbjct: 298 RMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQ 357

Query: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS 411
           EDE +DE+FRSLHLVRNL+GLEERDFDRFTDGKFDLLK+L+A DN+KN+ A+
Sbjct: 358 EDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAA 409

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/415 (70%), Positives = 345/415 (83%), Gaps = 26/415 (6%)

Query: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58
           MS E KF+KL V +  S+HIN+++L+K+ HKIKTDELS +K KT+KDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118
           RTM+ LK+++NRGVI + NGCLSTGKEANVYHAFAG GK    A V+ + +   +VL  +
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGK----APVVDEETGKYEVLETD 116

Query: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178
            +                    R EYAIKIYKTSILVFKDRE+YVDGEFRFRNARSQHNP
Sbjct: 117 GL--------------------RAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNP 156

Query: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238
           RKMIKIWAEKEFRNL+RI QSG+IPAP+PVEVK N+LVMEFL RGDGFASP+L+D+ YK 
Sbjct: 157 RKMIKIWAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKD 216

Query: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298
           REEI +YY+T+VAY+RLLYQVCRLVHADLSEYNTI+HDD+LY+IDVSQSVEPEHPMSLDF
Sbjct: 217 REEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDF 276

Query: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358
           LRMDIKNVN YFEKMGI+IFPER+IFQFVIS  L+KF GD ++  DL  YI+  LP+K T
Sbjct: 277 LRMDIKNVNLYFEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKST 336

Query: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS Q
Sbjct: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQ 391

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/415 (70%), Positives = 338/415 (81%), Gaps = 26/415 (6%)

Query: 1   MSLEGKFDKLKVHE--SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDP 58
           MSLE  FDKL V +  S+HIN+++LEKY HKIKTDELS  + KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 59  RTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKE 118
           RTM+ LK+++NRGVI + NGCLSTGKEANVYHAFAG GK        P I E        
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKA-------PVIDEE------- 106

Query: 119 LIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNP 178
              G+ EV              R EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNP
Sbjct: 107 --TGKYEVLETDG--------PRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNP 156

Query: 179 RKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKT 238
           RKMIKIWAEKEFRNL+RI+QSG+IPAP+P+EVK N+LVMEFL RG+GFASP+L+D+ Y+ 
Sbjct: 157 RKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRD 216

Query: 239 REEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDF 298
           R EI +YY+T+VAY+RLLYQVCRLVHADLSEYNTI+HDDKL++IDVSQSVEPEHPMSLDF
Sbjct: 217 RGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDF 276

Query: 299 LRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCT 358
           LRMDIKNVN YFEKMGI IFPER+IFQFVIS  L+KF  D  +  DL  YIA  LP+K T
Sbjct: 277 LRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKST 336

Query: 359 DEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           ++DE +DEIFRSLHLVR+L GLEERDFDR+TDGKFDLLK+LIA DN++NF AS Q
Sbjct: 337 EQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQ 391

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/421 (67%), Positives = 338/421 (80%), Gaps = 36/421 (8%)

Query: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55
           MS+E  F KL + +      +H+NS+IL+KY H+IKTDELS T+GKTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVL 115
           LDPRTM+ L+ L++RGV+ + NGCLSTGKEANVYHAFAG+                    
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNAN------------------ 102

Query: 116 NKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQ 175
                      P+ ++E++      ++EYA+KIYKTSILVFKDRERYVDGEFRFRN+RSQ
Sbjct: 103 ----------QPSEEAEKDSKDELVKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 152

Query: 176 HNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQ 235
           HNPRKMIKIWAEKEFRNL+RI QSG+IP P+P+EV+ N+LVMEFL RG+GFASPRL+DH 
Sbjct: 153 HNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHP 212

Query: 236 YKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMS 295
           YK REEI YYYHT+VAY+RLLYQVC+LVHADLSEYNTIVH D+LY+IDVSQSV+PEHPMS
Sbjct: 213 YKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMS 272

Query: 296 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPV 355
           LDFLRMDIKN+N YFEK GIDIFPER+IFQF+IS  LDKF GD  +  DLR+Y++  LP+
Sbjct: 273 LDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPL 332

Query: 356 KCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTAST 412
           K T EDE +DE+FRSLHLVRNL+GLEERDFDRFTDGKFDLLK+LIA DN+K   NF AS 
Sbjct: 333 KSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASE 392

Query: 413 Q 413
           Q
Sbjct: 393 Q 393

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/419 (69%), Positives = 332/419 (79%), Gaps = 47/419 (11%)

Query: 1   MSLEGKFDKLKV-HESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59
           MSLE +FD+L + H  EH N +IL+K+ + IKTDELS T+ K++KDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAG-------DGKVKGNAEVLPQISELE 112
           TM+ LK+++NRGVI EFNGCLSTGKEANVYHAFAG       DG V+G            
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQG------------ 108

Query: 113 DVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNA 172
                                      ++KE AIKIYKTSILVFKDRERYVDGEFRFRN+
Sbjct: 109 ---------------------------EKKELAIKIYKTSILVFKDRERYVDGEFRFRNS 141

Query: 173 RSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLR 232
           RSQHNPRKMIKIWAEKEFRNLRRI QSG+IPAP+PVEVK N+LVMEFL RGDGFASPRL+
Sbjct: 142 RSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLK 201

Query: 233 DHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEH 292
           DH +  R EI +YYHT++AYIRLLYQVCRLVHADLSEYN IVHD KLY+IDVSQSVEPEH
Sbjct: 202 DHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEH 261

Query: 293 PMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHY 352
           PMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQFVIS  L+KF G+P+SS DL NY++  
Sbjct: 262 PMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKA 321

Query: 353 LPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS 411
           LPVK T  D  +DEIFRSLHLVRNL+GLEERDFDRFTDGKFDLLK+LIA DN+++  A+
Sbjct: 322 LPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/421 (69%), Positives = 333/421 (79%), Gaps = 36/421 (8%)

Query: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55
           MSLE    KL +HE      +HIN++IL+K+ H IKTDELS T+ KT+KDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVL 115
           LDPRTM+ L+ L +RGVI EFNGCLSTGKEANVYHAFAG G      E            
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEE------------ 160

Query: 116 NKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQ 175
            ++++P Q E               R+EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQ
Sbjct: 161 -QKVLPNQGE---------------RREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 204

Query: 176 HNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQ 235
           HNPRKMIKIWAEKEFRNL+RI+QSG++PAPEP+EVK N+LVMEFL RGDGFASP+L+D  
Sbjct: 205 HNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFP 264

Query: 236 YKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMS 295
           YK R+E +YYYHT+VAYIRLLYQ C+LVHADLSEYNTIVH+ KLYVIDVSQSV+PEHPMS
Sbjct: 265 YKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMS 324

Query: 296 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPV 355
           LDFLRMDIKN+N YFE+M IDIFPER IFQFVIS +L+KF G+  ++ DLR Y+A  L  
Sbjct: 325 LDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRP 384

Query: 356 KCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTAST 412
           K   EDE +DE+FRSLHLVRNL GLEERDFDRFT GKFDLLK+LIA DNQK   NFTAS 
Sbjct: 385 KSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASE 444

Query: 413 Q 413
           Q
Sbjct: 445 Q 445

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/417 (68%), Positives = 330/417 (79%), Gaps = 43/417 (10%)

Query: 1   MSLEGKFDKLKVHE-SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59
           M LE +  KLK+ + ++H N++ILEK+ ++IKTDELS TKGKTNKDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKEL 119
           TM+ L+ L+NRGV+ EFNGCLSTGKEANVYHA +G        E  P+ SE         
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG------ATEGAPEKSE--------- 105

Query: 120 IPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179
                                   YA+KIYKTSILVFKDRERYVDGEFRFRNARS HNPR
Sbjct: 106 ------------------------YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPR 141

Query: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239
           KMIKIWAEKEFRNL+RI+QSG+IP P+PVE+K N+LVMEFL RGDGFASPRL+D+ +K R
Sbjct: 142 KMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDR 201

Query: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299
           +EI +YYH +V+YIRLLYQVC+LVHADLSEYN+IVH  KLY+IDVSQSV+PEHPMSLDFL
Sbjct: 202 DEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFL 261

Query: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359
           RMDIKN+N YFE+MGIDIFPER+IFQFVIS  LDKF GD RS+ DLR+Y+A  LP K T 
Sbjct: 262 RMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTA 321

Query: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTASTQ 413
           +DE +D++FRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN K    FTAS Q
Sbjct: 322 QDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQ 378

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/417 (68%), Positives = 335/417 (80%), Gaps = 17/417 (4%)

Query: 1   MSLEGKFDKLKVH---ESEHINSKILEKYGHKIKTDELSDTK-GKTNKDKANRATVENVL 56
           MS+E KF+KL +    + +  N+K+L+KY HKIK D+ S +K  KT KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 57  DPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLN 116
           DPRTM+ L+ L+NRG+I +FNGCLSTGKEANVYHAFAGDG  + +   LP    L   L 
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASG-TLPDEESLLARLT 119

Query: 117 KELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQH 176
           +E                Q  +  +KEYAIKI+KTSILVFKDRERYVDGEFRFRN+RSQH
Sbjct: 120 QE------------ERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQH 167

Query: 177 NPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQY 236
           NPRKMIKIWAEKEFRNL+RI+QSG +P P+PVEVK N+LVMEFL RGDGFASPRLRD+ Y
Sbjct: 168 NPRKMIKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPY 227

Query: 237 KTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSL 296
           K  + I  YY TLVAY+RL+YQVC LVHADLSEYN +VH+D+LY+IDVSQSV+PEHPMSL
Sbjct: 228 KDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSL 287

Query: 297 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVK 356
           DFLRMDIKNVN YF KMGIDIFPERIIFQFVIS  LDKF GD +SS DL  Y+   LPVK
Sbjct: 288 DFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVK 347

Query: 357 CTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
            T++DE++DE+FRSL+LVRNL+GLEERDFDRFT+GKFDLLK+L+A D +KNFTA+ Q
Sbjct: 348 KTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTAAEQ 404

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/423 (66%), Positives = 336/423 (79%), Gaps = 40/423 (9%)

Query: 1   MSLEGKFDKLKVHES-----EHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENV 55
           MSL+ + D L++ ++     +HIN++IL+K+ H IK DELS ++GKT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 56  LDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFA--GDGKVKGNAEVLPQISELED 113
           LDPRTM+ L+ L +RGVI +FNGC+STGKEANVYHAFA  G    +   EVLP       
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPN------ 114

Query: 114 VLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNAR 173
                                   L++R+E AIKI+KTSILVFKDRERYVDGEFRFRN+R
Sbjct: 115 ------------------------LEERRELAIKIFKTSILVFKDRERYVDGEFRFRNSR 150

Query: 174 SQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRD 233
           SQHNPRKMIKIWAEKEFRNL+RI+QSG++PAPEPVEV+ N+LVMEFL RG+GFASPRL+D
Sbjct: 151 SQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKD 210

Query: 234 HQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHP 293
           + YK REE  +YY+T+VAYIRLLYQ C+LVHADLSEYN IVH+ +LY+IDVSQSV+PEHP
Sbjct: 211 YPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHP 270

Query: 294 MSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYL 353
           MSLDFLRMDIKNVN YFE+M +D+FPER+IFQFVIS  LDKF+GD  SSVDLR+Y++  L
Sbjct: 271 MSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNL 330

Query: 354 PVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTA 410
           PVK   +DE +DE+FRSLHLVRNL GLEERDFDRFT GKFDLLK+LIA DN++    FTA
Sbjct: 331 PVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTA 390

Query: 411 STQ 413
           S Q
Sbjct: 391 SEQ 393

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/413 (67%), Positives = 329/413 (79%), Gaps = 11/413 (2%)

Query: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT 60
           M L+  F KL +  + H N++IL+K+GHKIKTDE S ++GKTNKDKANRATVENVLDPRT
Sbjct: 1   MVLDDDFQKLDL-SNNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPRT 59

Query: 61  MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELI 120
           M+ LK L +RG+I +FNGC+STGKEANVYHAFAGD       +       L +  +    
Sbjct: 60  MRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYD---- 115

Query: 121 PGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRK 180
                 P        T L+ RKEYAIKIYKTSILVFKDRERYVDGE+RFRN+RSQHNPRK
Sbjct: 116 ------PYSNPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRK 169

Query: 181 MIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTRE 240
           MIKIWAEKEFRNL+RI+QS +IP P+P+EVK N+LVMEFL RGDGFASPRL+D+ YK   
Sbjct: 170 MIKIWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHN 229

Query: 241 EIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFLR 300
           +I++YYHT++ YIRLLYQVCRLVHADLSEYNT+VH +KLYVIDVSQSVEPEHPMSLDFLR
Sbjct: 230 DIVHYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLR 289

Query: 301 MDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTDE 360
           MDIKN+N YFE+MG+ IF ERIIFQF IS  LD F G+  +  DLR Y+ + LP+K   +
Sbjct: 290 MDIKNINNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGK 349

Query: 361 DELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           D+ +DEIFRSLHLVRNL GLEERDFDR+TDGKFDLLK+LIA DN+KNF+AS Q
Sbjct: 350 DDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQ 402

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/379 (71%), Positives = 324/379 (85%), Gaps = 5/379 (1%)

Query: 35  LSDTKGKTNKDKANRATVENVLDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAG 94
           +S TKGKTNKDKANRATVENVLDPRTMK LK L +RGVI +FNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 95  DGKVKGNAEVLPQISELEDVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSIL 154
           D K+  +    P     ++ +++E +  ++E   I  EE + Q K +KEYA+KI+KTSIL
Sbjct: 61  DSKLHSDDTDEPHD---DNNIDEEALKEKLET-QINPEETRLQ-KDKKEYAVKIFKTSIL 115

Query: 155 VFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNI 214
           VFKDRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLRRI+QS +IP P+P+EVK N+
Sbjct: 116 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNV 175

Query: 215 LVMEFLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV 274
           L+MEFL RGDGFASPRLRD+ YK REE+I+YYH  +AY+RL+YQVCRLVHADLSEYN ++
Sbjct: 176 LIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILI 235

Query: 275 HDDKLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDK 334
           H++ +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQF+IS  LDK
Sbjct: 236 HNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDK 295

Query: 335 FTGDPRSSVDLRNYIAHYLPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFD 394
           FTG+     DLR+Y+A  LP+K T +DE +DEIFRSL+LVRNL+GLEERDFDR+TDGKFD
Sbjct: 296 FTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFD 355

Query: 395 LLKTLIASDNQKNFTASTQ 413
           LLK+LIA DN+KNF+A+ Q
Sbjct: 356 LLKSLIAHDNEKNFSAAEQ 374

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/417 (66%), Positives = 336/417 (80%), Gaps = 24/417 (5%)

Query: 1   MSLEGKFDKLKV-HESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59
           M LE K  +LK+   SEH NS+IL+K+ ++IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92

Query: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKEL 119
           TM+ L++LI+RG+I EFNGCLSTGKEANVYHAF       GNA  +  + +   V+ +  
Sbjct: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-------GNA--VDIVEKQHKVIRQSS 143

Query: 120 IPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179
           I    E  T           ++ EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 144 ICSDSEGDT-----------KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPR 192

Query: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239
           KMIKIWAEKEFRNL+RI+ +G+I  P+P+E+K N+LVMEFL RGDGFASP+L+D+ Y  R
Sbjct: 193 KMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDR 252

Query: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299
           +EI Y+YH +VAYIRLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFL
Sbjct: 253 QEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFL 312

Query: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359
           RMDIKN+N YF K+GI++F ER IFQFVIS +L+KF GD RS   L+ Y + YLP+K T+
Sbjct: 313 RMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTE 372

Query: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQ---KNFTASTQ 413
           EDE++DEIFRSLHLVRNL GLEE DFDRFT+GKFDLLK+L++ DNQ   K FTAS Q
Sbjct: 373 EDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQ 429

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  497 bits (1280), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 250/414 (60%), Positives = 301/414 (72%), Gaps = 47/414 (11%)

Query: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKG-KTNKDKANRATVENVLDPR 59
           MSLE +FD+L V + +  N++ILEKY ++I+    +  KG KT KDK++RATVENVLDPR
Sbjct: 1   MSLETEFDRLHVSKHQD-NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDPR 59

Query: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKEL 119
           TMK L  L NRGVI EFNGC+S+GKEANVYHAF  +G+                      
Sbjct: 60  TMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEGQ---------------------- 97

Query: 120 IPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179
                                  E AIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 98  -----------------------ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPR 134

Query: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239
           KMIKIWAEKEFRNLRRI  SG++P   PVEVK N+LVM+FL RGDG  SPRL+D+QYK  
Sbjct: 135 KMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDE 194

Query: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299
            E+ +YY+  +AY+RLLYQVCRLVHADLSEYN +VH + L++IDVSQSVEP HPMSLDFL
Sbjct: 195 LEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFL 254

Query: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359
           RMDIKN+N YF KMG+ +F ER+IFQF+I+  L+ F GD +++ DL  Y+  +LP+K   
Sbjct: 255 RMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPT 314

Query: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQ 413
           E   +DEIFRSLHLVR+L GLEERDFDRFTDGKFDLLK+LIA+DN++N     Q
Sbjct: 315 EGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNERNLQRPQQ 368

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 106/257 (41%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  I+   G +  GKE+++Y   A DG         P++ ++           
Sbjct: 84  ALKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGN--------PRVMKIH---------- 125

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                   ++ +TS    ++   Y+      RN +   N   + 
Sbjct: 126 ------------------------RLGRTSFHTVRNNRDYL------RNTKQGVNWMYLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I+VME +    G+   RLR H+      I
Sbjct: 156 RLAANKEYQFMSMLYTKGF-EVPEPFDNSRHIIVMELI---KGYPMRRLRKHK-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV-------HDDKLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++       +D    VID  Q +  +H  +
Sbjct: 207 PKLYSDLMNFIVKLGN-SGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 AYYFQRDVDCIRRFFKK 282

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 98/216 (45%), Gaps = 30/216 (13%)

Query: 111 LEDVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYA--IKIYK---TSILVFKDRERYVDG 165
           L  +LN+E++        +  E +  Q+  R   A  +KI++   TS    K+   Y+  
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQVSDRNGTAKVMKIHRLGRTSFHTVKNNRDYL-- 142

Query: 166 EFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDG 225
               RN+R   N   + K+ A KEF  +  ++  G I  P+      +++VM+ +   DG
Sbjct: 143 ----RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCSRHVVVMDLI---DG 194

Query: 226 FASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDK------- 278
           +   RLR+H+      I   Y  L+ +I  L     L+H D +E+N ++ +D+       
Sbjct: 195 YPMRRLREHK-----NIPKLYSDLMTFIVKLAN-SGLIHCDFNEFNIMIKNDEAVTDEKD 248

Query: 279 --LYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEK 312
               VID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 249 CGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 104/257 (40%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++     +  GKE+++Y     DG         P++ ++           
Sbjct: 84  ALKTMLNRDTVYSVGNTIGVGKESDIYKVSDKDGN--------PRVIKIH---------- 125

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                   ++ +TS    ++   Y+      R +    N   + 
Sbjct: 126 ------------------------RLGRTSFHTVRNNRDYL------RKSSQGANWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I+VME +   +GF   RLR H+      I
Sbjct: 156 RLAANKEYQFMSMLYSKGF-KVPEPFDNSRHIVVMELI---NGFPMRRLRKHK-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD-------KLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++ D+          VID  Q V  +H  +
Sbjct: 207 PKLYSDLMCFIVQLGN-SGLIHCDFNEFNVMIKDELEDENDCGFVVIDFPQCVSIQHQDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 105/257 (40%), Gaps = 64/257 (24%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++   G +  GKE+++Y     +G      E + +I  L           
Sbjct: 84  ALKTMLNRETVYSVGGTIGVGKESDIYRVSDRNG-----TEKVMKIHRLG---------- 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                      +TS    K++  Y+      +NA++  N   + 
Sbjct: 129 ---------------------------RTSFHTVKNKRDYIK-----KNAKNGVNWMYLS 156

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           KI A KE++ +  +F  G    PE  +   + +VME +    G+   RLR H+      I
Sbjct: 157 KIAAGKEYQFMTLLFAKGF-DVPEAFDCSRHCIVMELI---KGYPMRRLRKHK-----NI 207

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV-------HDDKLYVIDVSQSVEPEHPMS 295
              Y  L+++I  L     L+H D +E+N ++       +D    VID  Q +  +H  +
Sbjct: 208 PKLYSDLMSFIVKLGN-SGLIHCDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDA 266

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 267 EFYFKRDVDCIRRFFKK 283

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 107/257 (41%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++     +  GKE+++Y     +GK        P++ ++           
Sbjct: 84  ALKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGK--------PRVMKIH---------- 125

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                   ++ +TS    ++   Y+      RN+    N   + 
Sbjct: 126 ------------------------RLGRTSFHSVRNNRDYL------RNSNQGANWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I+VME +   +G+   RLR H+      I
Sbjct: 156 RLAANKEYQFMSMLYSKGF-KVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTI----VHDDK---LYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N +    V D+K     VID  Q V  +H  +
Sbjct: 207 PKLYSDLMCFIVELAN-SGLIHCDFNEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DYYFQRDVDCIRRFFKK 282

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 103/257 (40%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LK+L+N+  ++   G +  GKE+++Y          GN  VL +I  L          G
Sbjct: 84  ALKSLLNKDTVYSIGGTIGVGKESDIYEG----SDKNGNKRVL-KIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+  +                                   R +    N   + 
Sbjct: 129 RTSFHTVKNNRDY---------------------------------LRRSNQGTNWMNLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           K+ A KE++ +  ++  G    PEP +   +++VME +    G+   RLR H+     +I
Sbjct: 156 KLAANKEYQFMSLLYTKGF-KVPEPFDNSRHVIVMELI---RGYPMRRLRKHK-----DI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD-------KLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++ D+          VID  Q +  +H  +
Sbjct: 207 PKLYSDLMKFILQLAN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DFYFKRDVDGIRRFFKK 282

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 106/257 (41%), Gaps = 64/257 (24%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++   G +  GKE+++Y     +G  K     + +I  L          G
Sbjct: 84  ALKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGVSK-----VMKIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+++  +  +                                +N ++  N   + 
Sbjct: 129 RTSFHTVRNNRDYLK--------------------------------KNVKNGVNWMYLS 156

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I++M  +   +G+   RLR H       I
Sbjct: 157 QLAANKEYQFMSMLYTKGF-EVPEPFDNSRHIIIMGLI---EGYPMRRLRKHN-----NI 207

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD-------KLYVIDVSQSVEPEHPMS 295
              Y+ L+ +I  L     L+H D +E+N ++ D+          VID  Q +  +HP +
Sbjct: 208 PKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDA 266

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 267 EFYFQRDVDCIRRFFKK 283

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 105/257 (40%), Gaps = 66/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
            LK ++NR  ++     +  GKE++VY   A DG         P++ ++  +       G
Sbjct: 84  GLKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGT--------PRVLKIHRL-------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+  +  +  Q                        G + F           + 
Sbjct: 129 RTSFTTVKNNRDYLKRNQ-----------------------SGSWMF-----------LS 154

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G +  PEP +   ++++M+ +   DG+   R+R H+      +
Sbjct: 155 RLAANKEYQFMSLLYSKGFV-VPEPFDNSRHMILMQLI---DGYPMRRMRSHK-----NL 205

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVH-------DDKLYVIDVSQSVEPEHPMS 295
              Y  L+++I  L     L+H D +E+N ++        D    VID  Q +  +H  +
Sbjct: 206 PKLYSDLMSFIVKLANHG-LIHCDFNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDA 264

Query: 296 LDFLRMDIKNVNGYFEK 312
            ++ + D+  +  +F K
Sbjct: 265 EEYFKRDVDCIRRFFAK 281

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 104/257 (40%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++     +  GKE+++Y     +G         P++ ++           
Sbjct: 84  ALKTMLNRNTVYSVGNTIGVGKESDIYKVSDKNGN--------PRVMKIH---------- 125

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                   ++ +TS    ++   Y+      +N+    N   + 
Sbjct: 126 ------------------------RLGRTSFHSVRNNRDYL------KNSNQGANWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I+VME +   +G+   RLR H+      I
Sbjct: 156 RLAANKEYQFMSMLYSKGF-KVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV-------HDDKLYVIDVSQSVEPEHPMS 295
              Y  L+ ++  L     L+H D +E+N +V        D    VID  Q V  +H  +
Sbjct: 207 PKLYSDLMCFVVELAN-SGLIHCDFNEFNIMVKDKVEDEQDCGFVVIDFPQCVSIQHQDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DYYFQRDVDCIRRFFKK 282

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 104/257 (40%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++     +  GKE+++Y     +G         P++ ++           
Sbjct: 84  ALKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGN--------PRVMKIH---------- 125

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                                   ++ +TS    ++   Y+      + +    N   + 
Sbjct: 126 ------------------------RLGRTSFHSVRNNRDYL------KKSNQGANWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I+VME +   +G+   RLR H+      I
Sbjct: 156 RLAANKEYQFMSMLYSKGF-KVPEPFDNSRHIVVMELI---EGYPMRRLRKHK-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV-------HDDKLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++       +D    VID  Q +  +H  +
Sbjct: 207 PKLYSDLMCFIVDLAN-SGLIHCDFNEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/259 (20%), Positives = 104/259 (40%), Gaps = 66/259 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LKT++NR  ++     +  GKE+++Y     +G      E + +I  L          G
Sbjct: 84  ALKTMLNRDSLYSVGNTIGVGKESDIYKVSDKNG-----VEKVMKIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+++  +  +                                +N+++  N   + 
Sbjct: 129 RTSFHTVRNNRDYLR--------------------------------KNSKNGANWMFLS 156

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           K+ A KE++ +  +   G    PEP +   +I++ME +    GF   RLR HQ      +
Sbjct: 157 KLAAAKEYQFMSLLHSRGF-RVPEPFDHSRHIIIMELI---KGFPMTRLRKHQ-----NV 207

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV---------HDDKLYVIDVSQSVEPEHP 293
              Y  L+ +I  L     L+H D +E+N ++         +D    VID  Q +  +H 
Sbjct: 208 PKLYSDLMKFILELGN-SGLIHCDFNEFNIMIKDKLDGSDPNDTGFIVIDFPQCISIQHQ 266

Query: 294 MSLDFLRMDIKNVNGYFEK 312
            +  + + D+  +  +F+K
Sbjct: 267 DASFYFQRDVDCIRRFFKK 285

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 102/257 (39%), Gaps = 66/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LK ++NR  ++     +  GKE+++Y          GN+ V+ +I  L          G
Sbjct: 84  ALKAMLNRDTVYSIGATIGVGKESDIYQV----SDRNGNSRVM-KIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+  +  + +Q   +                                    + 
Sbjct: 129 RTSFQTVKNNRDYLKGRQSASWMF----------------------------------LS 154

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    PEP +   +I++ME +    G+   RLR H      ++
Sbjct: 155 RLAANKEYQFMSLLYSKGF-KVPEPFDNSRHIILMELI---KGYPMRRLRKHH-----DL 205

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD-------KLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++ D+          VID  Q +  +H  +
Sbjct: 206 PKLYSDLMCFIVNLANHG-LIHCDFNEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDA 264

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 265 EYYFQRDVDCIRRFFKK 281

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 103/257 (40%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           ++K+++NR  ++ F   +  GKE+++Y     +G  K     + +I  L          G
Sbjct: 84  AVKSMLNRDTVYSFGNTIGVGKESDIYQVSDKNGVAK-----VMKIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+  +  +                                +NA    N   + 
Sbjct: 129 RTSFHTVKNNRDYLK--------------------------------KNAHGT-NWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
            + A+KE++ +  ++  G I  P+P +   +I++ME +   DGF    LR+H       I
Sbjct: 156 LLAAQKEYQFMSLLYSKGFI-VPQPYDNSRHIVLMELI---DGFPMRNLRNHS-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVH-------DDKLYVIDVSQSVEPEHPMS 295
              Y  L+ +   L     L+H D +E+N ++        D    VID  Q +  +H  +
Sbjct: 207 PKLYSDLMTFAVKLAN-SGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + DI+ +  +F K
Sbjct: 266 DFYFQRDIECIRRFFRK 282

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 107/257 (41%), Gaps = 65/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LK+L+N+  ++     +  GKE+++Y A   +G+ +     + +I  L          G
Sbjct: 84  ALKSLLNKDTVYSVGNTIGVGKESDIYQASDRNGEHR-----VMKIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+          ++Y  K  + +  +F                        + 
Sbjct: 129 RTSFHTVKNN---------RDYLKKYNQGASWMF------------------------LS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  ++  G    P+  +   +I+VME +    GF   RLR H     + I
Sbjct: 156 RVAANKEYQFMSLLYSKGFT-VPKAFDNSRHIVVMELI---KGFPLRRLRKH-----DNI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDK-------LYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++ D+K         VID  Q +  +H  +
Sbjct: 207 PKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDA 265

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 266 DFYFKRDVDCIRRFFKK 282

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 103/257 (40%), Gaps = 66/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
            L+ +++R  I+     +  GKE++VY   A DG    +A VL +I  L          G
Sbjct: 84  GLRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDG----SARVL-KIHRL----------G 128

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           +    T+K+  +  +  Q                        G + F           + 
Sbjct: 129 RTSFTTVKNNRDYLKRNQ-----------------------SGSWMF-----------LS 154

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           ++ A KE++ +  +   G    PEP +   ++++ME +   DG+    +R H+      +
Sbjct: 155 RLAANKEYQFMSLLHSKGFT-VPEPFDNSRHMILMELI---DGYPMRNMRLHK-----NL 205

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV-------HDDKLYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++        D+   VID  Q +  +H  +
Sbjct: 206 PKLYSDLMLFIVKLANHG-LIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDA 264

Query: 296 LDFLRMDIKNVNGYFEK 312
             F + D+  +  +F+K
Sbjct: 265 EFFFKRDVDCIRRFFKK 281

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 106/257 (41%), Gaps = 66/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LK+L+N+  ++     +  GKE+++Y                                 
Sbjct: 84  ALKSLLNKNALYSVGNTIGVGKESDIY--------------------------------- 110

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
             +V T  SE    ++        ++ +TS    K+   Y+    R ++A   H    + 
Sbjct: 111 --QVSTSTSEALVMKIH-------RLGRTSFHTVKNNRDYLK---RGQSASWMH----LS 154

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
            + A KE++ +  ++  G    P P +   +I++ME++    G+   RLR+H+     ++
Sbjct: 155 SLAANKEYQFMNLLYSKGF-KVPRPYDNSRHIILMEYI---KGYPMRRLREHK-----DL 205

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDK-------LYVIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++ D           VID  Q +  +H  +
Sbjct: 206 PRLYSELMKFIVQLGNHG-LIHCDFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKDA 264

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D++ +  +F+K
Sbjct: 265 EYYFQRDVECIRRFFKK 281

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 177 NPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQY 236
           N  ++  + AE+E+  +  ++  G    P+P     + +VME++    G+   RLR H  
Sbjct: 149 NWMRLSHLSAEREYAYMCLLYSKGF-SVPKPYANSRHAIVMEYI---RGYPMRRLRSHS- 203

Query: 237 KTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD-------KLYVIDVSQSVE 289
                +   Y  L+A++  L     ++H D +E+N ++ DD          VID  Q + 
Sbjct: 204 ----NVPKLYSDLMAFVVKLANHG-MIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCIS 258

Query: 290 PEHPMSLDFLRMDIKNVNGYFEK 312
            +H  +  + + D+  +  +F+K
Sbjct: 259 IQHQEAEYYFKRDVDCIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/258 (20%), Positives = 99/258 (38%), Gaps = 66/258 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           ++K ++NR  ++     +  GKE+++Y          GNA+V+ +I  L           
Sbjct: 84  AIKAMLNRDTVYSIGNTIGVGKESDIYKV----SDRNGNAQVM-KIHRL----------- 127

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
                        T ++  ++Y                         +++R   +   + 
Sbjct: 128 --------GRTSFTSVRNNRDY------------------------LKHSRQGTSWMHLS 155

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
            + A KE+  L  +   G    PE  +   ++++MEF+    GF    LR H       I
Sbjct: 156 LLAAHKEYEFLALLHSRGF-QVPEAFDNSRHMVLMEFI---KGFPMKNLRTHS-----NI 206

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDD--------KLYVIDVSQSVEPEHPM 294
              Y  L+ +   L +   L+H D +E+N ++ D            VID  Q +  +HP 
Sbjct: 207 PKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPD 265

Query: 295 SLDFLRMDIKNVNGYFEK 312
           +  F R DI+ +  +F+K
Sbjct: 266 AEFFFRRDIECIRRFFKK 283

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 105/257 (40%), Gaps = 66/257 (25%)

Query: 63  SLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIPG 122
           +LK+++NR  ++     +  GKE+++Y                 Q+S+           G
Sbjct: 84  ALKSMLNRDTLYSVGTTIGVGKESDIY-----------------QVSDRS---------G 117

Query: 123 QIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMI 182
           + +V  I                 ++ +TS    K+   Y+      RN +S  +   + 
Sbjct: 118 ESKVLKIH----------------RLGRTSFHTIKNNRDYL------RNGQSA-SWMHLS 154

Query: 183 KIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEI 242
           K+ A KE++ +  ++       P+P +   + ++ME +    G+   RL  H+      +
Sbjct: 155 KLAANKEYQFMTMLYDRNF-EVPQPFDNSRHCVLMEHI---RGYPMRRLGKHK-----NL 205

Query: 243 IYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV------HDDKLY-VIDVSQSVEPEHPMS 295
              Y  L+ +I  L     L+H D +E+N ++       DD  Y VID  Q +  +H  +
Sbjct: 206 PKLYSDLMCFIVKLANHG-LIHCDFNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDA 264

Query: 296 LDFLRMDIKNVNGYFEK 312
             + + D+  +  +F+K
Sbjct: 265 AYYFKRDVDCIRRFFKK 281

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 117 KELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRE-RYVDGEFRFRNARSQ 175
           K   P Q E  ++     + Q K   E   KI     L+F  R+ R VDGE R  N    
Sbjct: 412 KTWFPIQNETVSMDEHLHRNQHKPLPENWPKI-----LLFTPRQDRLVDGE-RLINHFIN 465

Query: 176 HNPRKMIKIWAEKEFRNLRRIFQSGII 202
           H P  + KIW   E+ +L  ++ S +I
Sbjct: 466 HEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 60/118 (50%), Gaps = 21/118 (17%)

Query: 148 IYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRI--FQSGIIPAP 205
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ +++R+   ++G     
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRVKLIENG----- 363

Query: 206 EPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLV 263
            P  +  +I++M+   + DG        H     +E++  +  ++    +L  +C LV
Sbjct: 364 -PRCIDLDIVMMK---KSDG-------QHVLWNSDELVIPHSRMLERTFVLEPLCELV 410

>ADL175W Chr4 (387431..388855) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL132W
          Length = 474

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 16/94 (17%)

Query: 62  KSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKELIP 121
           K + T+ + G+++EFN      +EAN Y     D   +GN ++LP    L+ V       
Sbjct: 286 KEMYTVFSGGLVYEFN------QEANNYGLV--DSDAEGNIKLLPDFDTLKKVY------ 331

Query: 122 GQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILV 155
           G++ +PT  +E+ Q  L++ +  A+ +   S  V
Sbjct: 332 GKVHMPT--AEDLQRGLEKDRAAAMAVSSKSRCV 363

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 272 TIVHDDKLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYF 310
           TI+  DK+ V+D  Q +E +HP +L      +KN +G+F
Sbjct: 54  TIIDYDKILVLDAGQVIEYDHPYTL------LKNESGHF 86

>Ecym_5316 Chr5 complement(638982..641282) [2301 bp, 766 aa] {ON}
           similar to Ashbya gossypii AER019C
          Length = 766

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 307 NGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAH 351
           NGY   + +++  + +I +  +   LDKF G P  ++D+ +Y+ H
Sbjct: 285 NGYLAHIELNLIYDGVITEPSLRRYLDKFHGKPCCAIDIGHYMEH 329

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 94  GDGKVKGNAEVLPQISELEDVLNKELIPGQIEVPTIKSEEE 134
           G  +V GN+EV   +S +ED++N  L P ++ VP + +EE+
Sbjct: 52  GTEQVTGNSEV---VSVVEDIVNPSLDPTEVLVPQLGNEED 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,564,908
Number of extensions: 2170096
Number of successful extensions: 7317
Number of sequences better than 10.0: 75
Number of HSP's gapped: 7510
Number of HSP's successfully gapped: 86
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)