Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017705.433ON21721711541e-163
Kpol_1062.305.433ON2142007431e-100
CAGL0A02794g5.433ON2162006507e-86
Suva_2.5395.433ON2272196454e-85
KAFR0E039305.433ON2112046383e-84
KNAG0C049205.433ON2172096323e-83
NCAS0F033705.433ON2112046183e-81
YDR367W (KEI1)5.433ON2212136133e-80
TDEL0E019205.433ON2202106115e-80
Smik_4.6335.433ON2212136002e-78
Skud_4.6365.433ON2342255934e-77
ZYRO0F10010g5.433ON2082075714e-74
SAKL0G02508g5.433ON2282205613e-72
TBLA0G020105.433ON2132045291e-67
TBLA0A065205.433ON2062145281e-67
AER256C5.433ON2392125181e-65
Kwal_55.214325.433ON2072074942e-62
Ecym_47625.433ON2212204743e-59
KLLA0E21099g5.433ON2242174502e-55
NDAI0B056605.433ON1611624372e-54
KLTH0F16082g5.433ON2062064203e-51
Ecym_56152.362ON825128760.32
NCAS0D040806.233ON117937665.6
KLLA0E22331g1.473ON14242628.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01770
         (217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   449   e-163
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   290   e-100
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   254   7e-86
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   253   4e-85
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   250   3e-84
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   248   3e-83
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   242   3e-81
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   240   3e-80
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   239   5e-80
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   235   2e-78
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   233   4e-77
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   224   4e-74
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   220   3e-72
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   208   1e-67
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   207   1e-67
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   204   1e-65
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   194   2e-62
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   187   3e-59
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   177   2e-55
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   172   2e-54
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   166   3e-51
Ecym_5615 Chr5 complement(1243063..1245540) [2478 bp, 825 aa] {O...    34   0.32 
NCAS0D04080 Chr4 (766605..770144) [3540 bp, 1179 aa] {ON} Anc_6....    30   5.6  
KLLA0E22331g Chr5 (1993214..1993642) [429 bp, 142 aa] {ON} simil...    28   8.0  

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  449 bits (1154), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 217/217 (100%), Positives = 217/217 (100%)

Query: 1   MVIGTSGRVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTA 60
           MVIGTSGRVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTA
Sbjct: 1   MVIGTSGRVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTA 60

Query: 61  IQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE 120
           IQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE
Sbjct: 61  IQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE 120

Query: 121 SNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKY 180
           SNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKY
Sbjct: 121 SNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKY 180

Query: 181 MIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217
           MIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA
Sbjct: 181 MIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  290 bits (743), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 162/200 (81%), Gaps = 3/200 (1%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LP+SFFGFLPLYIGVETVLGITI NKCSG YGILALFTGHPL   QWVSYLWS FTL+IY
Sbjct: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTVDKY 136
           +QGLFQVH P+LLTY QI + +SFDT  TC FT+ F S WFTE    G  ++  + VD+Y
Sbjct: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTE---TGSGMSDGSGVDEY 133

Query: 137 NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKNKSI 196
            QGASE+ E+ +T+ +T++ALVSR YFNFILA+F Q+LFLHPKYM+D DDVEQDLKNK+ 
Sbjct: 134 GQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLKNKNK 193

Query: 197 IVQWWIKSKKRCYYTSKRFL 216
           IVQWWIKSKK CY  ++  L
Sbjct: 194 IVQWWIKSKKSCYNLARHIL 213

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  254 bits (650), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 150/200 (75%), Gaps = 8/200 (4%)

Query: 18  PKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYA 77
           PKSFFGFLPLY+GVE VLGITI NKCSG YGILALFTGHPL  +QW+SYLWS FTL++++
Sbjct: 9   PKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFS 68

Query: 78  QGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWF---TEESN-----AGDNINS 129
           QGLF +H P L+ + QIL+ ++ DT+ TCFFT++F + WF    EE +      G + N 
Sbjct: 69  QGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQNY 128

Query: 130 STTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQ 189
             + D  +QGASE  E+  TM  TL+ L+ R YFNFILASF Q+L  HPKYM+DQDDVEQ
Sbjct: 129 RRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVEQ 188

Query: 190 DLKNKSIIVQWWIKSKKRCY 209
           DLKNKS I +WWIKS+K CY
Sbjct: 189 DLKNKSAIKRWWIKSQKFCY 208

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  253 bits (645), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 154/219 (70%), Gaps = 19/219 (8%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QWV+YLWS FTL+++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTV--- 133
           AQGL+ +H PNLL + QI + Y+ DTICTCFFT++F + WFT E NA    ++S+T    
Sbjct: 68  AQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQT 127

Query: 134 ----------------DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLH 177
                           D   QGASES E+  T+ +TL++L+ RFYFNFILASF Q+L  H
Sbjct: 128 INYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHH 187

Query: 178 PKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           PKY++D+DDVEQDLKNK I  + W KS+K CY   K  L
Sbjct: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  250 bits (638), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 148/204 (72%), Gaps = 3/204 (1%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF G LPLY+ VE VLGIT FNK SG +GILALFTGHPL  +QWV YLWS+ TL ++
Sbjct: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSS---TTV 133
           AQGLF++H PN+LT+ QI + YS DT+C CFFT++F   WF  ES     + S+    T 
Sbjct: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTITKRTE 127

Query: 134 DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKN 193
           D  +QGAS+  E+  T+ +TL +LV RFYFNFILASF Q+L  HPKYM DQDD+EQDLKN
Sbjct: 128 DISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDLKN 187

Query: 194 KSIIVQWWIKSKKRCYYTSKRFLA 217
           KSI  +WW+K +K CY   K  LA
Sbjct: 188 KSIWKRWWLKCQKSCYKLCKNLLA 211

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  248 bits (632), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 9/209 (4%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPK+FFG  PLYIGVE VLG+T+ NKCSG +GILALFTGHPL  +QW SYLWS FTL++Y
Sbjct: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTT---- 132
           AQGL+Q+H P LLT+ QI++ +S DT+ TC FT++F   WF EESN    + ++ +    
Sbjct: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVAR 127

Query: 133 -----VDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDV 187
                 +   QGA+ES E+ +T+ +T+++LV R YFNF+LASF Q+L  HP+Y++DQDD+
Sbjct: 128 LVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDI 187

Query: 188 EQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           EQDLKNK  + +WW+ S+K  Y   +  L
Sbjct: 188 EQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  242 bits (618), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 146/204 (71%), Gaps = 3/204 (1%)

Query: 17  LPK---SFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTL 73
           LPK   SFFG +PLY+GVE VLGITIFNKCSG YGILALFTGHPL  +QWV YLWS FTL
Sbjct: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67

Query: 74  LIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTV 133
           +I+AQGL+++H P LLT+ QIL+ YS DTICTC FT++F S WF  E    +        
Sbjct: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRRNE 127

Query: 134 DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKN 193
              +QGA+E+ E+  T+ +TL+ L  R YFN +LA+F Q+L  HPKY++DQDDVEQDLKN
Sbjct: 128 SLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKN 187

Query: 194 KSIIVQWWIKSKKRCYYTSKRFLA 217
           K +  +WWIK++K  Y      LA
Sbjct: 188 KPVWKRWWIKNQKWSYKVCSHLLA 211

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  240 bits (613), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 117/213 (54%), Positives = 151/213 (70%), Gaps = 13/213 (6%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QW++YLWS FTL+++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNA---GDNINSSTT- 132
           +QGL+ +H PNLL + QI + Y+ DTI TCFFT++F + WFT E  A   G+N   S   
Sbjct: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSNPI 127

Query: 133 ---------VDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMID 183
                    +D   Q A+ES E+  T+ +TL++L+ RFYFNFILASF Q+L  HPKY++D
Sbjct: 128 STGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVD 187

Query: 184 QDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           +DDVEQ+LKNK I  + W KS+K CY   K  L
Sbjct: 188 RDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  239 bits (611), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 151/210 (71%), Gaps = 9/210 (4%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF GF+PLYIGVE  LGI+I NKCSG YGILALFTGHPL ++QWV Y+WS FTL+I 
Sbjct: 11  LPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLIIC 70

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTVDK- 135
            QGL+Q+H PN+LT+  I IT+  DT+ T FFT++F + W+  E N+ +  ++ ++    
Sbjct: 71  VQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTKSSYSDA 130

Query: 136 --------YNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDV 187
                    +QGASE  E+  TM +T+++L  + YF FI+ASF Q+L LHP+YM+DQDDV
Sbjct: 131 PVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQDDV 190

Query: 188 EQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217
           EQDLK++S   +WWIKS+K CY  SK  LA
Sbjct: 191 EQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  235 bits (600), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 117/213 (54%), Positives = 151/213 (70%), Gaps = 13/213 (6%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF GF+PLY+ VE VLGI+I NKCSG+YGILALFTGHPL  +QWV+YLWS FTL+I+
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIF 67

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAG------DNINSS 130
           +QGL+ +H PNLL + QI   Y+ DT+ TCFFT++F + WFT E  AG      +N N  
Sbjct: 68  SQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSNLI 127

Query: 131 TT-------VDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMID 183
           +T        D   Q A+ES E+  T+ +TL++L+ RFYFN ILASF Q+L  HPKY++D
Sbjct: 128 STERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVD 187

Query: 184 QDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           +DDVEQ+LKNK I  + + KS+K CY   K  L
Sbjct: 188 RDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  233 bits (593), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 151/225 (67%), Gaps = 22/225 (9%)

Query: 14  PKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTL 73
           PK+  KSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QWV+YLWS FTL
Sbjct: 9   PKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTL 68

Query: 74  LIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE--SNAGDNINSST 131
           ++++QGL+ +H PNLL + QI I Y+ DTI TCFFT++F + WFT E  ++ G   NS+ 
Sbjct: 69  IVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTA 128

Query: 132 --------------------TVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFT 171
                               + DK  Q A+E+ E+  T+ +TL +L+ RFYFN IL SF 
Sbjct: 129 DTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFV 188

Query: 172 QQLFLHPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           Q+L  HPKY++D+DDVEQDLKNK I  + W KS+K CY   K  L
Sbjct: 189 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  224 bits (571), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 107/207 (51%), Positives = 145/207 (70%), Gaps = 1/207 (0%)

Query: 11  MQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSS 70
           M+T   LPK F GFLPLYIGVE  LG+TI NKCSG++GILALFTGHPL  +QWV YLWS 
Sbjct: 1   MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSI 60

Query: 71  FTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNIN-S 129
           F+ ++YAQGLF    P+LL + QI I +S DT  TC FT++F + W+T E N     + +
Sbjct: 61  FSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIA 120

Query: 130 STTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQ 189
           +  + + NQGAS+S EF  T+ +TL +L++R YFNF+LASF Q L  HP+YM+D  DVEQ
Sbjct: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180

Query: 190 DLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           +L+ + +  + W +++ RC   SK+ L
Sbjct: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  220 bits (561), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 144/220 (65%), Gaps = 19/220 (8%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSF GFLPLYIGVE  LGI+IFNK SG YGILALFTGHPL  +QW  Y  S  TLL+Y
Sbjct: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVY 68

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESN-------------- 122
             GL+Q+  PN LTY  +L+ ++ DT+  CFFTI+F + WF+ E N              
Sbjct: 69  LSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128

Query: 123 AGDNINSSTTVDKYN-----QGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLH 177
           AG  +  +  +++ N     Q AS+  E+  TM  T++ L  RFYFNFILA+F QQ+  H
Sbjct: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188

Query: 178 PKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217
           PKY++D+DDVEQDLKNKS+  +  IKS+K CY   +R LA
Sbjct: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  208 bits (529), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 136/204 (66%), Gaps = 5/204 (2%)

Query: 8   RVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYL 67
           R+     K+LP SFF   PLY+GVE +LGI I NKCSG YGILALFTGHPL+ +QW++Y+
Sbjct: 4   RITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63

Query: 68  WSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNI 127
           WS FTLLIY QG+F +  PN+  + QI   +S DTI T F T+YF   WF+ + +   + 
Sbjct: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSE 123

Query: 128 NSSTTVDK-----YNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMI 182
           NS    +K       QGAS + E F  + +TL  L+SR Y+N +LASF  +LF++PK++I
Sbjct: 124 NSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183

Query: 183 DQDDVEQDLKNKSIIVQWWIKSKK 206
           DQDDVE DLKNKS   ++   SKK
Sbjct: 184 DQDDVETDLKNKSFFKKFGGISKK 207

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  207 bits (528), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 104/214 (48%), Positives = 138/214 (64%), Gaps = 10/214 (4%)

Query: 5   TSGRVRMQTPK-LLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQW 63
           T  R R    + +LPK F G  PLY+GVE VLGITIFNKC G YGILALF GHPL   QW
Sbjct: 2   TPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQW 61

Query: 64  VSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNA 123
           V Y WS   L IYAQGL +VH P L T+ Q+ I +S DT+ TC FT+YF   WF      
Sbjct: 62  VLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA---- 117

Query: 124 GDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMID 183
                ++TT     QGAS++ E+  ++ +TL +LVSR YFNFI+ SF Q+LF  P Y +D
Sbjct: 118 -----NTTTRPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLD 172

Query: 184 QDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217
            D+VE +L++ S++ + W++++  CY  S+R L+
Sbjct: 173 TDEVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  204 bits (518), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 105/212 (49%), Positives = 139/212 (65%), Gaps = 13/212 (6%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LPKSFFG LPLYIGVE  LGI IFNK  G++G+LALFTGHPL  +QW+ YLWS  TLL+Y
Sbjct: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWF---------TEESNAGDNI 127
             GL Q++ P L  YC +L+ YS DTI TC +T++F   WF         T + +  D  
Sbjct: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDADAT 147

Query: 128 NSSTTVDKY---NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQ 184
             S TV+     +Q AS+S E+ +TM  TL AL  RFY NF++ASF Q++F H K+    
Sbjct: 148 QGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGC 207

Query: 185 DDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           DDVEQDLK+KS+  + + K ++ CY+  +R+L
Sbjct: 208 DDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  194 bits (494), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 138/207 (66%), Gaps = 18/207 (8%)

Query: 29  IGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNL 88
           +GVE  LGIT+ NKCSG YGIL L TGH L  +QWV YL S  T+++Y+ GL  ++ P++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 89  LTYCQILITYSFDTICTCFFTIYFCSHWF-------------TEESNAGDNINSSTTVDK 135
           L+Y  IL+T++ DT+ TCFFT++F   WF             T +S+AG+N  S   + K
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 136 Y-----NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQD 190
                 +Q AS+  E+F+T+ +T+ AL +RFYFNFI+ +F Q+L  HPKY++DQDDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 191 LKNKSIIVQWWIKSKKRCYYTSKRFLA 217
           LK++  + +WWI+++   Y   +R+LA
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  187 bits (474), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 135/220 (61%), Gaps = 22/220 (10%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LP+SFFG LPLYIGVE  LG+ IFNK  G+YGILALFTG PL  IQW  Y+WS   LL++
Sbjct: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFT-EESNAGDNINSST---- 131
            +GL QV+ P L+TYC +L  YS DT+  CFF + F   WF+ E++++G N  S      
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 132 ---------------TVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFL 176
                          TVD   Q AS   E+  T+ LTLI    RFY NFI+ASF +++  
Sbjct: 123 VDVGKSGTQNFAYRRTVDD-TQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMK 181

Query: 177 HPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
             +Y+ + DDVE DLKN S+  + ++ +++ CYY  +R+L
Sbjct: 182 QNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  177 bits (450), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 133/217 (61%), Gaps = 19/217 (8%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LP++F  + PLYIGVE  LG+  FNK SG+YG+LALFTGHPL  +QW  Y+WS F L+++
Sbjct: 10  LPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE---------------- 120
             G+ QV+ PN+L    +   +S DTI +C + ++F + WF++E                
Sbjct: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128

Query: 121 -SNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPK 179
            ++ G     ST VD  ++ AS   EFF  + LTL+ L  RFYFNFI+ +F QQL    K
Sbjct: 129 PAHEGTTSTISTKVDT-SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGK 187

Query: 180 YMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216
           +  DQ+D+E +L N++I+ +W  K +K C+Y  KR+L
Sbjct: 188 FTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  172 bits (437), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (70%), Gaps = 6/162 (3%)

Query: 61  IQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE 120
           +QWV+YLWS F L+I+AQGL+Q+H P LLT+ QI + ++ DT+ TCFFT++F + WF + 
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWF-QG 59

Query: 121 SNAGDNINSSTTVDKYN-----QGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLF 175
           S     + +ST V K +     QGA+   E+F TM +T I L  RFYFN ILASF Q+L 
Sbjct: 60  SEGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119

Query: 176 LHPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217
            +PK+MIDQDDVEQDLKNKS++ +WWIK++K CY   K  L+
Sbjct: 120 SNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  166 bits (420), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 137/206 (66%), Gaps = 17/206 (8%)

Query: 29  IGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNL 88
           +GVE  LGITI NKCSG YGIL L TGH L  +QWV YL S FTL++Y+ GL  V+ P L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 89  LTYCQILITYSFDTICTCFFTIYFCSHWF-------------TEESNAGDNINSSTTVDK 135
            TY  +L+T++ DT+ TCFFT++F   WF             T++++ G +  S     +
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 136 ----YNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDL 191
                +Q AS++ E+F+T+ ++LIALVSRFYFNFI+ +F Q+LF HPKY++DQDDV+QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 192 KNKSIIVQWWIKSKKRCYYTSKRFLA 217
           K+K +  +WWI+++   Y     +LA
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYLA 206

>Ecym_5615 Chr5 complement(1243063..1245540) [2478 bp, 825 aa] {ON}
           similar to Ashbya gossypii ADR279C
          Length = 825

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76
           LP  +FG L L  G++ ++      + S  YGI+ +F       +  V Y +  +  LIY
Sbjct: 656 LPAYYFGILALAHGMDMIVSQISKKRASLGYGIIGVF-------VASVLYFFVQYRALIY 708

Query: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTVDKY 136
                +    +L T  Q +  + +   C  F   Y       E+++A   I  + TV + 
Sbjct: 709 GTPWTK----DLCTKSQWMSGWDYG--CGNFLHSYDDYKSLPEDASAAQLITPTDTVVEK 762

Query: 137 NQGASESK 144
           N+ A+++K
Sbjct: 763 NKAANDAK 770

>NCAS0D04080 Chr4 (766605..770144) [3540 bp, 1179 aa] {ON} Anc_6.233
           YGL133W
          Length = 1179

 Score = 30.0 bits (66), Expect = 5.6,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 163 FNFILASFTQQLFL--HPKYMIDQDDVEQDLKNKSII 197
           FN  +   TQ++ +  H KYM+ +DD E    NKS +
Sbjct: 195 FNPTIDPVTQEVLVPGHAKYMLVEDDAESSSNNKSFV 231

>KLLA0E22331g Chr5 (1993214..1993642) [429 bp, 142 aa] {ON} similar
           to uniprot|P47111 Saccharomyces cerevisiae YJR044C VPS55
           Vacuolar Protein Sorting YJR044c
          Length = 142

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 84  HHPNLLTYCQILITYSFDTI---CTCFFTIYFCSHWFTEESN 122
           +H NL+ +   L+T S   I   C  FFT +F   W TE+ N
Sbjct: 97  YHSNLINHESALMTVSGGLIIYLCIVFFTWFFNGSWDTEDDN 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,532,199
Number of extensions: 993527
Number of successful extensions: 3469
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3540
Number of HSP's successfully gapped: 31
Length of query: 217
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 112
Effective length of database: 41,441,469
Effective search space: 4641444528
Effective search space used: 4641444528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)