Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017605.434ON31031016400.0
Kpol_1062.295.434ON31131011031e-152
NDAI0C016005.434ON31331110561e-144
Suva_8.1735.434ON31230910361e-141
Smik_15.2985.434ON31230910331e-141
YOR120W (GCY1)5.434ON31230910271e-140
CAGL0I01100g5.434ON31030910261e-140
NCAS0H020605.434ON32231210111e-138
Skud_15.2835.434ON31230910091e-137
TDEL0E019105.434ON3113099861e-134
KNAG0C049105.434ON3133119691e-131
Smik_4.6345.434ON3123099681e-131
TBLA0A065105.434ON3123089671e-131
YDR368W (YPR1)5.434ON3123099671e-131
KAFR0E03850singletonON3113099661e-131
Suva_2.5405.434ON3123099581e-130
KAFR0E038405.434ON3103099561e-129
Skud_4.6375.434ON3123099551e-129
CAGL0A02816g5.434ON3103109541e-129
SAKL0G02530g5.434ON3123109541e-129
ZYRO0F10032g5.434ON3103109321e-126
KLLA0B14707gsingletonON3103109301e-125
TBLA0A02825singletonON3112989251e-125
TPHA0G00210singletonON3113069151e-123
NDAI0B056705.434ON3183059071e-122
KLTH0E15532gsingletonON3093048901e-119
Kwal_47.18084na 1ON3093058871e-119
KLTH0F16060g5.434ON3093058731e-117
TDEL0D00230singletonON3123088681e-116
KLTH0E00220gsingletonON3063028621e-115
KLTH0A00528gsingletonON3063028621e-115
NCAS0F033805.434ON3133118621e-115
Kwal_55.214265.434ON3083048611e-115
TBLA0A02835singletonON3113108421e-112
KLTH0A03476gna 1ON3083028251e-109
AER401W5.434ON3133118101e-107
KLLA0D10109gsingletonON3093088031e-106
NDAI0A070003.108ON3203005392e-66
KNAG0K020703.108ON3233015272e-64
Kwal_56.226113.108ON3213145253e-64
KLLA0F02728g3.108ON3303095185e-63
KLTH0C10010g3.108ON3213145123e-62
KAFR0G013503.108ON3242935054e-61
NCAS0I024203.108ON3202965028e-61
ZYRO0B06138g3.108ON3283095002e-60
Smik_2.2883.108ON3443015013e-60
SAKL0C09922g3.108ON3223084993e-60
YBR149W (ARA1)3.108ON3443074942e-59
Smik_2.289singletonON3443074926e-59
Skud_2.2763.108ON3443074891e-58
TDEL0D051603.108ON3252774845e-58
SAKL0C10626gsingletonON3222914828e-58
Suva_4.3983.108ON3443074794e-57
Ecym_55085.409ON3263364358e-51
TBLA0F01720singletonON3263094192e-48
KAFR0C05320singletonON3273064167e-48
TBLA0A00630singletonON3283004096e-47
Suva_15.3005.409ON3273094089e-47
ACL107C5.409ON3543174082e-46
Skud_8.1655.409ON3273204062e-46
Smik_8.1825.409ON3273093992e-45
TPHA0E018605.409ON3263043983e-45
NDAI0D016005.409ON3273143983e-45
CAGL0I01122g5.409ON3263163973e-45
CAGL0C04543g7.468ON2872723935e-45
YHR104W (GRE3)5.409ON3272873941e-44
KLTH0F16610g5.409ON3293113932e-44
ZYRO0A06336g5.409ON3273293932e-44
Ecym_7160na 2ON2712883882e-44
KLLA0E21627g5.409ON3293103922e-44
Kwal_47.18893na 3ON2892903883e-44
KNAG0B03780singletonON3263023897e-44
Kwal_55.215365.409ON3293113897e-44
Kpol_1013.827.468ON2852873813e-43
KLLA0F03256g7.468ON2852793813e-43
NCAS0A066605.409ON3262963835e-43
SAKL0F14278g7.468ON2862883781e-42
NCAS0H005607.468ON2842903771e-42
SAKL0G01914g5.409ON3293173792e-42
KLTH0G02420gna 3ON2893193736e-42
YJR096W7.468ON2822893727e-42
Kwal_47.182197.468ON2932893721e-41
KLTH0G05786g7.468ON2863003711e-41
KNAG0D013707.468ON2822883701e-41
TDEL0E021505.409ON3292913713e-41
Suva_12.1847.468ON2822723622e-40
Smik_10.3847.468ON2822923622e-40
KAFR0G009207.468ON2862823587e-40
ABL209Cna 2ON3102883608e-40
Skud_10.3187.468ON2822773588e-40
ZYRO0G17600g7.468ON2832933449e-38
Kwal_33.13276na 4ON3022883441e-37
KLTH0F01892gna 4ON3022873423e-37
TDEL0C033207.468ON2832823316e-36
Kpol_1020.137.285ON3133233284e-35
SAKL0F02574gna 3ON2893093161e-33
KLLA0F05775g7.285ON3093073136e-33
YDL124W7.285ON3123103136e-33
NCAS0A137407.285ON3093153111e-32
NDAI0A023007.285ON3133133084e-32
Kwal_47.19278na 5ON3143033022e-31
ZYRO0E09614gna 5ON3083123013e-31
Smik_4.1137.285ON3123112962e-30
KNAG0C041107.285ON3113122952e-30
Skud_4.1317.285ON3123082831e-28
TDEL0D02790singletonON3293022804e-28
KAFR0B012007.285ON3153082743e-27
TBLA0F019807.285ON3023172733e-27
Kpol_381.8singletonON3093102716e-27
CAGL0J09394g7.285ON3112902716e-27
SAKL0F00704gna 5ON3153212691e-26
KLTH0G00638gna 5ON3133122682e-26
SAKL0F09746g7.285ON3123072498e-24
ZYRO0C09196g7.285ON3123082481e-23
Ecym_32647.285ON3113272216e-20
Kwal_33.13274singletonON108841711e-14
Suva_12.272singletonON265208995e-04
TBLA0B10110singletonON345345996e-04
Suva_4.1227.285ON206184930.002
Kwal_26.83772.604ON33882890.013
TDEL0A08000singletonON319256870.019
TBLA0G01120singletonON343112870.022
NCAS0A03110singletonON344130860.027
Ecym_22962.604ON340148840.040
KLTH0E01474gsingletonON313273840.049
TBLA0G00960singletonON321114830.063
ABR094W2.604ON359130800.15
KAFR0C04240singletonON343126780.24
Suva_5.2077.378ON767194780.30
YDL243C (AAD4)singletonON32999770.32
NDAI0G012103.441ON164872780.34
YER091C (MET6)7.378ON767231770.38
Kwal_47.16887singletonON313205750.57
NDAI0B009305.76ON940106740.95
NDAI0C01480singletonON34397730.99
NDAI0B013002.604ON333116731.2
Suva_14.10na 6ON376100721.6
NCAS0A129502.604ON32381711.6
KLTH0D08844g2.604ON34081711.7
YFL056C (AAD6)singletonON212103701.8
Kpol_449.4singletonON34192712.0
YNL331C (AAD14)na 6ON37699702.3
Suva_9.17singletonON308208702.3
KLLA0F19360gsingletonON34467702.7
ZYRO0F00858g2.604ON346120702.7
Smik_14.1na 6ON376102702.8
Smik_5.2327.378ON767231703.2
KLTH0E16852gsingletonON37599685.0
KNAG0M023402.604ON30937675.1
ZYRO0F04840gsingletonON379265675.9
Skud_10.383na 7ON376104668.2
ZYRO0F18524g1.3ON335117658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01760
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   636   0.0  
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   429   e-152
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   411   e-144
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   403   e-141
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   402   e-141
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   400   e-140
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   399   e-140
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     394   e-138
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   393   e-137
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   384   e-134
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   377   e-131
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   377   e-131
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   377   e-131
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   377   e-131
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     376   e-131
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   373   e-130
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   372   e-129
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   372   e-129
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   372   e-129
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   372   e-129
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   363   e-126
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   362   e-125
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     360   e-125
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 357   e-123
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   353   e-122
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   347   e-119
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   346   e-119
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   340   e-117
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   338   e-116
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   336   e-115
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   336   e-115
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     336   e-115
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   336   e-115
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     328   e-112
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   322   e-109
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   316   e-107
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   313   e-106
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   212   2e-66
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   207   2e-64
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   206   3e-64
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   204   5e-63
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   201   3e-62
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   199   4e-61
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   197   8e-61
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   197   2e-60
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   197   3e-60
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   196   3e-60
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   194   2e-59
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   194   6e-59
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   192   1e-58
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   191   5e-58
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   190   8e-58
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   189   4e-57
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   172   8e-51
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     166   2e-48
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   164   7e-48
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     162   6e-47
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   161   9e-47
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   161   2e-46
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   160   2e-46
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   158   2e-45
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   157   3e-45
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               157   3e-45
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   157   3e-45
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   155   5e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   156   1e-44
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   155   2e-44
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   155   2e-44
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   154   2e-44
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   155   2e-44
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   154   3e-44
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               154   7e-44
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   154   7e-44
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   151   3e-43
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   151   3e-43
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             152   5e-43
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   150   1e-42
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   149   1e-42
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   150   2e-42
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   148   6e-42
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   147   7e-42
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   147   1e-41
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   147   1e-41
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   147   1e-41
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   147   3e-41
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   144   2e-40
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   144   2e-40
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   142   7e-40
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   143   8e-40
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   142   8e-40
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   137   9e-38
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   137   1e-37
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   136   3e-37
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   132   6e-36
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   130   4e-35
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   126   1e-33
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   125   6e-33
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   125   6e-33
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   124   1e-32
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     123   4e-32
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   120   2e-31
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   120   3e-31
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   118   2e-30
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   118   2e-30
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   113   1e-28
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     112   4e-28
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   110   3e-27
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   109   3e-27
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   108   6e-27
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   108   6e-27
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   108   1e-26
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   107   2e-26
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   100   8e-24
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   100   1e-23
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    90   6e-20
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    70   1e-14
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    43   5e-04
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    43   6e-04
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    40   0.002
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    39   0.013
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              38   0.019
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    38   0.022
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    38   0.027
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    37   0.040
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    37   0.049
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      37   0.063
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    35   0.15 
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               35   0.24 
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    35   0.30 
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    34   0.32 
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    35   0.34 
YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}  ...    34   0.38 
Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {O...    33   0.57 
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    33   0.95 
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               33   0.99 
NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.6...    33   1.2  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    32   1.6  
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    32   1.6  
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    32   1.7  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    32   1.8  
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    32   2.0  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    32   2.3  
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     32   2.3  
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    32   2.7  
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    32   2.7  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    32   2.8  
Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON...    32   3.2  
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    31   5.0  
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    30   5.1  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    30   5.9  
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    30   8.2  
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...    30   8.9  

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC
Sbjct: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLAS 180
           KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLAS
Sbjct: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLAS 180

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
           AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 301 PNWTPFIPFV 310
           PNWTPFIPFV
Sbjct: 301 PNWTPFIPFV 310

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  429 bits (1103), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/310 (67%), Positives = 246/310 (79%), Gaps = 1/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           M+L N   +V LN G +LP VGLGTWQS ENDAYKAV+ ALK GYRHID AAIY NE EV
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEV 60

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+AI+DSGV R+EIFVTTKLWGTQ R P  AL QSLERLGLDYVDLYL+HWP+P+N AQC
Sbjct: 61  GKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQC 120

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
           ++  NYL  P   +G RD+DL +W+F+KTWELMQ LP + K K++GVSNFSINNIK+LL+
Sbjct: 121 EESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           SPGNK VP VNQ+ELHPLLPQ ELV FCK K IVVEAYSPLG TGA IL+   + E++KK
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             IP AN+V SW +QR +VVLPKSVTESRIISNLQT+ L  E+  K+ N+S E GEKR+ 
Sbjct: 241 YNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTC 300

Query: 300 KPNWTPFIPF 309
            P+++PF  F
Sbjct: 301 APDFSPFNTF 310

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/311 (65%), Positives = 238/311 (76%), Gaps = 3/311 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           TL NSTA   LN G  +P VGLGTWQS  EN+ Y+AV+ ALKAGYRHIDTAAIY NE++V
Sbjct: 4   TLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQV 63

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+AI DSG+ R EIFVTTKLWGTQHR P+ ALNQSLERLGLDYVDLYLMHWPV       
Sbjct: 64  GKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKPDSI 123

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
           K D NY  +PM  +G RDLDL +W+F+KTWELMQ LPK+ K +++GVSNFSINN+K LL+
Sbjct: 124 K-DGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKALLS 182

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           SPGNK VP  NQVE HPLLPQ EL +FCK K I++EAYSPLGST APIL    I E++KK
Sbjct: 183 SPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIAKK 242

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             + PA VV SW +Q+  VVLPKSV E RI +N QT EL  +E   LNN+S E GE+R V
Sbjct: 243 HNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERRIV 302

Query: 300 KPNWTPFIPFV 310
           +PNW PF+PFV
Sbjct: 303 QPNWAPFVPFV 313

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  403 bits (1036), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/309 (64%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL  ST  + LN G ++P VGLGTWQSK+NDAYK+VVAALK GYRHIDTAAIYGNE++VG
Sbjct: 4   TLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AIKDSGV R EIFVTTKLW TQH  P  AL+QSL+RLGLDYVDLYLMHWPV + D    
Sbjct: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRL-DPNYI 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
           KD + L IP  EDG+R +D+ +W+FIKTWELMQ LPK+ K +++GVSNFSINN+KDLLAS
Sbjct: 123 KDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLLAS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           PGN+  P  NQVELHPLLPQ EL++FCKSK I+VEAYSPLGST AP+L+   + E++KK 
Sbjct: 183 PGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAKKN 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + P +VV SW  QR  VVLPKSV   RI +N +   L  E+F  +NNIS E GEKR V 
Sbjct: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRVVN 302

Query: 301 PNWTPFIPF 309
           P+W+PF  F
Sbjct: 303 PDWSPFEAF 311

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  402 bits (1033), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/309 (63%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL +ST  ++LN G Q+P VGLGTWQSK+NDAYK+V+AALKAGY+HIDTAAIY NE++VG
Sbjct: 4   TLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AIKDSGV R EIFVTTKLW TQH  P  AL++SL+RLGLDYVDLYL+HWP  + D    
Sbjct: 64  QAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARL-DTNYI 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
           KD + L +P   DG+R +D+ +W+FIKTWELMQ LPK+ K K+IGVSNFSINN+KDLLAS
Sbjct: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           PGNK  P  NQVE+HPLLPQ EL+ FCKSK I++EAYSPLGST AP+L+  TI +++KK 
Sbjct: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + P +VV SW  QR  VVLPKSV   RI +N +   L  E+F  +NNIS E GEKR V 
Sbjct: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302

Query: 301 PNWTPFIPF 309
           PNW+PF  F
Sbjct: 303 PNWSPFEAF 311

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL +ST  ++LN G Q+P +GLGTWQSKENDAYKAV+ ALK GYRHIDTAAIY NE++VG
Sbjct: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AIKDSGV R EIFVTTKLW TQH  P+ AL+QSL+RLGLDYVDLYLMHWP  ++ A  K
Sbjct: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            ++  L +P  +DG+R +D+ +W+FIKTWELMQ LPK+ K K++GVSNFSINN+KDLLAS
Sbjct: 124 NED-ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
            GNK  P  NQVE+HPLLPQ EL+ FCKSK IVVEAYSPLGST AP+L+   I E++KK 
Sbjct: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + P +VV SW +QR  VVLPKSV   RI +N +   L  E+F  +NNIS E GEKR V 
Sbjct: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302

Query: 301 PNWTPFIPF 309
           PNW+PF  F
Sbjct: 303 PNWSPFEVF 311

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 233/309 (75%), Gaps = 1/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
            L  +T+ + LN G  +P +GLGTWQS EN+ Y A + ALKAGYRHIDTAAIY NEEE+G
Sbjct: 3   ALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG 62

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           RAI+DS + R+E+FVTTKLWGTQHR+P +AL+QSL+RLGLDYVDLYLMHWPV +      
Sbjct: 63  RAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALK-TDLI 121

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASP 181
           KD N LQIP  EDG+RD+DL  W+F+KTWELMQ LPK K ++IGVSNFSINN+K+LL S 
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSK 181

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
           GNK VP  NQ+E+HPLLPQ EL+ FCK K IV+EAYSPLGST APIL+   I E++KK  
Sbjct: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
           +    +V SW  QR  VVLPKSV   RI  N +T +L  E+F+ L+N + + GE+R V P
Sbjct: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSP 301

Query: 302 NWTPFIPFV 310
           NW PF PFV
Sbjct: 302 NWGPFKPFV 310

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 239/312 (76%), Gaps = 3/312 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEE 59
           M+ SNST    LN G  +  VGLGTWQS  EN+ Y+AV+AALKAGYRHIDTAAIYGNE +
Sbjct: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71

Query: 60  VGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQ 119
           VG+AI DSGV R EIFVTTKLW TQH  P   LN SL+RLGLDYVDLYLMHWPV +N  +
Sbjct: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLN-PR 130

Query: 120 CKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLL 178
             KD N+L IP+  DG RD+++ +WD++KTWELMQ LPK+ K +++GVSNFSINN+K +L
Sbjct: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190

Query: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSK 238
           +SPGNK VP VNQVE+HPLLPQ EL+E+C SK I++EAYSPLGST APIL    +  ++K
Sbjct: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250

Query: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRS 298
           K  +  A +V SW +QR  +VLPKSV   RI +N +T++L  EE  ++NNIS E GE+R 
Sbjct: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310

Query: 299 VKPNWTPFIPFV 310
           V+P+W PF+PFV
Sbjct: 311 VQPHWEPFVPFV 322

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 235/309 (76%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL +ST  ++LN G Q+P VGLGTWQSK+NDAYK+V+AALK GYRHIDTAAIY NE++VG
Sbjct: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AI+DSGV R +IFVTTKLW TQH  P  AL+QSL RLGLDYVDLYLMHWPV + D    
Sbjct: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRL-DPDYI 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
           KD N L +P  +DG+R +D+ +W+FIKTWELMQ LPK+ K K++GVSNFSINN+KDLLAS
Sbjct: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
            GNK  P  NQVE+HPLLPQ EL++FC+ K I++E YSPLGST AP+L+   I E++KK 
Sbjct: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + PA+VV SW  QR  VVLPKSV   R+ +N +   L  E+F  +N IS   GEKR V 
Sbjct: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302

Query: 301 PNWTPFIPF 309
           PNW+PF  F
Sbjct: 303 PNWSPFEAF 311

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 230/309 (74%), Gaps = 3/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TLSN+T+ V LN G  +P VGLGTW+SKE D YKAV AALKAGYRHID AAIY NEEEVG
Sbjct: 4   TLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AI+DSG+ R E+F+TTKLW TQ R+P +AL QSLERLGL+YVDLYLMHWPVP+   +  
Sbjct: 64  KAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI- 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            D N L  P  EDG  D+D   WDF+KTWELMQ LPK+ K +S+GVSNFSINN+K+LLAS
Sbjct: 123 TDGNLLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           PGNK VP V QVE+HPLLPQ+ L +FCK  NI VEAYSPLG  GAP+L+   I +++ + 
Sbjct: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
                NVV SW +QR IV LPKS T  R++SNL+T +L  EE   +NN+S   G+KR+  
Sbjct: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNA 301

Query: 301 PNWTPFIPF 309
           P+ +PF  F
Sbjct: 302 PDMSPFPLF 310

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  377 bits (969), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 233/311 (74%), Gaps = 3/311 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKE-NDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           TLS +T+ + LN G  +  +GLGTW+S    DAY +V+AAL+AGYRHIDTAAIYGNE EV
Sbjct: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           GRAI++SGV R EIFVTTKLW TQH+ P+ AL+QSL+RLGLDYVDLYLMHWPV +   + 
Sbjct: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMR-GEN 122

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
             + + +  P   +G RD+D+  W+F+KTWELMQ LP++ K ++IGVSNFSINN+KDLLA
Sbjct: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           SPGNK VP  NQVE+HPLLPQ ELV+FC  K IV+EAYSPLGS  APIL+   I E++KK
Sbjct: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +  A VV SW +QR  +VLPKSV + RI +NL T  L +E+F  +NNIS   G KR +
Sbjct: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302

Query: 300 KPNWTPFIPFV 310
            P+W PF PFV
Sbjct: 303 DPDWEPFKPFV 313

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 227/309 (73%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL NS+A + LN G  +P +G GTW+S EN+ Y +V+AALKAGYRHID AAIY NEEEVG
Sbjct: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           RAIKDSGV R +IF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+   +  
Sbjct: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK-TETI 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            D N L IP  +DGT D+D   W+FIKTW+LMQ LPK+ K K++GVSNFSINNIK LL S
Sbjct: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P NK VP  NQ+E+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+LE   I +++KK 
Sbjct: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + PA ++ SW IQR  VVL KSV   RI+SN +   LP ++F  ++N+S   GEKR V 
Sbjct: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302

Query: 301 PNWTPFIPF 309
             W+ F  F
Sbjct: 303 MKWSSFPIF 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 236/308 (76%), Gaps = 2/308 (0%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           L NS   VTLN+G ++P VGLGTW+S+END Y +V+ ALKAGYRHIDTAAIY NE EVGR
Sbjct: 5   LKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGR 64

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           AIKDSGV R +IF+TTKLW T+ ++P  AL  SL+RLGLDYVDLYLMHWPV +N  +  K
Sbjct: 65  AIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLN-PRYIK 123

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKV-KSIGVSNFSINNIKDLLASP 181
           D++YL +P   DGTRD+D+ +WD+IKTWEL+Q LP + + +S+GVSNFSINN++ +L+SP
Sbjct: 124 DDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLSSP 183

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
           GNK  P VNQVELHPLLPQFEL ++C SK I +EAYSP GS  AP L+  TI +++ K  
Sbjct: 184 GNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAAKNG 243

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
           + PA V+ SW++QR IVVLPKSV E R+ISN +  +L  E+ ++++ ++   GEKR  KP
Sbjct: 244 VSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRINKP 303

Query: 302 NWTPFIPF 309
           +W PF  F
Sbjct: 304 DWDPFPVF 311

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 226/309 (73%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL NS+A + LN G  +P +G GTW+S +N+ Y +V+AALKAGYRHID AAIY NEEEVG
Sbjct: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           RAIKDSGV R EIF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+   +  
Sbjct: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV- 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            D N L IP  EDGT D+D   W+FIKTWELMQ LPK+ K K++GVSNFSINNIK+LL S
Sbjct: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P NK VP  NQ+E+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+L+   I +++KK 
Sbjct: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + PA ++ SW IQR  VVL KSV   RI+SN +   LP ++F  ++N+S   G KR V 
Sbjct: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302

Query: 301 PNWTPFIPF 309
             W  F  F
Sbjct: 303 MKWGSFPIF 311

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  376 bits (966), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 234/309 (75%), Gaps = 3/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKEN-DAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           TL N+T  + LN G  LP +GLGTW++ ++ + Y AV +AL+AGYRHIDTAAIY NEE V
Sbjct: 4   TLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVV 63

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           GRAI++SG+ R EIFVTTKLWGTQHR P  AL+QSLERLGLDYVDLYLMHWPVP+ +A+ 
Sbjct: 64  GRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPM-EAKY 122

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLAS 180
            K ++ L+ P   DG+  ++ + WDFIKTWELMQ LPK+K ++IGVSNFSINNI DLL S
Sbjct: 123 SKSSSLLEFPYRPDGSLAVE-SDWDFIKTWELMQELPKTKTRAIGVSNFSINNINDLLKS 181

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           PGNK VP  NQVELHPLLPQ ELV FC+ K IVVEAYSP GS  AP+L    I EV+KK 
Sbjct: 182 PGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKH 241

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            +  A V+ SW I+R I VLPKSV + R++SN +T  LP ++F+ +NN+S E GEKR V 
Sbjct: 242 DVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVVN 301

Query: 301 PNWTPFIPF 309
            +W+PF  F
Sbjct: 302 FDWSPFKIF 310

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 226/309 (73%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL NS+A + LN G  +P +G GTW+S +N  Y +V+AALKAGYRHID AAIY NEEEVG
Sbjct: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +AIKDSGV R EIF+TTKLWGT+ R P+ AL++SL+RLGLDYVDLYLMHWPVP+      
Sbjct: 64  KAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLK-TDTI 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            D ++L IP  EDGT D+D   W+F+KTW+LMQ LPK+ K K++GVSNFSINNIK+LL S
Sbjct: 123 TDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLKS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P NK VP  NQ+E+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+L+   I +++KK 
Sbjct: 183 PSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + PA ++ SW IQR  VVL KSV   R++SN +   LP ++F  ++N+S   GEKR V 
Sbjct: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRVVN 302

Query: 301 PNWTPFIPF 309
             W  F  F
Sbjct: 303 MQWNSFPIF 311

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  372 bits (956), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 230/309 (74%), Gaps = 4/309 (1%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQ-SKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           L NST  + LNDG+Q+P VGLGTWQ + E DAY AV AAL AGYRHIDTAAIY NE +VG
Sbjct: 5   LKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
            AI+DSGV R EIFVTTKLW  QH  P+ AL++SL+RLGLDYVDLYLMHWPV ++ +  K
Sbjct: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASP 181
           +  + L++    DGTR ++   W FI TWELMQ LPK+KV+SIGVSNFS+NN+KDLL +P
Sbjct: 125 E--SPLELMKRPDGTRPVE-TDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKAP 181

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
               VP +NQVELHPLLPQ+ELV++C+   I VEAYSPLGST AP+L    + +V+KK  
Sbjct: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
           + PA+VV SW++QR I+VLPKSV   R+ +NL+T  LP E+F  +  IS + GE+R   P
Sbjct: 242 VQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNP 301

Query: 302 NWTPFIPFV 310
           N+ PF  FV
Sbjct: 302 NFEPFKTFV 310

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 224/309 (72%), Gaps = 2/309 (0%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL NS+A + LN G  +P +G GTW+S +N+ Y +V+AALK GYRHID AAIY NEEEVG
Sbjct: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           RAIKDSG+ R EIF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+      
Sbjct: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK-TDTV 122

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180
            D N L IP  EDGT D+D   W+FIKTW+LMQ LPK+ K +++GVSNFSINNIK+LL S
Sbjct: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P NK VP  NQVE+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+L+   I +++KK 
Sbjct: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            + P+ ++ SW IQR  VVL KSV   R++SN +   LP ++F  + ++S   GEKR V 
Sbjct: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302

Query: 301 PNWTPFIPF 309
             W  F  F
Sbjct: 303 MKWASFPIF 311

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 229/310 (73%), Gaps = 2/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           M+L NSTA + LN G ++P VGLGTW+S  ND Y +V+AALK GYRHID AAIYGNE++V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           GRAIKDSGV R EIF+TTKLWGT+HR+P  AL+ SL+RLGLDYVDLYLMHWPV +  A  
Sbjct: 61  GRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALK-AHG 119

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
            ++ + L IP   DG  D+D+  WDFIKTWELMQ LPK+ K K+IGVSNFSINN+K L  
Sbjct: 120 SEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKN 179

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           SP    VP  NQVE+HPL PQ EL+E+CKS+NI++EAYSP GS  AP+L+   ++++++K
Sbjct: 180 SPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEK 239

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             I  A ++ SW +QR  VVLPKSV   RI +NL+ + L  E+   + N+S   GEKR V
Sbjct: 240 YNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLV 299

Query: 300 KPNWTPFIPF 309
           + +W+PF  F
Sbjct: 300 QLDWSPFPTF 309

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 234/310 (75%), Gaps = 2/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           + L NS+A V LN G  +P +GLGTW+S + +AY +V++A+K GYRHID+AAIYGNEE V
Sbjct: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+AI+DSGV R+E+FVTTKLWGTQ R+P+ AL+ SL+RLGLDYVDLYL+HWP+       
Sbjct: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
           K D++YL +P  +DG  D+D+  W+F+KTWEL+Q LP + K K++GVSNFS+NN+K+LLA
Sbjct: 123 K-DDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           SPGNK VP  NQVELHPLLPQ EL+EF KSK IV+EAYSPLGS G+P+L+   I EV+KK
Sbjct: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             + PA V+ +W IQR  V+LPKSV   R+ SN +  +L  E+  +++ IS E G KR V
Sbjct: 242 YGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFV 301

Query: 300 KPNWTPFIPF 309
            P+W  F  F
Sbjct: 302 HPDWPSFPIF 311

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 230/310 (74%), Gaps = 3/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           +TL NST+ + LN G  +P VGLGTW+SKEN+ YKAV+ ALKAGYRHID AA+YGNE EV
Sbjct: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+AI+DSGV R+EIF+TTKLW TQ R+P +AL+QSL+RLGLDYVDLYL+HWPVP+     
Sbjct: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
            KD N  Q     DG++D+DL  W+FIKTWELMQ L +S K K+IGVSNFS+NN+KDLLA
Sbjct: 122 -KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           +P  K  P VNQVELHPLLPQ +L++F K   IV+EAYSPLG   APIL   T+ E++K 
Sbjct: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +VV SW +Q+ +V LPKSVT SRI+ NL+ + L   + +K++ +    GE+R+ 
Sbjct: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299

Query: 300 KPNWTPFIPF 309
             +++PF  F
Sbjct: 300 YQDFSPFPIF 309

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 224/310 (72%), Gaps = 2/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           M+ SN +  + LN G  +P VGLGTW+S E DAY AVV+AL+ GYRHIDTAAIYGNEE V
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+ I+DSGV R EIFVTTKLWGTQ R P+ AL+ SL+RLGLDYVDLYL+HWPVP+N A  
Sbjct: 61  GKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLN-ASS 119

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
             D NYL  P   DG  D+D+  W+FIKTWE MQ LPKS K K+IGVSNFSI NI+ LLA
Sbjct: 120 ITDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLA 179

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           +  +  VP  NQ+E+HP LPQ EL+++CKSK I++EAYSPLGS+ + IL   TI  ++ K
Sbjct: 180 ANPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASK 239

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
               PAN++ SW   R  VVLPKSV   RI +NL+ ++L  E+  K+N ++  VG KR V
Sbjct: 240 YNAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYV 299

Query: 300 KPNWTPFIPF 309
            P+++PF  F
Sbjct: 300 APDFSPFAIF 309

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  360 bits (925), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 218/298 (73%), Gaps = 3/298 (1%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           L N TA V LN G  +P +GLGTW+S+ ND Y +V+AA K GYRHIDTAAIYGNE++VG+
Sbjct: 5   LKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQVGK 64

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           AI + GV RSE+FVTTKLWGTQ R P+ ALNQSL+RLGLDYVDLYL+HWPV        K
Sbjct: 65  AINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFK-TDTIK 123

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181
           D N L IP  +DG  D+D   W+FIKTWELMQ L K+ K K+IG+SNFSINNIK+LLA+P
Sbjct: 124 DGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLAAP 182

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
                P  NQVE+HPLLPQ EL+ FCK K IV+EAYSPLG   AP+L+  TI E++K+  
Sbjct: 183 TTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKRNN 242

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
           +    VV SW +QR  VVLPKSV ESRIISNL+T  L  ++ +K+NN+    GE R+ 
Sbjct: 243 VDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRTC 300

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 168/306 (54%), Positives = 221/306 (72%), Gaps = 1/306 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           +T  N      +    ++P V LGTW++  N+ Y AV+ ALKAGYRHID AAIY NEEEV
Sbjct: 3   VTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEEEV 62

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+AI+DSG+ R +IFVTTKLWGT+ R+P  AL+ SL+RLGLDYVDLYLMHWPV +  A  
Sbjct: 63  GKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALK-ADS 121

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLAS 180
             DN+ L IP    G  D+D+ +W+FIKTWELMQ LP SK K+IGVSNFSINN+ +LLA+
Sbjct: 122 ITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELPTSKAKAIGVSNFSINNLNELLAA 181

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P  K +P  NQ E+HPLLPQ EL+++C+ K I+VEAY PLG +  P++    I E++ KL
Sbjct: 182 PTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATKL 241

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
            +    ++ SW IQR  VVLPKSV + RI++N QT+ +PAEEF K+NN++ E G +RSV 
Sbjct: 242 GVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSVN 301

Query: 301 PNWTPF 306
            +++PF
Sbjct: 302 IDFSPF 307

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  353 bits (907), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 224/305 (73%), Gaps = 7/305 (2%)

Query: 12  LNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKDSGVR 70
           L+ G  +P +GLGTW+S   NDAY +V+AALK GYRHIDTAAIYGNE +VG+AI+DSGV 
Sbjct: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVP 72

Query: 71  RSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN----Y 126
           R+EIFVT+KLW  Q   P  ALNQ+L+RLGLDY+DLYLMHWPV  N    K ++     +
Sbjct: 73  RNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAF 132

Query: 127 LQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPGNKE 185
           + IP + +G  D+++ +W+FIKTWELMQ LP+S K K++GVSNFSINN+ DLLA+   K 
Sbjct: 133 MTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKV 192

Query: 186 VPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAIPPA 245
           VP  NQ+ELHPLL Q EL+++CK KNI+VEAYSP GS  APIL+  TIN ++KKL I   
Sbjct: 193 VPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVG 252

Query: 246 NVVFSWLIQR-KIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPNWT 304
            VV SW IQR   VVLPKSV E RII+N + + LP E+F  +NN+  E GE R V P+W+
Sbjct: 253 QVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWS 312

Query: 305 PFIPF 309
           PF  F
Sbjct: 313 PFPLF 317

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 218/304 (71%), Gaps = 3/304 (0%)

Query: 4   SNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRA 63
           +NS+A   L  G  +P +G GTW+S E D Y AV+ ALK GYRHIDTAA+YGNE  VGRA
Sbjct: 5   TNSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRA 64

Query: 64  IKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
           I+DSGV R ++FVTTKLW TQHR P  AL+QSL+RLGLDYVDLYL+HWP+P+   Q   D
Sbjct: 65  IRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLR-TQRITD 123

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK-SKVKSIGVSNFSINNIKDLLASPG 182
            N   +P  EDG  D+D   W ++KTWE+MQ LP  SK +++GVSNFS+  +++LLA+ G
Sbjct: 124 GNLFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASG 182

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAI 242
            K +P VNQVE HPLLPQ +L +FC   NI++EAYSPLGS G+P++E   + E++ K   
Sbjct: 183 TKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNA 242

Query: 243 PPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPN 302
            PA V+ SW I+R  V+LPKSVT SRI SN + ++L  ++F+K+NNI  E GEKR   P+
Sbjct: 243 DPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPD 302

Query: 303 WTPF 306
           W  F
Sbjct: 303 WFHF 306

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/305 (55%), Positives = 218/305 (71%), Gaps = 3/305 (0%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           L N+T    LN G  +P +G GTW+S E + Y AV++A+K GYRHID+AA+YGNE  VGR
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           AI+DSGV R E+FVTTKLW TQ R P  AL+QSL+RLGLDYVDLYL+HWP+PI   +   
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRIT- 122

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181
           D N   IP  EDG  D+D   WD+IKTW+LMQ LP + K +++GVSN S++ ++ LLA  
Sbjct: 123 DGNLFSIPTKEDGKPDVD-TEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADK 181

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
           GNK VP V QVE HPLLPQ +L++FC   +I++EAYSPLGS G+P+++   I E++KK  
Sbjct: 182 GNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYN 241

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
             PA ++ SW I+R  VVLPKSVT SRI SNLQT++L  E+F K+N +  E GEKR   P
Sbjct: 242 ADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDP 301

Query: 302 NWTPF 306
            W  F
Sbjct: 302 EWFTF 306

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/305 (53%), Positives = 214/305 (70%), Gaps = 3/305 (0%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           L   TA   LN G Q+P +GLGTW+S + + Y A +AA+KAGYRHID AA+  NE+ VGR
Sbjct: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           AI+DSGV R E+FVTTKLW TQHR P  AL+QSL+RLGLDYVDLY+MHWPV     Q  K
Sbjct: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQV-K 123

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181
             NY+ IP  +DG  D+D   WD++KTWELMQ LP + K  ++GV+NFS++ +K L+ SP
Sbjct: 124 HTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSP 182

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
           GNK VP  +Q+E HP LPQ +++ FCK  NI++EAYSPLGS GAP+L+   + E+SKKL 
Sbjct: 183 GNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLH 242

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
           + PA ++ SW +QR   VL KS T SRI +NL T ++P  +  ++N ++ E G KR   P
Sbjct: 243 VEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNP 302

Query: 302 NWTPF 306
            W  F
Sbjct: 303 TWFSF 307

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/308 (54%), Positives = 220/308 (71%), Gaps = 3/308 (0%)

Query: 4   SNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRA 63
           S  T    LN G  LP +GLGTW+S E DAY AV++ALKAGY+HIDTAAIY NE  VG+A
Sbjct: 5   STKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKA 64

Query: 64  IKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
           I+DSG+ R E+F+TTKLW TQHR P  AL+ SLERLGLDYVDLYL+H+PV     +  +D
Sbjct: 65  IRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRI-ED 123

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPG 182
            N    P+  +G RD+D+  WDF+KTW L+Q LP+S K K++GVSNFSINN+K LL S  
Sbjct: 124 GNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDE 183

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA- 241
              VP VNQVE+HP LPQ EL++FCKSK+IVVEAYSPLGSTG+ +L   T+ ++++K   
Sbjct: 184 KFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXD 243

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
             PA ++ +W I R   VLPKSVT  RI +N + +++  E+  K+ N+   +G KR ++P
Sbjct: 244 AQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEP 303

Query: 302 NWTPFIPF 309
           +W+PF  F
Sbjct: 304 DWSPFPIF 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 217/302 (71%), Gaps = 2/302 (0%)

Query: 6   STAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK 65
           +T ++ +N G  +P +GLGTW++ + D Y+AV+AAL++GYRHIDTAAIY NE  VGRAI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
           DSGV R +IFVTTKLW TQ R P  ALN SLERLGLDYVDLYLMH+PV +      KD N
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALK-TDLIKDGN 120

Query: 126 YLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPGNK 184
            L IP+  DG RD+D+  W F+KTW+LMQ LPKS K K+IGVSNFSI NI+++L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 185 EVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAIPP 244
            VP  NQ+E+HP LPQ EL+E+CKSK I+VEAYSPLGS+ + +L    + ++++K  + P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 245 ANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPNWT 304
           A ++ SW + R   +LPKSV   R+ SNL+ ++L + +  +++ I  ++G KR V P+W 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 305 PF 306
           PF
Sbjct: 301 PF 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 217/302 (71%), Gaps = 2/302 (0%)

Query: 6   STAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK 65
           +T ++ +N G  +P +GLGTW++ + D Y+AV+AAL++GYRHIDTAAIY NE  VGRAI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
           DSGV R +IFVTTKLW TQ R P  ALN SLERLGLDYVDLYLMH+PV +      KD N
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALK-TDLIKDGN 120

Query: 126 YLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPGNK 184
            L IP+  DG RD+D+  W F+KTW+LMQ LPKS K K+IGVSNFSI NI+++L      
Sbjct: 121 VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGL 180

Query: 185 EVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAIPP 244
            VP  NQ+E+HP LPQ EL+E+CKSK I+VEAYSPLGS+ + +L    + ++++K  + P
Sbjct: 181 SVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEP 240

Query: 245 ANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPNWT 304
           A ++ SW + R   +LPKSV   R+ SNL+ ++L + +  +++ I  ++G KR V P+W 
Sbjct: 241 AQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWA 300

Query: 305 PF 306
           PF
Sbjct: 301 PF 302

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 227/311 (72%), Gaps = 3/311 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEE 59
           +TL  STA + LN G  +P + LGTW+S    D Y +V+AALKAGYRHIDTAAIYGNE++
Sbjct: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62

Query: 60  VGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQ 119
           VG+AI+DSG+ R EIFVT+KLW TQ  +P  AL  +L RLGLDY+DLYLMHWPV  N   
Sbjct: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122

Query: 120 CKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKV-KSIGVSNFSINNIKDLL 178
            K   +++ IP NE+G  D+++ +W+F+KTWELMQ LP + + K++GVSNFSINN+K+LL
Sbjct: 123 VK-GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELL 181

Query: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSK 238
            SPGNK  P  NQ+E+HPLLP+ +L++FC+ K I++EAYSPLGS  APIL+   I E+SK
Sbjct: 182 TSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISK 241

Query: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRS 298
           KL +PPA ++ SW +QR  VVL KS  E RII+N +   L  E+F  + N++ E G  R 
Sbjct: 242 KLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRV 301

Query: 299 VKPNWTPFIPF 309
           V P+W+PF  F
Sbjct: 302 VDPDWSPFPLF 312

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 214/304 (70%), Gaps = 2/304 (0%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           L   TA  TLN G ++P +GLGTW+  +   YKA++AALKAGYRHID+AA+  NE+ +G+
Sbjct: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           AI+DSGVRR E+FVTTKLW TQHR P  AL+QSL+RLGL+YVDLY+MHWP+     Q K 
Sbjct: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASPG 182
             N++ IP N +G   +D   WD++KTWELMQ LP  K ++IGV+NFS+  +  LL SP 
Sbjct: 125 -KNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKSPN 182

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAI 242
           NK +P  +Q+E HP LP  E++ FC+ K I++EAYSPLG  G P+++   I E+SKKL +
Sbjct: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242

Query: 243 PPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPN 302
            PA ++ SW ++R   VLPKS T++RI SNL+  +L  E++ +++ I+ E G KR+  P 
Sbjct: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPP 302

Query: 303 WTPF 306
           W  F
Sbjct: 303 WFSF 306

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 225/310 (72%), Gaps = 3/310 (0%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           +TL N T  +TLN+G ++P +GLGT+ SK+N+ Y+AVV A KAGYRH+DTAA Y NEE+V
Sbjct: 3   VTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQV 62

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
           G+A+KD GV RSE++VTTK+W T+ R P+ AL++SL+RLGL+Y+DLYLMHWPV +     
Sbjct: 63  GKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLK-TDT 121

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179
            KD   + IP   DG  D+D   W F++ WE MQ L KS KVKSIGVSNFSINNIK+LLA
Sbjct: 122 IKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLA 180

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
           +P    VPVVNQVE+ PLLP  EL+EFC+SK+I+ +AY P G + AP+++  T+ E++K 
Sbjct: 181 APTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKG 240

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +    V+ SW +QR  VVLPKSV ESRIISNL+T  L   + +K+NNIS   GEKR  
Sbjct: 241 NGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLN 300

Query: 300 KPNWTPFIPF 309
             N++PF  F
Sbjct: 301 NVNFSPFPIF 310

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  322 bits (825), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 206/302 (68%), Gaps = 4/302 (1%)

Query: 6   STAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK 65
           ST+   LN G  +P VGLGT+ S++   YKAV+ A+K GYRHID AA+Y NE+ VGRAI+
Sbjct: 7   STSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAIR 66

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
           DSGV R E+FVTTK+W TQHR P  AL +SL RLGLDYVDL+LMHWP  +   +   D N
Sbjct: 67  DSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERI-TDGN 125

Query: 126 YLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPGNK 184
            + +P  ED   D+D   W++IKTW LMQ LP S K K++GVSNFS+  ++ LLA PG+K
Sbjct: 126 MITVPKREDEKPDVD-TEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSK 184

Query: 185 EVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAIPP 244
            VP  NQVE+HPLLPQ  L +FCK KNI++ AYSPLGS  AP+L+   I E++ K    P
Sbjct: 185 VVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADP 244

Query: 245 ANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPNWT 304
           A ++  W ++R  V LPKSVT SRI SNLQ + L   E  K+N I  + GEKR V P W 
Sbjct: 245 AQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHKK-GEKRVVDPEWF 303

Query: 305 PF 306
            F
Sbjct: 304 DF 305

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  316 bits (810), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 221/311 (71%), Gaps = 7/311 (2%)

Query: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           TL  ST  VTLN G ++P  GLGTWQS ++DA  AV AALK GY+HIDTA+ Y NEE VG
Sbjct: 6   TLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVG 65

Query: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121
           +A+K+SG+ R E+F+TTK+W  Q R P  AL+ SL++LG +YVDL LMHWPVP  + +  
Sbjct: 66  KAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENS 125

Query: 122 KDNNYLQIPMNEDG--TRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDLL 178
             + Y ++P   DG  TRD     WDF+KTW LMQ L    KVK+IGVSNFSINN+++LL
Sbjct: 126 TLDAY-KVPRGPDGKVTRD---EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELL 181

Query: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSK 238
            + G   VP VNQVELH  LPQ ELVE+C+ K IVVEAYSPLGS+ AP+L+  T+N+V++
Sbjct: 182 NAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAE 241

Query: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRS 298
           K  + PA+V+ +++  R IVVLPKSV ESRIISN +  ++  E+   LN+I  + G +R 
Sbjct: 242 KYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRF 301

Query: 299 VKPNWTPFIPF 309
           V P+++PF  F
Sbjct: 302 VDPDFSPFPLF 312

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  313 bits (803), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 205/308 (66%), Gaps = 6/308 (1%)

Query: 4   SNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRA 63
           S     + LN G  +P +G GTW S   DAY AV+ ALK GYRHID AA+YGNE  VG+ 
Sbjct: 5   SGEFPSLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKG 64

Query: 64  IKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
           I+DSG+ R EIFVTTKLW TQ R P  AL++SLERLGLDYVDL+L+HWPVP+      + 
Sbjct: 65  IRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE- 123

Query: 124 NNYLQIPMNEDGTR-DLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181
            N L+ P    G +  +D   W FIKTWELMQ LPK+ K +++GVSNFSI N++DLL S 
Sbjct: 124 -NLLKYPT--PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSS 180

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
            +  VP VNQ E+HP LPQ EL+ +CKSK IVVEAY PLGS+ + +L   TI E++ K  
Sbjct: 181 PDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYH 240

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301
           + PANV+ +W I R   VLPKS T +RI SN   + L  E+  ++  +S  +G KR V P
Sbjct: 241 VKPANVLINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHP 300

Query: 302 NWTPFIPF 309
           ++ P+  F
Sbjct: 301 DFEPYPLF 308

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  212 bits (539), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 187/300 (62%), Gaps = 13/300 (4%)

Query: 1   MTLSNSTA-KVTLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNE 57
           MT   ST     LN+G ++P +GLGT   K+   +  +AV AA++AGYRHIDTA  Y  E
Sbjct: 1   MTHPTSTEIYFNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTE 60

Query: 58  EEVGRAIKD----SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPV 113
             +G+A+K+    + ++R E+F+TTK+W T   +P D+++QSL+ LG+DYVDL L HWPV
Sbjct: 61  PYIGQALKELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPV 120

Query: 114 PINDAQCKKDNNYLQIPMNEDGTRDLDL-ASWDFI-KTWELMQALPK-SKVKSIGVSNFS 170
                +  +  N + +P ++DG    +  A W F  K  E +   PK ++V++IGVSN+ 
Sbjct: 121 CFQKVENSQ-GNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYP 179

Query: 171 INNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILEL 230
           I  ++ L      K  P +NQVE+HP LPQ EL +FC    I++ AYSPLGS GAP L++
Sbjct: 180 IEYLERLFKE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKI 237

Query: 231 GTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNIS 290
            ++ +++KK  + PA+++ S+ I +  VVLP+S+   RI +N+   +L  ++ SKL+ + 
Sbjct: 238 KSVQDLAKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG 297

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  207 bits (527), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 188/301 (62%), Gaps = 19/301 (6%)

Query: 12  LNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD--- 66
           LN+G  +P +GLGT   +E+  +  +AV AA+KAGYRHIDTA  YG E  +G A+K+   
Sbjct: 13  LNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELLE 72

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD-- 123
              V+RS++F+T+K+W       D +LN+SL+ LGLDYVDLYL HWP+     +  KD  
Sbjct: 73  NGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKDGV 132

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL---PK-SKVKSIGVSNFSINNIKDLLA 179
           N     P+++DG   L +   D++ T++ M+ +   PK ++V++IGVSN+ +  +  LL 
Sbjct: 133 NGLKGKPIDKDGNA-LIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRLLK 191

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE+HP LPQFEL EFC+  +I + AYSPLGS+GAP+L+L  + E+S+K
Sbjct: 192 VCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELSEK 249

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +V+ S+ I++   V+P+S+   R+   +  + L   E  +L++I    G K S+
Sbjct: 250 YQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDI----GRKDSI 305

Query: 300 K 300
           +
Sbjct: 306 R 306

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  206 bits (525), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 191/314 (60%), Gaps = 14/314 (4%)

Query: 5   NSTAKVTLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           N+    TLN+G ++P +GLGT    E      +AV AA+K+GYRHIDTA  Y  E+ +G 
Sbjct: 6   NTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGE 65

Query: 63  AIKD----SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDA 118
           A+K+      ++R +IF+TTK+W T     D+++++SLE LG+DYVDL L HWP+  N  
Sbjct: 66  ALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRL 125

Query: 119 QCKKD-NNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSK---VKSIGVSNFSINNI 174
           Q  +  +   + P +EDG+   +    D+++T++ ++ +  SK    +SIGVSN+ +  +
Sbjct: 126 QDPEGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYL 184

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTIN 234
           + LL     K VP VNQVE+HP LPQ EL +FC   NI +EA+SP G+TG+P+++   + 
Sbjct: 185 ERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQ 242

Query: 235 EVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVG 294
           +V++K +  P +V+ ++ +++ +V +P+SV    I SN+Q + L  E+  +LN    E  
Sbjct: 243 KVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVE-N 301

Query: 295 EKRSVKPNWTPFIP 308
            KR V   +   IP
Sbjct: 302 PKRLVDEEFAVAIP 315

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  204 bits (518), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 183/309 (59%), Gaps = 15/309 (4%)

Query: 11  TLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD-- 66
           T N+GN++P  GLGT    E   +  +AV AA+KAGYRHIDTA  YG EE VG A+++  
Sbjct: 12  TFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELF 71

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
               V+R ++ +T+K+W T     D +LN+SL RL +DYVDL+L HWP+           
Sbjct: 72  EERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGV 131

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           +   + P+++ G    D    D+I+T++ ++ +       +V++IGVSNF I  +K +L 
Sbjct: 132 DKIAKEPVDDQGNPLYD-EKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLK 190

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               + VP  NQVELHP LPQ EL EFC    I+V AYSPLG  GAP+LEL  +  + +K
Sbjct: 191 E--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEK 248

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
               P +++ S+ +++  +V+P+S+  +RI SNL+ + L  E+ +KLN    +  +KR +
Sbjct: 249 YNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQK-NKKRYI 307

Query: 300 KPNWTPFIP 308
               +  IP
Sbjct: 308 NGAVSSVIP 316

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  201 bits (512), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 186/314 (59%), Gaps = 14/314 (4%)

Query: 5   NSTAKVTLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           N+    TLN+G ++P +GLGT    E      +AV AA+K+GYRHIDTA  Y  E+ VG 
Sbjct: 6   NTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGE 65

Query: 63  AIKD----SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDA 118
           A+K+      V+R +IFVTTK+W T     D+++++SLE LGLD+VDL L HWP+  N  
Sbjct: 66  ALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRL 125

Query: 119 QCKKD-NNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSK---VKSIGVSNFSINNI 174
           +     +   + P +EDG+   +    D+++T++ ++ L  +K    ++IGVSN+ +  +
Sbjct: 126 EDPDGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYL 184

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTIN 234
           + LL     + VP +NQVE HP LPQ EL +FC   NI +EAYSPLG+T AP+++   + 
Sbjct: 185 ERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVK 242

Query: 235 EVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVG 294
           +++ K A    NV+ ++ +++ +V +P+SV    I SN+Q + L  E+   LN    E  
Sbjct: 243 KIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVE-N 301

Query: 295 EKRSVKPNWTPFIP 308
            KR V   +   IP
Sbjct: 302 TKRIVDEPFAAAIP 315

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  199 bits (505), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 182/293 (62%), Gaps = 15/293 (5%)

Query: 12  LNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD--- 66
           LN+G  +P +G GT+  +E   +  +AV AA+KAGYRHIDTA +Y +E  VG AIK+   
Sbjct: 13  LNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMIE 72

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD-- 123
              V RS++FVTTK+W     + + +LN+SLE LGLDYVDL L HWP+     + +K+  
Sbjct: 73  EGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKNGV 132

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           N  +  P +++G   L+    DF++T+  ++ +       +V++IGVSN++I  ++ L  
Sbjct: 133 NGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEALFK 191

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  PVVNQVE+HP LPQ EL +FC +  I++ AYSPLGS GAP L++  ++++++K
Sbjct: 192 ECKVK--PVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLAEK 249

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSE 292
             +   +++ S+ I++   V+P+S+   RI S ++      EE  +L+N+  E
Sbjct: 250 YDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIE 302

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  197 bits (502), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 178/296 (60%), Gaps = 14/296 (4%)

Query: 5   NSTAKVTLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           N+     LN+G ++P +GLGT   K    +  KAV AA++AGYR IDTA  Y  E  +G 
Sbjct: 6   NTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGE 65

Query: 63  AIK----DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDA 118
           A+K    D  ++R ++F+TTK+W      P  ++N+SL+ LG+DYVD+ L HWP+     
Sbjct: 66  ALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKT 125

Query: 119 QCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL---PK-SKVKSIGVSNFSINNI 174
              ++   +  P+++DG + +     D+I T++LM+ +   PK ++V++IGVSN+ I  +
Sbjct: 126 Y-DENGTIIGKPLDKDG-KVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYL 183

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTIN 234
           + ++     K  PV+NQVELHP LPQ EL +FC    I++ AYSPLGS GAP  ++  + 
Sbjct: 184 ERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQ 241

Query: 235 EVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNIS 290
           E +KK  + PA+++ S+ +++  VV+P+S+   R+ SN+    L   E   L++  
Sbjct: 242 EYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 183/309 (59%), Gaps = 15/309 (4%)

Query: 11  TLNDGNQLPYVGLGTW--QSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD-- 66
           TLN+G ++P +GLGT     +     +AV AA+KAGYRHIDTA  YG+E  VG AIK+  
Sbjct: 15  TLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKELM 74

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVP-INDAQCKKD 123
               +RR +IF+T+K+W       + +LN+SLE LG+DY+DL+L HWP+  +        
Sbjct: 75  EEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVKQEDTHGI 134

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           N   + P   +G    ++   D+++T+  M+ +      ++V+SIGVSNF +  ++  L 
Sbjct: 135 NGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLERTLF 193

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE+HP LPQFEL +FC++ NI++EAYSPLGS  AP + L  + ++++K
Sbjct: 194 ECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQDLAEK 251

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
            ++ P+ ++ S+ I++   V+ +SV   RI SN++   L  EE   L+ +      KR V
Sbjct: 252 YSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGI-TKPKRFV 310

Query: 300 KPNWTPFIP 308
              W   +P
Sbjct: 311 NEKWNAVVP 319

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  197 bits (501), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 189/301 (62%), Gaps = 18/301 (5%)

Query: 11  TLNDGNQLPYVGLGTW--QSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD-- 66
           +LN+G ++P +GLGT   Q K  +  +AV AA+KAGYRHIDTA  Y  E  VG AIK+  
Sbjct: 26  SLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
               ++R ++F+TTK+W       D +LN+SL+ LGLDYVDL L HWP+     +  +  
Sbjct: 86  EEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEGI 145

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           + Y+++P+++ G + +  ++ D+++T++ ++ +       +V++IGVSNFSI  ++ L+ 
Sbjct: 146 SGYMKLPVDDSG-KTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIK 204

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE HP LPQ EL +FC   +I++ AYSPLGS GAP L++  + ++ +K
Sbjct: 205 ECKVK--PTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEK 262

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +++ S+ I++  +V+P+S+   RI SN++ + L  +E  +LN    E GEK  V
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN----EFGEKYPV 318

Query: 300 K 300
           +
Sbjct: 319 R 319

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  196 bits (499), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 180/308 (58%), Gaps = 15/308 (4%)

Query: 12  LNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD--- 66
           LN+G ++P VGLGT   K+      +AV AA+KAG+R IDTA  YG EE +G A+++   
Sbjct: 13  LNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQELFA 72

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
              V+R ++F+TTK+W       + +LN+SL+RL LDYVDL L HWP      Q  + + 
Sbjct: 73  EGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPEGSG 132

Query: 126 YL-QIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLAS 180
            L   P +EDG+   D A  D+++T++ ++A+      ++V++IGVSN+ I  ++ L   
Sbjct: 133 QLVNHPQHEDGSPFYDTAG-DWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERLFKE 191

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
              K VP +NQVELHP LPQ EL ++C    I++ +YSPLGS GAP L +  + E++ K 
Sbjct: 192 --CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELASKY 249

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300
                +V+ S+ I++  +V+P+S+   RI   L  + L  EE  KLN    E  E R + 
Sbjct: 250 NANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVE-HEYRYID 308

Query: 301 PNWTPFIP 308
             +   +P
Sbjct: 309 EAFCVCVP 316

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  194 bits (494), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 187/307 (60%), Gaps = 18/307 (5%)

Query: 11  TLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK--- 65
           +LN+G ++P +GLGT    E   +  +AV AA+KAGYRHIDTA  Y  E  VG AIK   
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 66  -DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
            D  ++R ++F+TTK+W       D +LN+SL+ LGL+YVDL L HWP+     +  K  
Sbjct: 86  EDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGI 145

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           +  ++ P+++ G + +  A  D+++T++ ++ +       +V++IGVSNFSI  ++ L+ 
Sbjct: 146 SGLVKTPVDDSG-KTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIK 204

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE HP LPQ EL +FC   +I++ AYSPLGS GAP L++  + ++++K
Sbjct: 205 ECRVK--PTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAEK 262

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +++ S+ I++  +V+P+S+   RI S+++   L  +E  +LN+     GEK  V
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF----GEKYPV 318

Query: 300 KPNWTPF 306
           +    PF
Sbjct: 319 RFIDEPF 325

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  194 bits (492), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 189/307 (61%), Gaps = 18/307 (5%)

Query: 11  TLNDGNQLPYVGLGTW--QSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD-- 66
           +LN+G ++P +GLGT   Q K  +  +AV AA+KAGYRHIDTA  Y  E  VG AIK+  
Sbjct: 26  SLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKELL 85

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
               ++R ++F+TTK+W       D +LN+SL+ LGLDYVDL L HWP+     +  K  
Sbjct: 86  EEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEKVKDPKGI 145

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           +  ++ P+++ G + +  ++ D+++T++ ++ +       +V++IGVSNFSI  ++ L+ 
Sbjct: 146 SGLVKTPVDDSG-KTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIK 204

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE HP LPQ EL +FC   +I++ AYSPLGS GAP L++  + ++ +K
Sbjct: 205 ECKVK--PTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEK 262

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +++ S+ I++  +V+P+S+   RI SN++ + L  +E  +LN    E GEK  V
Sbjct: 263 YNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN----EFGEKYPV 318

Query: 300 KPNWTPF 306
           +    PF
Sbjct: 319 RFIDEPF 325

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  192 bits (489), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 188/307 (61%), Gaps = 18/307 (5%)

Query: 11  TLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK--- 65
           +LN+G ++P +GLGT    E   +  +AV AA+KAGYRHIDTA  Y  E  VG AIK   
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 66  -DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
            D  ++R ++F+TTK+W       D +LN+SL+ LGLDYVDL+L HWP+     +  K  
Sbjct: 86  EDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEKVKDPKGL 145

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           +  ++ P+++ G + +  ++ D+++T++ ++ +       ++++IGVSNFSI  ++ L+ 
Sbjct: 146 SGLVKTPVDDSG-KTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERLIK 204

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE HP LPQ  + +FC   +I++ AYSPLGS GAP L++  + ++++K
Sbjct: 205 ECRVK--PTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLTEK 262

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +V+ S+ I++  +V+P+S+   RI S+++   L  +E  +LN+     GEK  V
Sbjct: 263 YNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF----GEKYPV 318

Query: 300 KPNWTPF 306
           +    PF
Sbjct: 319 RFIDEPF 325

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  191 bits (484), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 173/277 (62%), Gaps = 12/277 (4%)

Query: 12  LNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD--- 66
           LN+G ++P +GLGT    E   +  +AV AA+KAGYR+IDTA  YG+E  VG AIK+   
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
              ++R ++F+T+K+W       + +L +SL+ LG+DY+DL+L HWP+  N  +     N
Sbjct: 73  EGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNRREDPHGIN 132

Query: 126 YL-QIPMNEDGTRDL-DLASW-DFIKTWELMQALPK-SKVKSIGVSNFSINNIKDLLASP 181
            L + P   DG+ D  + A W D  K  E + + PK ++V++IGVSNF +  +K +L   
Sbjct: 133 GLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRVLKEC 192

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  PV+NQVE+HP LPQFEL EFC   +I + AYSPLGS GAP+++   I E+S+K  
Sbjct: 193 PVK--PVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLIKEMSQKYK 250

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
               +++ S+ I++   V+P+S+   RI SN++ + L
Sbjct: 251 ASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPL 287

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  190 bits (482), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 175/291 (60%), Gaps = 14/291 (4%)

Query: 12  LNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD--- 66
           LN G ++P +GLGT    E       AV  A+K GYR IDTA +YG+E  +G A+++   
Sbjct: 13  LNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELFE 72

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN 125
              V+R ++F+TTK+W   +   + +L +SL++L LDYVDL L HWP+     Q  +   
Sbjct: 73  EGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFV-KQYDEHGK 131

Query: 126 YLQIPMN-EDGTRDLDLASWDFIKTWELMQALPK---SKVKSIGVSNFSINNIKDLLASP 181
               P++ + G   LD    D++ TW+ ++ + K    +V++IGVSN+ +  ++ LL   
Sbjct: 132 LKSHPVDPKSGDIVLD-EKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             + VPV+NQVELHPLLPQ EL E+C S  I++E++SPLGS+G P LE   + E+SKK  
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSE 292
             P +V+ ++ +++  VV+P+S+   RII N   + L  E+  KL+ +  E
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGRE 299

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  189 bits (479), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 187/307 (60%), Gaps = 18/307 (5%)

Query: 11  TLNDGNQLPYVGLGTWQSKEN--DAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD-- 66
           TLN+G ++P +GLGT    E   +  +AV AA+KAGYRHIDTA  Y  E  VG AIK+  
Sbjct: 26  TLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD- 123
               ++R ++F+TTK+W       + +L++SL+ +GLDYVDL+L HWP+     +  K  
Sbjct: 86  EEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEKVKDPKGI 145

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----PKSKVKSIGVSNFSINNIKDLLA 179
           +  ++ P+++ G   L  ++ D+++T++ ++ +       +V++IGVSNFSI  ++ L+ 
Sbjct: 146 SGLVKTPVHKSGEAML-ASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLVK 204

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  P VNQVE HP LPQ EL +FC   +I++ AYSPLGS GAP L++  + ++ +K
Sbjct: 205 ECRVK--PTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLVEK 262

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299
             +   +V+ S+ I++  +V+P+S+   RI S+++   L  +E  +LN+     GEK  V
Sbjct: 263 YNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDF----GEKYPV 318

Query: 300 KPNWTPF 306
           +    PF
Sbjct: 319 RFIDEPF 325

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  172 bits (435), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 176/336 (52%), Gaps = 47/336 (13%)

Query: 7   TAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----R 62
           T   TLN+G ++P VGLG W+   + A   V  A+K GYR  D A  YGNE+E+G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQ 119
           AI +  V+R ++F+ +KLW   H HPD    AL ++L  LGLDYVDLY +H+P+PI    
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFH-HPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIK--- 119

Query: 120 CKKDNNYLQIPMNEDGTRDLDLASWD------------FIKTWELMQAL-PKSKVKSIGV 166
                    +P+ E    ++     D             + T+  M+ L  +  VKS+G+
Sbjct: 120 --------YVPLEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGL 171

Query: 167 SNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSP------- 219
           SNF    I+DLL   G +  PV  QVELHP L Q  LV + +SK+I V AYS        
Sbjct: 172 SNFQACLIQDLLR--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFL 229

Query: 220 -LGSTGA----PILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ 274
            LG++ A    P+LE   +  ++KK  + P+ V+  W  QR I V+PKS  + R+++NL 
Sbjct: 230 ELGNSAAKDVTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLN 289

Query: 275 TMELPAEEFSKLNNISSEVGEKRSVKP-NWTPFIPF 309
           + +      S++++I S     R + P +W     F
Sbjct: 290 SDKALTLSDSEMSDIFSLNKNLRFLDPWDWARLPGF 325

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  166 bits (419), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 164/309 (53%), Gaps = 31/309 (10%)

Query: 11  TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIKD 66
            LN+G ++P VGLG W+       + V  A+K GYR  D A  YGNE+EVG    RAI +
Sbjct: 6   ALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 67  SGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
             V+RS++F+ +KLW T H HPD    A+ ++L  LGLDY+DLY +H+P+       ++ 
Sbjct: 66  KIVKRSDLFIVSKLWNTYH-HPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEK 124

Query: 124 NNYLQIPMNEDGTR-DLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDLLASP 181
                    ED  +  + L    ++ T+  M+AL  +  +KSIGVSN     ++D+L   
Sbjct: 125 YPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM-- 182

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGT--------- 232
           G K  PV  Q+E HP L Q  LV++CK + I+V AYS  G      LELG+         
Sbjct: 183 GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQS--YLELGSELKEDTPNL 240

Query: 233 -----INEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---QTMELPAEEFS 284
                I  ++ K  +  + V+  W  Q  + V+PKS  + R++ NL    T+ L  EE  
Sbjct: 241 FDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELV 300

Query: 285 KLNNISSEV 293
           +++NI+  +
Sbjct: 301 EISNINRNI 309

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  164 bits (416), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 164/306 (53%), Gaps = 29/306 (9%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK---D 66
           VTLN+G ++P VGLG W+   +   + V  A+K GYR  D A  YGNE EVG+ IK   D
Sbjct: 5   VTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAID 64

Query: 67  SG-VRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
            G V+RS++FV +KLW + H HPD    AL ++L+ LGLDY+DLY +H+P+       ++
Sbjct: 65  EGLVKRSDLFVVSKLWNSYH-HPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEE 123

Query: 123 D---NNYLQIPMNEDGTRDLDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKDLL 178
                 Y  +    +G   L  A    + T+  L + +    +KSIG+SNF+   ++DLL
Sbjct: 124 KYPPGFYTGVDDAREGI--LSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLL 181

Query: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG------------STGAP 226
              G +  PV  Q+E HP L Q +LVE+CK K I V AYS  G             +   
Sbjct: 182 N--GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPS 239

Query: 227 ILELGTINEV-SKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSK 285
           +LE   I ++ +   +  P+ V+  W  QR I V+PKS  + R++ NL   +       +
Sbjct: 240 LLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEE 299

Query: 286 LNNISS 291
           LN ISS
Sbjct: 300 LNEISS 305

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  162 bits (409), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 161/300 (53%), Gaps = 38/300 (12%)

Query: 7   TAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----R 62
           TA +TLN+G ++P VGLG W+   +     V  A+K GYR  D AA YGNE+EVG    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQ 119
           A+ +  V+RS++F+ +KLW T H HPD    AL ++L  LGLDY+DLY +H+P+      
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFH-HPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVP 120

Query: 120 CKKDNNYLQIPMNEDGTRD-----LDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINN 173
            ++       P    G  D     + L +  ++ T+  M+ L  +   KSIGVSN   + 
Sbjct: 121 FEEK----YPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSI 176

Query: 174 IKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTI 233
           ++D+L   G +  P   Q+E HP L Q  LV+FCK++NI V +YS  G      LELG+ 
Sbjct: 177 LQDVLM--GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQS--FLELGSK 232

Query: 234 ----------NEVSKKLA------IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTME 277
                     + V KK+A      +  + V+  W  QR I ++PKS  + R++ NL   E
Sbjct: 233 RAEDTPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNE 292

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  161 bits (408), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 167/309 (54%), Gaps = 28/309 (9%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G ++P VGLG W+         +  A+K GYR  D A  YGNE+EVG    +AI 
Sbjct: 5   VTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           +  V R +IFVT+KLW   H HPD    AL ++L+ +GLDY+DLY +H+P+       ++
Sbjct: 65  EGLVTRKDIFVTSKLWNNFH-HPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPFEE 123

Query: 123 DNNYLQIPMNEDGTR-DLDLASWDFIKTWELMQA-LPKSKVKSIGVSNFSINNIKDLLAS 180
                     ED  R  +  A    I T+  ++A + +  +KSIG+SNF  + ++DLL  
Sbjct: 124 KYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLLR- 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTI------- 233
            G +  PV  Q+E HP L Q  LV++CK  +I V AYS  G      ++LG         
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTLF 241

Query: 234 -NEVSKKLA-----IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT---MELPAEEFS 284
            N+V KK++        + V+  W  QR I V+PKS  + R++ NL+    + L  +E  
Sbjct: 242 ENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQELK 301

Query: 285 KLNNISSEV 293
           +++++++ +
Sbjct: 302 EISSLNANI 310

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  161 bits (408), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 164/317 (51%), Gaps = 49/317 (15%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           + LN+G  +P VGLG W+     A + V  A+K GYR +D A  Y NE EVG    RAI 
Sbjct: 33  IKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAID 92

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           +  VRR E+FV +KLW   HR P+D   AL ++L  LGLDY+DL+ +H+P+         
Sbjct: 93  EGLVRREELFVVSKLWNNYHR-PEDVGKALQRTLSDLGLDYLDLFYIHFPLA-------- 143

Query: 123 DNNYLQIPMNEDGTRDLDLASWD------------FIKTWE-LMQALPKSKVKSIGVSNF 169
              +  +P+ E     L   + D             I+T+  L Q + + ++++IG+SNF
Sbjct: 144 ---FKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNF 200

Query: 170 SINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG-------- 221
               ++DLL   G +  P   Q+E HP L Q  LV++ KS+ + V  YS LG        
Sbjct: 201 QGCLVQDLLR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELG 258

Query: 222 ----STGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---Q 274
                  AP+L+   +  ++++    PA V+  W  QR I V+PKS  + R+ +NL   +
Sbjct: 259 NTAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDE 318

Query: 275 TMELPAEEFSKLNNISS 291
            + L  +E  +L++++ 
Sbjct: 319 ALTLADDELRELSSLNC 335

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 165/320 (51%), Gaps = 50/320 (15%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G ++P VGLG W+  +N     +  A+K GYR  D A  YGNE+EVG    +AI 
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIY 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           +  V R ++FV +KLW   H HPD    AL ++L  +GLDY+DLY +H+P+         
Sbjct: 65  EGLVTRKDVFVVSKLWNNFH-HPDHVKLALKKTLSDMGLDYLDLYYIHFPIA-------- 115

Query: 123 DNNYLQIPMNED-------GTRD-----LDLASWDFIKTWE-LMQALPKSKVKSIGVSNF 169
              +  IP  E        GT D     +  A    I T+  L + + +  +KSIG+SNF
Sbjct: 116 ---FKYIPFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNF 172

Query: 170 SINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILE 229
             + ++DLL   G +  PV  Q+E HP L Q  LVEFCK  +I V AYS  G      ++
Sbjct: 173 QGSLVQDLLR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMD 230

Query: 230 LGTI--------NEVSKKLA-----IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT- 275
           L           N+V KK++        + V+  W  QR I V+PKS  + R++ NL+  
Sbjct: 231 LQLAKATQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIE 290

Query: 276 --MELPAEEFSKLNNISSEV 293
               L  +E  K++ +++ +
Sbjct: 291 KKFSLTEQELKKISALNANI 310

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  158 bits (399), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 164/309 (53%), Gaps = 28/309 (9%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G ++P VGLG W+  +      +  A+K GYR  D A  YGNE+EVG    RAI 
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRRAIS 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQC-K 121
           +  V R ++FV +KLW   H HPD    AL ++L  +GLDY+DLY +H+P+        +
Sbjct: 65  EGLVARKDVFVVSKLWNNFH-HPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPFEE 123

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKDLLAS 180
           K        ++++    +  A    + T+  L + + +  +KSIG+SNF  + ++DLL  
Sbjct: 124 KYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLLR- 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTI------- 233
            G +  PV  Q+E HP L Q  LVEFC+  NI V AYS  G      ++L          
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPTLF 241

Query: 234 -NEVSKKLAI-----PPANVVFSWLIQRKIVVLPKSVTESRIISNLQT---MELPAEEFS 284
            N+V KK+++       + V+  W  QR I V+PKS  + R++ NL+      L  +E  
Sbjct: 242 ENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELK 301

Query: 285 KLNNISSEV 293
           +++ +++ +
Sbjct: 302 EISALNANI 310

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 160/304 (52%), Gaps = 25/304 (8%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           +TLN+G ++P VGLG W+   +     V  A+K GYR  D A  YGNE+EVG    +AI 
Sbjct: 5   ITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAIS 64

Query: 66  DSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
           +  V+R E+FV +KLW + H  +H   AL ++L  + LDY+DLY +H+P+       ++ 
Sbjct: 65  EGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPFEEK 124

Query: 124 NNYLQIPMNEDGTRD-LDLASWDFIKTWELMQALPKSK-VKSIGVSNFSINNIKDLLASP 181
                    ED  +  +       I T+  M+ L     +KSIG+SNF+   I+DLL S 
Sbjct: 125 YPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLLRSC 184

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG-----------STGAPIL-E 229
             K  P   Q+E HP L Q  L+E+CK  +I V AYS  G           +  A +L E
Sbjct: 185 KIK--PTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVLFE 242

Query: 230 LGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---QTMELPAEEFSKL 286
              I  ++   ++ P+ V+  W  QR I ++PKS  + R++ NL   + + L  +E S +
Sbjct: 243 HEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQELSTI 302

Query: 287 NNIS 290
           ++++
Sbjct: 303 SDLN 306

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 167/314 (53%), Gaps = 32/314 (10%)

Query: 7   TAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK- 65
           +A VTLN+G ++P VGLG W+   +   + +  A+K GYR  D A  YGNE+EVG+ IK 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 66  --DSG-VRRSEIFVTTKLWGTQHRHPDDA---LNQSLERLGLDYVDLYLMHWPVPINDAQ 119
             D G V+R ++F+ +KLW   H HPD     L ++L+ LGLDYVDLY +H+P+      
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFH-HPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVS 120

Query: 120 CKKDNNY---LQIPMNEDGTRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIK 175
              D  Y   +     ++    L   +   I T+  M+ L  +  +KSIG+SN++   + 
Sbjct: 121 --PDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVA 178

Query: 176 DLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG------------ST 223
           D L   G +  PV  Q+E HP L Q +L+E+CK  ++ V AYS  G              
Sbjct: 179 DTLR--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKN 236

Query: 224 GAPILELGTINEVSKKL-AIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---QTMELP 279
             P+ +  TI +++ K  A+  + V+  W  QR + ++PKS  + R++ NL   Q + L 
Sbjct: 237 TPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLA 296

Query: 280 AEEFSKLNNISSEV 293
            E+  +++ ++  +
Sbjct: 297 EEDLREISALNQNL 310

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  157 bits (397), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/316 (34%), Positives = 159/316 (50%), Gaps = 46/316 (14%)

Query: 7   TAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK- 65
           ++ VTLN+G ++P VGLG W+   +   + V  A+K GYR  D A  YGNE+EVG+ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 66  --DSG-VRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQ 119
             D G V+R ++FV +KLW + H HPD    AL ++L  +GLDY+DL+ +H+P+      
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFH-HPDHVKMALKRTLSDMGLDYLDLFYIHFPIA----- 115

Query: 120 CKKDNNYLQIPMNED-------GTRD-----LDLASWDFIKTWE-LMQALPKSKVKSIGV 166
                 +  +P  E        G  D     +  A    I T+  L Q + +  +KSIG+
Sbjct: 116 ------FKYVPFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGI 169

Query: 167 SNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYS-------- 218
           SNFS + ++DLL     K  PV  QVE HP L Q  LVE+CK   I V AYS        
Sbjct: 170 SNFSGSLVQDLLRQCKIK--PVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYI 227

Query: 219 ----PLGSTGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ 274
               PL      +    TI +++    +  + V+  W  QR I ++PKS  + R+  NL 
Sbjct: 228 ELNHPLAKNTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLM 287

Query: 275 TMELPAEEFSKLNNIS 290
             E       +L  IS
Sbjct: 288 IDEKLTLTHKELEAIS 303

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  155 bits (393), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 153/272 (56%), Gaps = 39/272 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI------K 65
           L DG ++P + LGT+    +   K V  ALK GYRH DTA +YGNE EVG+ I       
Sbjct: 13  LQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINED 72

Query: 66  DSGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
            +  +R ++F TTKLW +Q  +     A+ + ++++ GL Y+D+ L+H P+         
Sbjct: 73  KAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL--------- 123

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                       G R         ++TW+ MQ A+ +  VKSIGVSN+  ++I++LL   
Sbjct: 124 -----------SGQRRR-------LETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  PVVNQ+E+ P + + EL ++CKS N+VVEAY+P+ + G  + + G + E+SK+  
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPM-AHGYKMNDPG-LREISKETG 223

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNL 273
           + P  ++  W +Q   + LPK+ T +R+ SNL
Sbjct: 224 MNPGQLLIRWSLQHGYLPLPKTKTVARLASNL 255

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 150/287 (52%), Gaps = 25/287 (8%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G ++P VGLG W+  +      +  A+K GYR  D A  YGNE+EVG    +AI 
Sbjct: 5   VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIS 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQC-K 121
           +  V R +IFV +KLW   H HPD    AL ++L  +GLDY+DLY +H+P+        +
Sbjct: 65  EGLVSRKDIFVVSKLWNNFH-HPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEE 123

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKDLLAS 180
           K         +++    +  A    I T+  L + + +  +KSIGVSNF  + I+DLL  
Sbjct: 124 KYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLR- 182

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG------------STGAPIL 228
            G +  PV  Q+E HP L Q  LVEFCK  +I V AYS  G             T   + 
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLF 241

Query: 229 ELGTINEVSKKL-AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ 274
           E   I +VS+       + V+  W  QR I V+PKS  + R++ NL+
Sbjct: 242 ENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLE 288

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 165/311 (53%), Gaps = 33/311 (10%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK---D 66
           V LN+G ++P VGLG W+         V  A+K GYR  D A  YGNE+EVG+ I+   D
Sbjct: 8   VKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRKAID 67

Query: 67  SG-VRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
            G V+R ++FV +KLW + H  ++   AL ++L+ LGL+Y+DL+ +H+P+       ++ 
Sbjct: 68  EGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPFEER 127

Query: 124 NNYLQIPMNEDGTRD-----LDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKDL 177
                 P    G  D     + L     + T+  L Q + +  +K+IGVSNF    + DL
Sbjct: 128 YP----PGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDL 183

Query: 178 LASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG-----------STGAP 226
           LA  G K  P   Q+E HP L Q +LVE+CK + I V AYS  G           +   P
Sbjct: 184 LA--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTP 241

Query: 227 IL-ELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTME---LPAEE 282
            L E   + +V+    +  + V+  W  QR++ ++PKS  + R+++NLQ  E   L  EE
Sbjct: 242 TLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 283 FSKLNNISSEV 293
             ++++++ ++
Sbjct: 302 LQEISSLNKDI 312

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 168/329 (51%), Gaps = 39/329 (11%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           V LN+GN++P VGLG W+       + +  A+  GYR  D A  YGNE+EVG    RAIK
Sbjct: 5   VALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRRAIK 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           D  V+R E+FV +KLW + H HP +   AL ++L  +GLDY+DL+ +H+P+ +     ++
Sbjct: 65  DGLVKREELFVVSKLWNSFH-HPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSFEE 123

Query: 123 DNNYLQIPMNEDGTRD-----LDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKD 176
                  P    G  D     L       + T+  L + + +  +KSIGVSNFS + + D
Sbjct: 124 KYP----PGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLD 179

Query: 177 LLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG------------STG 224
           LL   G +  P   Q+ELHP L Q   V++ +SK I V AYS  G               
Sbjct: 180 LLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKAT 237

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---QTMELPAE 281
            P+ E   + +++ K  +  + V+  W  Q+K+ V+PKS  + R+  NL   Q + L  +
Sbjct: 238 PPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGD 297

Query: 282 EFSKLNNISSEVGEKRSVKP-NWTPFIPF 309
           E  +++ ++  +   R   P  W+   PF
Sbjct: 298 EIKEISGLNKNL---RFNDPFTWSEKTPF 323

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  154 bits (388), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 150/288 (52%), Gaps = 41/288 (14%)

Query: 11  TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD---- 66
           TL +G  +P +GLG +   +N   + V  ALK GYRH DTA  YGNE EVG  I      
Sbjct: 7   TLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWLAE 66

Query: 67  --SGVRRSEIFVTTKLWGTQHRHPD--DALNQSLERLG-LDYVDLYLMHWPVPINDAQCK 121
             S  RR ++F  TKLW +Q+ + +   A+ Q L+++  L Y+DL L+H P         
Sbjct: 67  DPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA-------- 118

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLAS 180
                                S   + T+E MQ ++    VKSIGVSN+  +++++L A 
Sbjct: 119 -------------------CGSAKRLATYEAMQESVDAGIVKSIGVSNYERHHLQELYAM 159

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
           P  K  PVVNQ+E+ P LP+ +LV++CKS  + ++AYSPLG      +    I  ++ + 
Sbjct: 160 PNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQK 217

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKL 286
              PA ++ +W + +    LPK+    R+ SNL +  + L AEE + +
Sbjct: 218 NCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVSLTAEELTNI 265

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 161/310 (51%), Gaps = 31/310 (10%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G ++P VGLG W+   +     +  A+K GYR  D A  Y NE+EVG    RAIK
Sbjct: 8   VTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIK 67

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           +  V+R ++ V +KLW + H HPD+   AL ++L  L LDYVD++ +H+P+         
Sbjct: 68  EGLVKREDLVVVSKLWNSFH-HPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF-- 124

Query: 123 DNNY---LQIPMNEDGTRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDLL 178
           D  Y         ++    ++      + TW  ++ L  + K+KS+G+SNFS   I+DLL
Sbjct: 125 DEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL 184

Query: 179 ASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG-----------STGAPI 227
              G +  PV  Q+E HP L Q  L+++ K+  I V AYS  G           +   P 
Sbjct: 185 R--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPT 242

Query: 228 L-ELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ---TMELPAEEF 283
           L E  TI  ++ K  + P  V+  W  Q  I ++PKS  + R++ NL+    + L  +E 
Sbjct: 243 LFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDEL 302

Query: 284 SKLNNISSEV 293
            +++ ++  +
Sbjct: 303 KQISGLNQNI 312

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  154 bits (388), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 158/290 (54%), Gaps = 43/290 (14%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           M L+ ST K TL +G ++P + LG +++ + +    V  ALK+GYRH+D A +YGNE EV
Sbjct: 1   MNLTPSTTK-TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREV 59

Query: 61  GRAI-----KDSGVRRSEIFVTTKLWGTQHRH--PDDALNQSLERLG-LDYVDLYLMHWP 112
           G  I     +   V RSEIF TTK+ G  H +     ++ +SLE +  ++Y+DL L+H P
Sbjct: 60  GLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP 119

Query: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSI 171
           +                            A+ + + TW+ +Q A  + KV++IGVSN+SI
Sbjct: 120 IA---------------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSI 152

Query: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELG 231
            ++++L    G K  P+VNQ EL+P L + EL E+C+ K +V+EA+SPL  T        
Sbjct: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDP 210

Query: 232 TINEVSKKLAIP---PANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
            + E+ K  + P   PA ++  W +Q   + LPKS    R ISNLQ ++ 
Sbjct: 211 QLQELIKT-SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDF 259

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  154 bits (389), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 155/302 (51%), Gaps = 22/302 (7%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           VTLN+G  +P VGLG W+   +   + V  A+K GYR  D A  YGNE++VG    RAI 
Sbjct: 5   VTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRRAID 64

Query: 66  DSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
           +  V+R ++FV +KLW T H  +H   AL ++L+ + L+Y+DLY +H+P+       ++ 
Sbjct: 65  EGIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVPFEER 124

Query: 124 NNYLQIPMNEDGTRD-LDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDLLASP 181
                    ED  +  L       I T+  M+ L  +   KSIG+SN++   ++D L   
Sbjct: 125 YPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDTLR-- 182

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTG------------APILE 229
           G +  PV  Q+E HP L Q +LVE+CK   I V AYS  G                P+ +
Sbjct: 183 GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTPPLFD 242

Query: 230 LGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNI 289
              I +++++  +  + V+  W  QR I V+PKS  + R++ NLQ  +        L  I
Sbjct: 243 HPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKDLEEI 302

Query: 290 SS 291
           SS
Sbjct: 303 SS 304

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  154 bits (389), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 161/311 (51%), Gaps = 24/311 (7%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           MT ++ T K  LN+G Q+P VGLG W+         V  A+K GYR  D A  YGNE+EV
Sbjct: 1   MTYTSETVK--LNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEV 58

Query: 61  G----RAIKDSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVP 114
           G    +AI +  V+R ++FV +KLW + H  ++   AL ++LE + L+Y+DL+ +H+P+ 
Sbjct: 59  GQGIHKAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLA 118

Query: 115 INDAQCKKDNNYLQIPMNEDGTRD-LDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSIN 172
                 ++          ED  +  + L     I T+  L + + +  +KSIG+SNF   
Sbjct: 119 FKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGI 178

Query: 173 NIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG----------- 221
            I DLLA    K  PV  Q+E HP L Q +L+E+C  + I V AYS  G           
Sbjct: 179 LIHDLLAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSEL 236

Query: 222 STGAPIL-ELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPA 280
           +   P L E   I +++    +  + V+  W  QR+I ++PKS  + R++ NLQ  E   
Sbjct: 237 AKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLT 296

Query: 281 EEFSKLNNISS 291
              ++L  IS+
Sbjct: 297 LTEAELQEISA 307

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  151 bits (381), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 148/287 (51%), Gaps = 40/287 (13%)

Query: 3   LSNSTAKV-TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61
           + N  AK   L++G  +P VGLGT+    N     V  ALKAGYRH DTA +YGNEEEVG
Sbjct: 1   MVNKVAKFYKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVG 60

Query: 62  RAIKD------SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWP 112
           + I           RR  +F TTKLW +Q  +     A+   L+++  L+Y+DL L+H P
Sbjct: 61  QGIHRWLLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSP 120

Query: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSI 171
           +                     G   L L      +TW+ MQ A+    VKSIGVSN+ +
Sbjct: 121 L---------------------GGTKLRL------ETWKAMQEAVDHGMVKSIGVSNYGM 153

Query: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELG 231
           ++I +LL     K  PVVNQ+E+ P L + EL ++CKS +I VE YSPL  T    L   
Sbjct: 154 HHIDELLTWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQ 211

Query: 232 TINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
            + +V+ +       V+  W +Q   + LPK+ T +R+ +NL   + 
Sbjct: 212 DLKKVANETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDF 258

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  151 bits (381), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 146/279 (52%), Gaps = 43/279 (15%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD----- 66
           L+ G  +P VGLGT++   N     V  AL+ GYRH DTA +YGNE EVG+ IK      
Sbjct: 11  LSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWLNEN 70

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPD-----DALNQSLERLGLDYVDLYLMHWPVPINDAQC 120
            +  +R ++F TTKLW +QH +       D   Q +E LG  Y+DL L+H P+       
Sbjct: 71  PAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLG--YIDLLLIHSPL------- 121

Query: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLA 179
                         G + L L      +T+E MQ A+   KV+SIGVSN+   +I++LL 
Sbjct: 122 --------------GGKKLRL------ETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239
               K  PVVNQ+E+ P   + EL +FCK K I+VEAY+PL  T    L+   + +V+ +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
           +       +  W +Q+  + LPK+ + SR+ SNL     
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 149/296 (50%), Gaps = 46/296 (15%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG----RAIK 65
           +TLN+G ++P VGLG W+   +     V  A+KAGYR  D A  Y NE EVG    RA+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 66  DSGVRRSEIFVTTKLWGTQHRHPDDA---LNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122
           D  V+R ++FV +KLW   H HPD     L ++L+ LGLDY+DLY +H+P+         
Sbjct: 65  DGIVKRQDLFVVSKLWNNFH-HPDHVKLNLKRNLKDLGLDYLDLYYIHFPIA-------- 115

Query: 123 DNNYLQIPMNEDGTRDLDLASWD------------FIKTWELMQALPKSK-VKSIGVSNF 169
              +  +PM E     +     D             + T+  ++   +   +KSIG+SNF
Sbjct: 116 ---FKFVPMEERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNF 172

Query: 170 SINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG-------- 221
           +   + D+L     K  PV  Q+E HP L Q +L+E+CK  ++ V  YS  G        
Sbjct: 173 NGGLVADILRGCSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCG 230

Query: 222 ----STGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL 273
                   P+ +   I ++++K  +  A V+  W  QR + ++PKS  + R++SNL
Sbjct: 231 MDLAKNTPPLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNL 286

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 152/288 (52%), Gaps = 41/288 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI------K 65
           L+ G  LP +GLGT+    N   + V  ALK GYRH+DTA +YGNE EVG  I       
Sbjct: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71

Query: 66  DSGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
            S  +R ++F  TKLW +Q  + +   A+ +  E++ GL Y+DL L+H P+         
Sbjct: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL--------- 122

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                       G+R         ++T++ MQ A+ K  V+SIGVSN+ +++I +LL   
Sbjct: 123 -----------SGSRKR-------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  P VNQ+E+ P L + EL ++CKS+ ++VEAY+PL  T    +    +  V+K+  
Sbjct: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLN 287
                V+  W +Q   V LPK+ +  R+ SNL    +EL  E+   L+
Sbjct: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLD 270

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  149 bits (377), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 152/290 (52%), Gaps = 41/290 (14%)

Query: 11  TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD---- 66
           T N+GNQ+P + LGT+   ++   K V  ALKAGYRH DTA +YGNE +VG  I      
Sbjct: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 67  --SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCK 121
                +RS++F TTKLW +Q  +     A+ + L ++ GL Y+D+ L+H P+        
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPL-------- 120

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLAS 180
                      E  T+ L+        TW  MQ A+    VK+IGVSN+   ++++LL  
Sbjct: 121 -----------EGRTKRLE--------TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQW 161

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
                 PVVNQ+E+ P + + EL ++CKS  +VVEA++PL  T    L    +  VSK++
Sbjct: 162 ERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEV 219

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
                 V+  W +Q   + LPK+ T  R+  NL+    +L  E+   +++
Sbjct: 220 GRSTVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  150 bits (379), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 167/317 (52%), Gaps = 31/317 (9%)

Query: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
           +S  +  VTLN+G ++P +GLG W+   +     V  A+K GYR  D A  YGNE+EVG+
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 63  AIK----DSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPI 115
            IK    +  V+R ++FV +KLW + H HPD+   AL ++L+ +GLDY+DL+ +H+P+  
Sbjct: 61  GIKKAIAEGIVKREDLFVVSKLWNSFH-HPDNVKLALKKTLDDIGLDYLDLFYIHFPLAF 119

Query: 116 NDAQCKKD---NNYLQIPMNEDGTRDLDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSI 171
                ++      Y      ++G   +       I T+  L + + +  +KSIG+SNF+ 
Sbjct: 120 KFVPFEEKYPPGFYTGAEDEKNGV--ISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNG 177

Query: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG---------- 221
           + ++DLL   G +  PV  Q+E HP L Q  LV++CK+  I V AYS  G          
Sbjct: 178 SLVQDLLR--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSE 235

Query: 222 --STGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL---QTM 276
              T   +    T+  ++    +  + V+  W  QR + V+PKS  + R++ NL    ++
Sbjct: 236 LAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSL 295

Query: 277 ELPAEEFSKLNNISSEV 293
            L  +E   ++ ++ ++
Sbjct: 296 TLSDKELKAISALNKDI 312

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  148 bits (373), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 175/319 (54%), Gaps = 49/319 (15%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEE- 59
           M+++ ST K TL +G ++P +G GT+++ +  A   V AA K GYRH+DTA +Y NE E 
Sbjct: 1   MSITASTTK-TLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENEREC 59

Query: 60  ---VGRAIKDS-GVRRSEIFVTTKLWGTQHRH--PDDALNQSLERLG-LDYVDLYLMHWP 112
              V + +K+S  V R ++F TTK+ G  H +     ++ +SLE    L+YVDL+L+H P
Sbjct: 60  ATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP 119

Query: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSI 171
               + +                           + T++ +Q   K+ K+K+IGVS++SI
Sbjct: 120 CAETEKR---------------------------LGTYKALQEFYKAGKIKAIGVSSYSI 152

Query: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELG 231
            ++++L +  G +  P+VNQ EL+P L + +LV++CK +++V+EA+SP+  T +      
Sbjct: 153 KHLEELYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDP 210

Query: 232 TINEVSKKLAIP---PANVVFSWLIQRKIVVLPKSVTESRIISNLQTM--ELPAEEFSKL 286
            + ++ K+ + P   PA ++  W +Q   V LPKSV E R  SNL  +  E+ AE+   L
Sbjct: 211 VVQKLLKE-SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269

Query: 287 NNISSEVGEKRSVKPNWTP 305
            +     GE    +P + P
Sbjct: 270 THD----GEHFLAQPGFDP 284

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  147 bits (372), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 153/289 (52%), Gaps = 41/289 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI-----KD 66
           L++G ++P + LGT+    +   + V   +K GYRH DTA +YGNE+EVG  I     +D
Sbjct: 8   LSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

Query: 67  SG-VRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
            G  +R EIF TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+  +  +   
Sbjct: 68  PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLR--- 124

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                                   ++TW  MQ A+ +  VKSIGVSN+   +I +LL  P
Sbjct: 125 ------------------------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWP 160

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  PVVNQ+E+ P + + EL ++CKSK +VVEA++PL   G  +     + +V K++ 
Sbjct: 161 ELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL-CHGYKMTNPDLL-KVCKEVD 218

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
             P  V+  W +Q   + LPK+ T  R+  NL     EL  E+   L++
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  147 bits (372), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 157/289 (54%), Gaps = 41/289 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD----- 66
           L+ G  LP +GLGT+     +  + V  ALK+GYRH+DTA +YGNE EVG+ I+      
Sbjct: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78

Query: 67  -SGVRRSEIFVTTKLWGTQHRHPD--DALNQSLERLG-LDYVDLYLMHWPVPINDAQCKK 122
               +R ++F TTKLW +Q+ + +   A+ + +E++  L Y+DL L+H P+         
Sbjct: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL--------- 129

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                       GTR         ++T++ MQ A+ +  V+SIGVSN+  ++I +LL   
Sbjct: 130 -----------SGTRRR-------LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  PVVNQ+E+ P + + +L ++CKSK +VVEA+SPL  T    L+   +  V+K+  
Sbjct: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETG 229

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
                V+  W +Q   V LPKS +  R+  N++    EL  E+ S L+ 
Sbjct: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 161/300 (53%), Gaps = 41/300 (13%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60
           M+ ++      L+ G  LP +GLGT+     +  + V  ALKAGYRH+DTA +YGNE EV
Sbjct: 1   MSSTSVPRAYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREV 60

Query: 61  GRAIKD------SGVRRSEIFVTTKLWGTQHRHPD--DALNQSLERLG-LDYVDLYLMHW 111
           G  ++          RR ++F TTKLW +Q+ + +   A+ + L+++  L Y+D+ L+H 
Sbjct: 61  GEGVEKWLKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHS 120

Query: 112 PVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFS 170
           P+                     GTR         ++T++ MQ A+    V+SIGVSN+ 
Sbjct: 121 PL--------------------SGTRRR-------LETYKAMQEAVDAGIVRSIGVSNYG 153

Query: 171 INNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILEL 230
            ++I +LLA    K  PVVNQ+E+ P + + +L ++CKSK +VVEA+SPL  T    ++ 
Sbjct: 154 KHHIDELLAWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKH 211

Query: 231 GTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
             +  V++++      V+  W +Q   V LPKS +  R+  NL+    EL  E+ + L+ 
Sbjct: 212 PNVVRVAEEVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQITFLDQ 271

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  147 bits (370), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 148/288 (51%), Gaps = 40/288 (13%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI-----KD 66
           L  G  +P +GLGT+    ++    V AAL+ GYRH+DTA +YGNE EV +       + 
Sbjct: 9   LASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFLGRH 68

Query: 67  SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERLG-LDYVDLYLMHWPVPINDAQCKKD 123
             V R +IF TTKLW +Q  +     A+ + +E +G L Y+DL LMH   PI   Q ++ 
Sbjct: 69  PDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMH--SPIGGKQVRRG 126

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASPG 182
                                    TW+ MQ A+    V+SIGVS++   +++DL     
Sbjct: 127 -------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWSE 161

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAI 242
            K  P VNQ+E+ P + + +L ++CKSK IVVEAYSPL  T    L+   + +V+++   
Sbjct: 162 LKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEETGK 219

Query: 243 PPANVVFSWLIQRKIVVLPKSVTESRIISNLQTM--ELPAEEFSKLNN 288
            P  V+  W +Q   V LPK+ T SR+  NL     EL  E    L++
Sbjct: 220 NPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  147 bits (371), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 151/291 (51%), Gaps = 32/291 (10%)

Query: 10  VTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIK---D 66
           VTLN+G ++P VGLG W+         V  A+K GYR  D A  YGNE+EVG+ I+   D
Sbjct: 5   VTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRKAID 64

Query: 67  SG-VRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKD 123
            G V+R E+FV +KLW + H  ++   AL ++L+ + LDY+DL+ +H+P+ +     K+ 
Sbjct: 65  EGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPFKEK 124

Query: 124 NNYLQIPMNEDGTRDLDLASWD-----FIKTWE-LMQALPKSKVKSIGVSNFSINNIKDL 177
                 P    G++D    +        I T+  L Q + +  +KSIG+SNFS + I DL
Sbjct: 125 YP----PGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDL 180

Query: 178 LASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG------------STGA 225
           L   G +  PV  Q+E HP L Q  LV + K + + V AYS  G             T  
Sbjct: 181 LR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTP 238

Query: 226 PILELGTINEVSKKLA--IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ 274
           P+ E   I E++K     I P+ V+  W  Q  + V+PKS  + R+  NL 
Sbjct: 239 PLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLH 289

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 147/272 (54%), Gaps = 39/272 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD----- 66
            ++G ++P + LGT+    +   + V   +K GYRH DTA +YGNE+EVG  I       
Sbjct: 8   FSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHED 67

Query: 67  -SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
               +R ++F TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+         
Sbjct: 68  PENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL--------- 118

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                      +G++         ++TW+ MQ A+ +  VKSIGVSN+   ++ +LL   
Sbjct: 119 -----------EGSKLR-------LETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
             K  PVVNQ+E+ P + + EL ++CKSKN+VVEA++PL   G  + +   + +V K++ 
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL-CHGYKMTDPDLL-KVCKEVD 218

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNL 273
             P  V+  W +Q   + LPK+ T  R+ SNL
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNL 250

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 151/292 (51%), Gaps = 47/292 (16%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD----- 66
           L++G ++P + LGT++   +   + V   +K GYRH DTA +YGNE+EVG  I       
Sbjct: 8   LSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNED 67

Query: 67  -SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
               +R++IF TTKLW +Q  +R    A+ Q L  + GL+Y+DL L+H P+  +  +   
Sbjct: 68  PKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLR--- 124

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                                   ++TW  MQ A+    VKSIGVSN+   +I +LL   
Sbjct: 125 ------------------------LETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLG---STGAPILELGTINEVSK 238
             +  PVVNQ+E+ P + + EL ++CKSK ++VEA++PL        P L +     V K
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPLCHGYKMTNPDLLI-----VCK 215

Query: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQ--TMELPAEEFSKLNN 288
           ++   P  V+  W +Q   + LPK+ T  R+  NL   + EL  E+   L++
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  142 bits (358), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 147/282 (52%), Gaps = 40/282 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKDSGVR- 70
           L+    +P V LGT+    ++  + V  AL  GYRH DTA +Y NEEEV + I +  +R 
Sbjct: 11  LSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWLIRH 70

Query: 71  ----RSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKKD 123
               R EIF TTKLW +Q  +++   A+ + ++++  L Y+DL LMH   PI   Q +++
Sbjct: 71  PETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMH--SPIGGPQIREE 128

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASPG 182
                                    TW  MQ A+ +  VKSIGVSNF I ++K+L    G
Sbjct: 129 -------------------------TWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWDG 163

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL-- 240
            K  PVVNQ+E+ P L + EL +FCK + +VVEAY+PL + G  I     I ++S +L  
Sbjct: 164 LKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL-THGYKINHPDLI-KISNELNN 221

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEE 282
                 ++  W +Q   V LPK+ T  R+ SNL   +    E
Sbjct: 222 TKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTE 263

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  143 bits (360), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 147/288 (51%), Gaps = 40/288 (13%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI-----KD 66
           L+DG Q+P VGLG +Q  E      V  AL+ GYR  D+A  Y NE+ V R I       
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 67  SGVRRSEIFVTTKLWGTQHRH--PDDALNQSLERLG-LDYVDLYLMHWPVPINDAQCKKD 123
            G RR +++ TTK+    H +     +L +SL   G L Y+DL L+H P+          
Sbjct: 75  PGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMS--------- 125

Query: 124 NNYLQIPMNEDGTRDLDLASWDFIKTWE-LMQALPKSKVKSIGVSNFSINNIKDLLASPG 182
                     D TR L         TW+ L +A+ + +V+SIGVSN+   ++ +LL   G
Sbjct: 126 ----------DRTRRLG--------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEG 167

Query: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAI 242
            K  PVVNQVE++P L + ELV++C+  NI V+A+SPL       L+   + +V+ +   
Sbjct: 168 LKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDK 225

Query: 243 PPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
             A ++  W IQ   +VLPK+  + R+  N      EL AE  S+L +
Sbjct: 226 GVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  142 bits (358), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 144/277 (51%), Gaps = 39/277 (14%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI------K 65
           L++G ++P + LGT+    +   + V   +K GYRH DTA +YGNE+EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 66  DSGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCKK 122
               +R +IF TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+  +  +   
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLR--- 124

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLASP 181
                                   ++TW+ MQ A+ +  VKSIGVSN+   +I +LL  P
Sbjct: 125 ------------------------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWP 160

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241
                PVVNQ+E+ P + + EL ++CKSK ++VEA++PL   G  +     + +V K++ 
Sbjct: 161 DLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL-CHGYKMTNPDLL-KVCKEVD 218

Query: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
             P  V+  W +Q   + LPK+ T  R+  NL   + 
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDF 255

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  137 bits (344), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 153/293 (52%), Gaps = 47/293 (16%)

Query: 11  TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD---- 66
           T+ +G ++P + LG +    +     V  ALK GYRH DTA +YGNE+EVG  I      
Sbjct: 8   TMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKE 67

Query: 67  --SGVRRSEIFVTTKLWGTQH------RHPDDALNQSLERLGLDYVDLYLMHWPVPINDA 118
             +  +R ++F TTKLW +Q+      R   + +N+  E   L Y+DL L+H P+     
Sbjct: 68  DPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKE---LGYIDLLLIHSPL----- 119

Query: 119 QCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDL 177
                           G R         ++T++ MQ A+    VKSIGVSN+   +I++L
Sbjct: 120 ---------------SGPRRR-------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEEL 157

Query: 178 LASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVS 237
                 K  PV NQ+E+ P   + +L  +C+SK ++VEA+SPL + G  + E G ++ ++
Sbjct: 158 YKWDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL-THGYKLKEPGLVS-LA 215

Query: 238 KKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNN 288
           KKL      V+  W +QR ++ LPK+   +R+ SNL+    EL  E+  +L++
Sbjct: 216 KKLGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  137 bits (344), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 149/288 (51%), Gaps = 41/288 (14%)

Query: 5   NSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI 64
           N   +  LN+G Q+P +G G ++  + D    V +ALK GYRHIDTA +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 65  K----DSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLD------YVDLYLMHWPVP 114
           +    ++G  R  I+ TTKLW +Q     +   ++L+ +  D      YVDL L+H   P
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGR--EETEKALQEVAADVKEYIGYVDLLLLH--SP 123

Query: 115 INDAQCKKDN-NYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINN 173
              A+ + +    L+  + E G++ L+                    +KSIGVSNF +++
Sbjct: 124 RGGAKRRLETWAILEQAVQEPGSKALE--------------------IKSIGVSNFGVDH 163

Query: 174 IKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTI 233
           +++LL     K  PV++Q+ELHP LP+ EL ++ K K+I  EAYSPL  T    L+   +
Sbjct: 164 LEELLKVAKVK--PVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPEL 219

Query: 234 NEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAE 281
             +  K  I  A ++  W   +  VVL KS    RI  NL    LP+E
Sbjct: 220 LALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAV--LPSE 265

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  136 bits (342), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 144/287 (50%), Gaps = 39/287 (13%)

Query: 5   NSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEE----V 60
           N   +  LN+G ++P +G G +     +  + V  AL+ GYRHIDTA +Y N+++    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLD------YVDLYLMHWPVP 114
            R ++++G  R E++ TTKLW TQ     DA  ++LE +  D      YVDL L+H   P
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQGR--DATPRALEEIAADVKEFIGYVDLLLLH--SP 123

Query: 115 INDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNI 174
           + DAQ +                   L +W  ++      A    ++++IGVSNF + ++
Sbjct: 124 LTDAQRR-------------------LETWAVLERAVQEPASSALEIRAIGVSNFGVRHL 164

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTIN 234
           ++LL     K  PVV+Q+ELHP LP+ EL  F +   I+ EAYSPL  T    L+   + 
Sbjct: 165 QELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELL 220

Query: 235 EVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAE 281
            +  K  +    ++  W   +   VL KS    RI  NL    LPA+
Sbjct: 221 ALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAV--LPAK 265

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  132 bits (331), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 149/282 (52%), Gaps = 39/282 (13%)

Query: 11  TLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKD---- 66
           TL++G ++P + LGT+   ++     V  ALK GYRH DTA +Y NE +VG  I      
Sbjct: 8   TLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 67  --SGVRRSEIFVTTKLWGTQ--HRHPDDALNQSLERL-GLDYVDLYLMHWPVPINDAQCK 121
                +R ++F TTKLW +Q  ++    A+ + L+++  L Y+DL L+H P+        
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL-------- 119

Query: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSINNIKDLLAS 180
                        G+R         ++T++ MQ A+ +  VKSIGVSN+  +++++LL+ 
Sbjct: 120 ------------SGSRKR-------LETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSW 160

Query: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240
            G K  PVVNQ+E+ P   + EL ++C+S+ IVVE Y+PL  T    L+   + +V++++
Sbjct: 161 EGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEV 218

Query: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEE 282
                 V+  W +Q   + LPK+    R+  NL   +    E
Sbjct: 219 GKNTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTE 260

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  130 bits (328), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 160/323 (49%), Gaps = 58/323 (17%)

Query: 12  LNDGNQLP---YVGLGT-WQSK---ENDAYKAVVAALKA-----GYRHIDTAAIYGNEEE 59
           LN+GNQ+P    +G GT W  +   E+     +V  +K      G  HID A  YG   E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 60  VGRAIKDSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPIN 116
           + +A+K+S   RSEIF+T K + TQ +  +D    LN  L+ LGLDYVDLYL+H   P  
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIH--SPFF 126

Query: 117 DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK-SKVKSIGVSNFSINNIK 175
           D + K             G+  L+       K W+ M+ L K  K KSIGVSNFS+ NI+
Sbjct: 127 DPEFK-------------GSLTLE-------KVWKDMETLYKEGKAKSIGVSNFSVKNIE 166

Query: 176 DLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STGA 225
           ++L   G K  P VNQ+E +  L      +V +C+  NI +EAYSPLG        S   
Sbjct: 167 EILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLGPLQKRPENSNEL 224

Query: 226 PILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRII--SNLQTMELPAEEF 283
           P      I+E++ K     + ++ +W+  R I+ +  S    RII   N+ +  L  +E 
Sbjct: 225 PFYNY--IDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEV 282

Query: 284 SKLNNISSEVGEKRSVKPNWTPF 306
             L  +     E+ +++  WT F
Sbjct: 283 DTLTKLGL---EQPALRIYWTNF 302

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 158/309 (51%), Gaps = 50/309 (16%)

Query: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI-----KD 66
           L +G ++P +GLG +Q+ + +    V  ALK GYR +D+A +YGNE E    I     + 
Sbjct: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70

Query: 67  SGVRRSEIFVTTKLWGTQHRHPDDA---LNQSLERLG-LDYVDLYLMHWPVPINDAQCKK 122
             V RS+IF TTK+  TQ +  + A   + +SL R+  LDY+DL+L+H P+   + +   
Sbjct: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR--- 126

Query: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181
                                   + TW+  Q   ++ K+K+IGVSN+ I +++++    
Sbjct: 127 ------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162

Query: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPIL---ELGTINEVSK 238
           G K  P+VNQ EL+P L + EL  +C  K +V++AYSPL  T A  L   EL  + E S 
Sbjct: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220

Query: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNNISSEVGEK 296
                 A ++ +W +Q   V L K+V E R+  N+++   EL + +  KL +      + 
Sbjct: 221 PEQT-SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDD----QY 275

Query: 297 RSVKPNWTP 305
              +P W P
Sbjct: 276 YLSQPKWDP 284

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  125 bits (313), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 156/307 (50%), Gaps = 57/307 (18%)

Query: 11  TLNDGNQLP---YVGLGT--WQSKENDAY--KAVVAALKA------GYRHIDTAAIYGNE 57
           TL++GN++P    VG GT  ++S+E DA   + +V  +K       G  HID A IY   
Sbjct: 8   TLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTY 67

Query: 58  EEVGRAIKDSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPI 115
            E+G A+KD+   R EIF+T K    +    +P  AL  SL++LG+DYVDLYL+H P+ I
Sbjct: 68  PELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI-I 126

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNI 174
            +++   + N                        W+ ++ L KS K K+IGVSNF++ ++
Sbjct: 127 KESKLDVEAN------------------------WKYLEELYKSGKAKNIGVSNFAVKDL 162

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STG 224
           + LLA    K  P VNQ+E  P L      +VEF +   I++EAYSPLG        +  
Sbjct: 163 EKLLAVAEVK--PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADK 220

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEE 282
            P  +   I E+SKK     A ++ SW+ +R I+ +  S    RI    ++ +  L  EE
Sbjct: 221 LPFYQY--IAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEE 278

Query: 283 FSKLNNI 289
             K+  +
Sbjct: 279 VQKITQL 285

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  125 bits (313), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 157/310 (50%), Gaps = 56/310 (18%)

Query: 11  TLNDGNQLP---YVGLGT--WQSKENDA------YKAVVAALK-AGYRHIDTAAIYGNEE 58
           TLN+GN++P    +G GT  ++++E DA       + +V ALK  G  HID A IY    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLYLMHWPVPI 115
           EVG+A+  +   R+ IF+T K +  Q +    P D L+ +L+++G DYVDLYL+H P   
Sbjct: 69  EVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF-- 125

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNI 174
                 K+ N L +                  + W+ M+ L KS K K+IGVSNF++ ++
Sbjct: 126 ----VSKEVNGLSLE-----------------EAWKDMEQLYKSGKAKNIGVSNFAVEDL 164

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STG 224
           + +L     K  P VNQ+E  P L      + +FC+  +I+VEAYSPLG           
Sbjct: 165 QRILKVAEVK--PQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDS 222

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEE 282
            P  E   + E+S+K     A ++  W+ +R ++ +  S    RI    NL + +L AEE
Sbjct: 223 QPFFEY--VKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEE 280

Query: 283 FSKLNNISSE 292
             K+  +  E
Sbjct: 281 VDKITELGLE 290

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 155/315 (49%), Gaps = 59/315 (18%)

Query: 11  TLNDGNQLP---YVGLGT--WQSKENDAY--KAVVAALKA-----GYRHIDTAAIYGNEE 58
           TLN+GN++P    +G GT  ++++E DA   + +V  LK      G  HID A IY    
Sbjct: 9   TLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYP 68

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPI 115
           EV  A+++S   R EIF+T K + TQ +  DD    LN SL+ LGLDYVDLYL+H P   
Sbjct: 69  EVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPFIK 127

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNI 174
           N +  +                          + W+ M+ L KS K K+IGVSNF + ++
Sbjct: 128 NGSTLE--------------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDL 161

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STG 224
           + +L     K  P +NQ+E +  L      +V+FCK  NI +EAY+PLG           
Sbjct: 162 EKILKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEA 219

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEE 282
            P  +   I E+SKK     A ++  W+ +R I+ +  S    R+    NL + +L + E
Sbjct: 220 KPFYDY--IAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSE 277

Query: 283 FSKLNNISSEVGEKR 297
             K+  +  ++   R
Sbjct: 278 VDKITELGLKLKATR 292

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  123 bits (308), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 153/313 (48%), Gaps = 51/313 (16%)

Query: 3   LSNSTAKVTLNDGNQLP---YVGLGT-WQSKENDAYK---AVVAALKA-----GYRHIDT 50
           +S S    TLN+GN++P    +G GT W   + ++ K    +V  L+      G  HID 
Sbjct: 1   MSFSQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDA 60

Query: 51  AAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLY 107
           A +Y    EV +A+K +   R EIF+T K +    +   +P   L +SL+ L LDYVDLY
Sbjct: 61  AEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLY 120

Query: 108 LMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK-SKVKSIGV 166
           L+H P  I    C                       +   + W+ M+ L K  K K+IGV
Sbjct: 121 LLHSPF-ITKESC----------------------GYTMEEAWKQMEKLYKDGKAKNIGV 157

Query: 167 SNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--- 221
           SNFS++++K +L     K  P +NQ+E +  L      +V+FC+  +I+VEAYSPLG   
Sbjct: 158 SNFSVDDLKRILKICEIK--PQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLR 215

Query: 222 ---STGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTM 276
              +   P      I E++KK       V+  W+ +RKI+ +  S  E RI    +L + 
Sbjct: 216 KKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSF 275

Query: 277 ELPAEEFSKLNNI 289
           +L +EE  K+  +
Sbjct: 276 DLTSEEVEKITKL 288

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/303 (29%), Positives = 149/303 (49%), Gaps = 50/303 (16%)

Query: 15  GNQLPYVGLGT---WQ-----SKENDAY-----KAVVAALKAGYRHIDTAAIYGNEEEVG 61
           G+++P +G G+   W+      ++ D +       V +A+ AG+ HID A  Y    EVG
Sbjct: 14  GDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAYKTHPEVG 73

Query: 62  RAIKDSGVRRSEIFVTTKL--WGTQHRH---PDDALNQSLERLGLDYVDLYLMHWPVPIN 116
           R +K+SGV R ++++T K   W    R    P ++L+ SLE++ + YVDLYL+H  VP  
Sbjct: 74  RGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLLH--VPFI 131

Query: 117 DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIK 175
             Q                      A  D  + W  M+ +  +   K+IGVSNF + +++
Sbjct: 132 TVQT---------------------AGIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLE 170

Query: 176 DLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--STGAPILELG 231
            +  +   K +PVVNQ+E +  L Q    ++ +CK  +IVVE YSPL   + G P     
Sbjct: 171 YI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLDK 228

Query: 232 TINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIIS--NLQTMELPAEEFSKLNNI 289
            +  +++K       ++  W+ Q  +VV+  S  ++R+    N+   EL AE+F  +  I
Sbjct: 229 LLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSITKI 288

Query: 290 SSE 292
             E
Sbjct: 289 GRE 291

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  120 bits (301), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 151/312 (48%), Gaps = 58/312 (18%)

Query: 16  NQLPYVGLGT---WQSKENDA----------YKAVVAALKAGYRHIDTAAIYGNEEEVGR 62
             +P +G GT   W+  + +              +V A+  G+ HIDTA  Y   EEVG 
Sbjct: 16  THIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEVGE 75

Query: 63  AIKDSGVRRSEIFVTTKL----W-GTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPIND 117
           A++ S + R ++F+T K     W G     P  A  + LE LG+ Y DLY++H P     
Sbjct: 76  ALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP----- 130

Query: 118 AQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKV-KSIGVSNFSINNIKD 176
               K+N                 A  D  + W  ++ L ++ + K+IGVSNF +  +K 
Sbjct: 131 -DITKEN-----------------AGIDLQEAWRQVEELYEAGIAKAIGVSNFPLETLKQ 172

Query: 177 LLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLGSTGAPILEL--GT 232
           + +    + +P+V+QVE HP L      +VE+C++K+IVVEAYSPL    AP+     G 
Sbjct: 173 MESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARPGP 226

Query: 233 INEV----SKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNN 288
           ++++     KK       +V  W+I R IV L  S  E RI   L T++   E+ S +  
Sbjct: 227 LDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEK-SDVEL 285

Query: 289 ISSEVGEKRSVK 300
           I +EVG K+  +
Sbjct: 286 I-NEVGSKKHFQ 296

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 155/311 (49%), Gaps = 56/311 (18%)

Query: 10  VTLNDGNQLP---YVGLGT--WQSKENDA------YKAVVAALK-AGYRHIDTAAIYGNE 57
           +TLN+GN++P    +G GT  ++ +E DA       + +V ALK  G  HID A IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 58  EEVGRAIKDSGVRRSEIFVTTKLWGTQ---HRHPDDALNQSLERLGLDYVDLYLMHWPVP 114
            EVG+A+  +   R+EIF+T K + TQ      P   L+ +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 115 INDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINN 173
                  K+ N                  +   + W+ M+ L +S K K+IGVSNF++ +
Sbjct: 126 -----VSKETN-----------------GFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKD 163

Query: 174 IKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------ST 223
           ++ +L     +  P VNQ+E  P L      + +FC+  +I++EAYSPLG          
Sbjct: 164 LERILKVAEIR--PQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDE 221

Query: 224 GAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAE 281
             P  E   + E+S+K     A +   W+ +R ++ +  S    RI    NL + +L  E
Sbjct: 222 SLPFFEY--VKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDE 279

Query: 282 EFSKLNNISSE 292
           E +++  +  E
Sbjct: 280 EVNQITELGLE 290

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  118 bits (295), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 151/312 (48%), Gaps = 50/312 (16%)

Query: 3   LSNSTAKVTLNDGNQLPYV---GLGT-WQSKENDAY---KAVVAALK-----AGYRHIDT 50
           +S++ A VTLN+G+++P V   G GT W  K+   +     ++  L+      G  HID 
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 51  AAIYGNEEEVGRAIKDSGVRRSEIFVTTK--LWGTQHRHPDDALNQSLERLGLDYVDLYL 108
           A +YG   E+  A++ +   RSEIF+T K  L     + P   L  SL+   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 109 MHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK-SKVKSIGVS 167
           +H P         K+   L +    +G              W  M+ L K  K K+IGVS
Sbjct: 121 LHSPF------VAKEKPGLTL----EGA-------------WRQMEQLYKDGKAKNIGVS 157

Query: 168 NFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLGSTGA 225
           NFS+ ++K +L+    K  P VNQ+E HP L      +++FC+ +NI +EA++PLG    
Sbjct: 158 NFSVEDLKRVLSVAEIK--PQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQV 215

Query: 226 PILE------LGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTME 277
              E         I+ +S K     A ++  W+ +R ++ +  S    RI    NL   +
Sbjct: 216 KTQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFD 275

Query: 278 LPAEEFSKLNNI 289
           L  EE +K+  +
Sbjct: 276 LEDEEVTKITRL 287

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  113 bits (283), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/308 (30%), Positives = 150/308 (48%), Gaps = 56/308 (18%)

Query: 10  VTLNDGNQLP---YVGLGT--WQSKENDA------YKAVVAALKA-GYRHIDTAAIYGNE 57
           + LN+GN++P    +G GT  +++ E DA       + ++ AL+  G  HID A IY   
Sbjct: 8   IVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTY 67

Query: 58  EEVGRAIKDSGVRRSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLYLMHWPVP 114
            EVG+A+  +   R EIF+T K + TQ +    P   L  SL+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFV 126

Query: 115 INDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINN 173
             +A                         +   + W+ M+ L K+ K K+IGVSNF++ +
Sbjct: 127 SKEAN-----------------------GFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKD 163

Query: 174 IKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------ST 223
           ++ +L     K  P VNQ+E  P L      + +FC+  NI++EAYSPL           
Sbjct: 164 LEKILKIAEVK--PQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDD 221

Query: 224 GAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAE 281
             P  E   + E+S+K     A ++  W+ +R ++ +  S    RI    NL + +L  E
Sbjct: 222 SKPFFEY--VKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDE 279

Query: 282 EFSKLNNI 289
           E  ++  +
Sbjct: 280 EVDEITEL 287

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  112 bits (280), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 152/302 (50%), Gaps = 46/302 (15%)

Query: 11  TLNDGNQLP---YVGLGT-W---QSKENDAYKAVVAALKA-----GYRHIDTAAIYGNEE 58
           TLN+GN++P    VG GT W   +  E++  K +V  +K      G  H+D A  Y   +
Sbjct: 28  TLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQ 87

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHRHPD--DALNQSLERLGLDYVDLYLMHWPVPIN 116
           E+G+A+++S   R EIF+T K   T   H    +     ++++G+DYVDLYL+H P+   
Sbjct: 88  ELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL--- 144

Query: 117 DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKD 176
               +K+ N + +   E+  +DL+          +L +A    K K+IGVSNF + +++ 
Sbjct: 145 ---IEKEKNGVTL---EEVWKDLE----------KLYEA---GKAKNIGVSNFRVEDLQR 185

Query: 177 LLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLGSTGAPILELGT-- 232
           +L     K  P VNQ+E H  L      +V+F +  NI +EAY+PLG       + G   
Sbjct: 186 ILKVAKVK--PQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFY 243

Query: 233 --INEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEEFSKLNN 288
             + E++KK     A V+  W+ +R ++ +  S    RI    +L + +L  EE  K+  
Sbjct: 244 NYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKITE 303

Query: 289 IS 290
           + 
Sbjct: 304 LG 305

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  110 bits (274), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 152/308 (49%), Gaps = 54/308 (17%)

Query: 10  VTLNDGNQLP---YVGLGT-WQSKENDA---YKAVVAALKA-----GYRHIDTAAIYGNE 57
            TLN+GN++P    +G GT W   E       + +V  +K      G  HID A +Y   
Sbjct: 9   TTLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTY 68

Query: 58  EEVGRAIKDS-GVR-RSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLYLMHWP 112
            EVG+A+++S  V+ R EIF+T K + TQ +   +P   L   L++LGLDYVDLYL+H P
Sbjct: 69  PEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP 127

Query: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSI 171
                   K+ N +    M E                W+ M+ L K+ KVK+IGVSNFS+
Sbjct: 128 FI-----SKEKNGF---TMEE---------------AWKYMEDLYKAGKVKNIGVSNFSM 164

Query: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--STGAPI 227
            +++ +L S   K  P VNQ+E +  L      +V FC+  +I V AY+PLG     +  
Sbjct: 165 ADLQRILKSCEVK--PQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKN 222

Query: 228 LELGTINEVSKKLA----IPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAE 281
            E    ++  K+LA       A ++  W+ +R I+ +  S  E RI     L T +L   
Sbjct: 223 FEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDS 282

Query: 282 EFSKLNNI 289
           E  K+  +
Sbjct: 283 EVEKITQL 290

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 156/317 (49%), Gaps = 58/317 (18%)

Query: 3   LSNSTAKVTLNDGNQLP---YVGLGTWQSKEN--DAY-----KAVVAALKA-GYRHIDTA 51
           +S  T+ +TLN+GN++P    +G GT   K N  D Y     K +  AL+  G  HID A
Sbjct: 1   MSYQTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCA 60

Query: 52  AIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLM 109
            +Y    EVG A+++S   R EIF+T K    +    +P + L  +LE++GL+YVDLYL+
Sbjct: 61  EMYQTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLL 120

Query: 110 HWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFI--KTWELMQALPKSKV-KSIGV 166
           H+P+                         +D   +DF   + W++M+ L    + K+IGV
Sbjct: 121 HFPI-------------------------IDPKLYDFTLEEAWKMMEDLYNEGLAKNIGV 155

Query: 167 SNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLGSTG 224
           SNF + +++ L  S   K  P +NQ+E +  L      + ++C   NI +EA+ PL    
Sbjct: 156 SNFRVEDLEQLSKSWVIK--PQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPL---- 209

Query: 225 APILELGT-------INEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQT 275
            P+ E+         + ++++K +     ++  W+ QRK++ +  S    R+    ++ +
Sbjct: 210 VPLREVNEKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFS 269

Query: 276 MELPAEEFSKLNNISSE 292
            EL  +E   +  + S+
Sbjct: 270 FELTQDEVEFITKLGSQ 286

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 149/310 (48%), Gaps = 59/310 (19%)

Query: 11  TLNDGNQL---PYVGLGTWQSKENDAY--------KAVVAALKAGYRHIDTAAIYGNEEE 59
           TLN+GN++     +G GT    E  A+        +A  A    G  H+D A  Y    E
Sbjct: 9   TLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPE 68

Query: 60  VGRAIKDSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPIND 117
           + +A+K+S   R+EIF+T K         +P +ALN +L+ LGLDYVDLY++H+P     
Sbjct: 69  LNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP----- 123

Query: 118 AQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK-SKVKSIGVSNFSINNIKD 176
              + D  Y          +DL + +      W  M+ L K  K K+IGVSNFSI +++ 
Sbjct: 124 ---EFDPEY----------KDLSIET-----AW--MELLYKEGKAKNIGVSNFSIEHLER 163

Query: 177 LLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLGSTGAPILE----- 229
           ++     K  P VNQ+E +  L      +V++C+     +EAYSPL    AP+       
Sbjct: 164 VMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNF 217

Query: 230 -----LGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIIS--NLQTMELPAEE 282
                   I+EVS K     + ++  W+ +R IV +  S    RI++  NL + +L  EE
Sbjct: 218 NELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEE 277

Query: 283 FSKLNNISSE 292
             K+  +  E
Sbjct: 278 VDKITKLGLE 287

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 133/290 (45%), Gaps = 48/290 (16%)

Query: 12  LNDGNQLP---YVGLGTWQSKENDA----YKAVVAALKA-----GYRHIDTAAIYGNEEE 59
           LN+G+++P    VG GT   K N+      + +V  LK      G  H+D A  Y    E
Sbjct: 9   LNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTYRE 68

Query: 60  VGRAIKDSGVRRSEIFVTTKLWGTQH--RHPDDALNQSLERLGLDYVDLYLMHWPVPIND 117
           VGRA+ ++   R EIF+T K W       +P   L   L+RLGL+YVDLYL+H P     
Sbjct: 69  VGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF---- 124

Query: 118 AQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKD 176
               K+ N                  +   + W +M+ L  S K K+IGVSNF+  +++ 
Sbjct: 125 --ISKETN-----------------GFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLER 165

Query: 177 LLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG------STGAPIL 228
           +L     K  P VNQ+E +  L      +  FCK  +I + AYSPLG      + G    
Sbjct: 166 VLKVCKVK--PQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQP 223

Query: 229 ELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278
               IN++++     P  V+  W+ +R +V +  S  + RI    +  E 
Sbjct: 224 FYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEF 273

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  108 bits (269), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 151/321 (47%), Gaps = 58/321 (18%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLGT---WQ-----SKENDAYKAVVA-----ALKAGYRH 47
           M ++N         G+ LP +G G+   W+      K    Y   +A     A++ G+ H
Sbjct: 1   MDMTNIPGITLKGSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNH 60

Query: 48  IDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKL--WGTQHRH---PDDALNQSLERLGLD 102
           IDTA  Y   +EVG  I ++ V R  +++T K   W  + R    P ++L  SL+ + LD
Sbjct: 61  IDTAEAYKTYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLD 120

Query: 103 YVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKV- 161
           YVDLY++H                  +P     T  +DL      + W  M+ +   K+ 
Sbjct: 121 YVDLYMIH------------------VPNITTKTAGIDLK-----EAWLQMEEIYTRKMA 157

Query: 162 KSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSP 219
           ++IGVSNF + +++ + +    K  PVVNQ+E    + Q    ++++C+  NIVVE YSP
Sbjct: 158 RNIGVSNFDVESLEYIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSP 215

Query: 220 LG--STGAPILELGTINE----VSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNL 273
           L   + G P    G ++E    ++ K       V+  W+ Q  IVV+  +  + R+  +L
Sbjct: 216 LVPLTKGKP----GPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESL 271

Query: 274 QT--MELPAEEFSKLNNISSE 292
                EL  E+F ++ N+  E
Sbjct: 272 NIFDFELSKEDFDQITNVGRE 292

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  107 bits (268), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 148/312 (47%), Gaps = 62/312 (19%)

Query: 15  GNQLPYVGLGT---WQSKENDAYKA----------VVAALKAGYRHIDTAAIYGNEEEVG 61
           G++LP +G G+   W+  + +  K           V  A+KAG+ HID A  Y    EVG
Sbjct: 14  GDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPEVG 73

Query: 62  RAIKDSGVRRSEIFVTTKL--WG---TQHRHPDDALNQSLERLGLDYVDLYLMHWPVPIN 116
             I +SGV R +++VT K   W     + + P ++L  SL ++ + YVDLYL+H      
Sbjct: 74  AGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVH------ 127

Query: 117 DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIK 175
                       +P     T  +DL      + W  M+ +  +   K+IGVSNF + +++
Sbjct: 128 ------------VPFINPETAGIDLK-----EAWRQMEEIYDRGWAKNIGVSNFDVESLE 170

Query: 176 DLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--STGAPILELG 231
            +      K  PVVNQ+E    + Q    ++ +CK   I +E YSPL   + G P    G
Sbjct: 171 YIRTI--GKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKP----G 224

Query: 232 TINEV----SKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSK 285
            ++++    +KK       ++  W++Q  ++ +  S  + RI  +L     EL +E+F+ 
Sbjct: 225 PLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTS 284

Query: 286 LNNISSEVGEKR 297
           +    +EVG+ +
Sbjct: 285 I----TEVGKTK 292

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  100 bits (249), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 147/307 (47%), Gaps = 56/307 (18%)

Query: 11  TLNDGNQLPYV---GLGT-WQSKENDAYK-------AVVAALKA-GYRHIDTAAIYGNEE 58
           TLN+GN++P V   G GT W   E +A K        V  AL   G  HID A IY    
Sbjct: 9   TLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYP 68

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDD---ALNQSLERLGLDYVDLYLMHWPVPI 115
           E+G+A++++   R+EI++T K + T  +  D+        L+ LG+DY+DLYL+H P   
Sbjct: 69  ELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF-- 125

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNI 174
                        I    +G        +   + W+ ++ L KS K K+IGVSNF+  ++
Sbjct: 126 -------------ITEGRNG--------FTLEQAWKYLEELYKSGKAKNIGVSNFAKEDL 164

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STG 224
           + +L     K  P VNQ+E    L      +  F K  +I++EAYSPLG        +  
Sbjct: 165 ERILKIAEIK--PQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADS 222

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEE 282
            P  +   INE+++K     A V+  W+ +R ++ +  S    R+    ++ T +L + E
Sbjct: 223 LPFYKY--INELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTE 280

Query: 283 FSKLNNI 289
             K+  +
Sbjct: 281 VEKITEL 287

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  100 bits (248), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 145/308 (47%), Gaps = 56/308 (18%)

Query: 11  TLNDGNQLPYV---GLGT--WQSKENDA------YKAVVAALK-AGYRHIDTAAIYGNEE 58
           TLN+GN++P V   G GT  ++ +E DA       K +  AL   G  H+D A +Y    
Sbjct: 9   TLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYP 68

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLYLMHWPVPI 115
           E   A+K++   R+EIFVT K +  Q +    P + L+  L+R GL+YVDLYL+H P   
Sbjct: 69  EFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPF-- 125

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNI 174
                 K+ N   I                  + W  ++ L  + K K+IGVSNF + ++
Sbjct: 126 ----ASKEKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDL 164

Query: 175 KDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEAYSPLG--------STG 224
           + +L     K  P VNQ+E    L      +V+F +  +I +EAY+PLG           
Sbjct: 165 EKILKVAKVK--PQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQA 222

Query: 225 APILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI--ISNLQTMELPAEE 282
            P  +   I ++++K +   A ++  W+ +R I+ +  S    RI    NL   +L  +E
Sbjct: 223 KPFYDY--IKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDE 280

Query: 283 FSKLNNIS 290
             ++  + 
Sbjct: 281 VDEITKLG 288

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 89.7 bits (221), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 158/327 (48%), Gaps = 66/327 (20%)

Query: 10  VTLNDGNQLP---YVGLGTWQSKE---NDAYKAVVAALKA-----GYRHIDTAAIYGNEE 58
            TLN+GN +P    VG+G   +K     D  K ++  LK      G+ HI TA  Y N  
Sbjct: 9   FTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNG 68

Query: 59  EVGRAIKDSGVRRSEIFVTTKLWGTQHR---HPDDALNQSLERLGLDYVDLYLMHWPVPI 115
            +  A+K S   R EI++T K + +Q +    P +AL +SL+RLG DYVDLYL+H P   
Sbjct: 69  LLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNPC-- 125

Query: 116 NDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNI 174
                        +  + +G            K W+ M+ L K+ KVK+IGVSNF I ++
Sbjct: 126 -------------LDSSPNGI--------SLEKAWKQMELLYKTGKVKNIGVSNFRIEDL 164

Query: 175 KDLLASPGNKEV-PVVNQVELHPLLPQF--ELVEFCKSKNIVVEAYSPLGSTGAPILEL- 230
           + L     + E+ P VN++E H  L      + E+ K+ ++++  YSPL        +  
Sbjct: 165 ERL----KDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFM 220

Query: 231 -----GTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRI-----ISNLQTMELPA 280
                  I  +++K     A ++  W+    + VLP  +T +++      S++ + EL +
Sbjct: 221 DFPFYRYIIGLAEKYNKTEAQILLHWM--NCLGVLP-VITNTKVKWYKEASDIISFELTS 277

Query: 281 EEFSKLNNISSEVGEKRSVKPNWTPFI 307
           EE     ++ +E+G+K   KP+   F+
Sbjct: 278 EEL----DMITELGKKH--KPHRKHFV 298

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 4/84 (4%)

Query: 5  NSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI 64
          N   +  LN+G Q+P +G G ++  + D    V +ALK GYRHIDTA +Y N++E  + +
Sbjct: 8  NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 65 K----DSGVRRSEIFVTTKLWGTQ 84
          +    ++G  R  I+ TTKLW +Q
Sbjct: 68 RKYLDETGEARENIWFTTKLWDSQ 91

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 46/208 (22%)

Query: 25  TWQSKENDAYKAVVAALKAGYRHIDTAAIY-GNEEEVGRAIKDSGVRRSEIF-VTTKLWG 82
           T+    N     +V  LKAG + IDTA IY  NE+ +G       ++  + F + TK  G
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNEKAIGE------LQLPDRFTIHTKASG 62

Query: 83  TQ-----HRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTR 137
                    + + ++ +SL  LG+  V+ +L+H P P             +IP+ E    
Sbjct: 63  FSGGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP-------------EIPLEE---- 105

Query: 138 DLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDLLASPGNKE--VPVVNQVEL 194
                      T + + +L  + K +  G+SNFS  ++K +     +K+  +P V Q   
Sbjct: 106 -----------TLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNY 154

Query: 195 HPLLPQF--ELVEFCKSKNIVVEAYSPL 220
           + L      +L    K  +I + AYSP+
Sbjct: 155 NALSRAIVNDLFPLLKELHISLYAYSPI 182

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 73/345 (21%), Positives = 123/345 (35%), Gaps = 105/345 (30%)

Query: 19  PYV-GLGTWQSKEN---------DAYKAVVAALKAGYRHIDTAAIYGN---EEEVGRAIK 65
           P++ G  T+ +K+N         DAYK +  A   G R  DTA  Y N   E  +G  +K
Sbjct: 18  PFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSETILGSFLK 77

Query: 66  DSGVRRSEIFVTTKLW------------------------------GTQHRHPDDALNQS 95
              + R  + + TK++                              G   +H  +A   S
Sbjct: 78  HYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHILEAAKNS 137

Query: 96  LERLGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQA 155
           + RLG  Y+D+Y +H        +C  +  +      E+  R L+               
Sbjct: 138 VRRLG-TYIDVYQIH--------RCDHETPF------EETMRALN-------------DV 169

Query: 156 LPKSKVKSIGVSNFSINNIKDL-LASPGNKEVPVVNQVELHPLL---PQFELVEFCKSKN 211
           + +   + IG S+       +    +  +     VN    + LL    + E++ FCK  N
Sbjct: 170 VEQGYARYIGASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNN 229

Query: 212 IVVEAYSPL--GSTGAPILE--------------------------LGTINEVSKKLAIP 243
           + +  +SPL  G    PI E                          +  +N+++ K  + 
Sbjct: 230 VAITPWSPLQMGFLARPITEKSVRQTTDLVIKAMSLDKFSEADKEIIDRVNKLANKKNLK 289

Query: 244 PANVVFSWLIQRKIVVLPKSVTESRIISNLQTM--ELPAEEFSKL 286
            A V  +WL ++    +     ESRI   L+ +  EL  EE   L
Sbjct: 290 MATVTLAWLFKKNAFPIVGLNKESRIDDALEALKVELTEEEVKYL 334

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 83/184 (45%), Gaps = 40/184 (21%)

Query: 48  IDTAA--IYGNE-EEVGRAIKDSGVRRSEIFVT------TKLWGTQHRHPDDALNQSLER 98
           ID AA  IY     EVG A+  +   ++EIF+T      T++  T    PD AL    ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMAL----KK 62

Query: 99  LGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPK 158
           + ++YVD++ +H P     A      N L +               D + T  L ++   
Sbjct: 63  ISVEYVDMHFLHSPFVFKQA------NVLNL--------------KDAMHTDHLRRS--- 99

Query: 159 SKVKSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFE--LVEFCKSKNIVVEA 216
           +K  + G S+ ++  ++ +L +    E P VNQ++L   L      + + C+  +I++  
Sbjct: 100 NKANNRGASSVNVEELRRVLKTED--EEPQVNQIKLRSSLRNQTPGISKLCQENDILMAV 157

Query: 217 YSPL 220
           YS L
Sbjct: 158 YSTL 161

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 12/82 (14%)

Query: 40  ALKAGYRHIDTAAIYGNEEEV-GRAI---KDSGVRRSEIFVTTKL-------WGTQHRHP 88
           A++ G R IDT+  YG+ E++ G+A+   KD  + R   F+ TK+       +     H 
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDE-IPRENYFICTKVGRIRLDEFDYSREHV 110

Query: 89  DDALNQSLERLGLDYVDLYLMH 110
             ++ +S ERL  DY+D+  +H
Sbjct: 111 RSSVLRSCERLRTDYLDVVFLH 132

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 94/256 (36%), Gaps = 94/256 (36%)

Query: 49  DTAAIY-GNEEEVG--------------RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALN 93
           DTA IY G+E+ +G              R+ ++  + R  IF              +++ 
Sbjct: 38  DTARIYPGSEKSIGDLGIADDLVIDTKARSFEEGALTRDGIF--------------ESIK 83

Query: 94  QSLERLGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELM 153
           QS + L +D V++Y +H P PI              P+ E               T + +
Sbjct: 84  QSFDELKVDSVEIYYLHAPDPIT-------------PIEE---------------TIDAI 115

Query: 154 QALPK-SKVKSIGVSNFSINNIKDL--LASPGNKEVPVVNQVELHPLLPQFE--LVEFCK 208
             L K  K K  G+SN++ +++K +   A   N  +P V Q   +      E  L    +
Sbjct: 116 NELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKDLFPVLR 175

Query: 209 SKNIVVEAYSPLGS-----------TGAPILELGTI---------------------NEV 236
              I   AYSP+              GA   + GT+                     +++
Sbjct: 176 KYGISFYAYSPIAGGFLVKSVQQIEEGAGRFKKGTMIGDLYSKLYNTPKLLKGLEKWDDI 235

Query: 237 SKKLAIPPANVVFSWL 252
           +KK  IP +++ + W+
Sbjct: 236 AKKYDIPKSHLAYRWI 251

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 46/112 (41%), Gaps = 32/112 (28%)

Query: 30  ENDAYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEIFVTTKLW----- 81
           +N+ +K +  A  +G R  DTA  Y N +    +G  +K+  + R  + + TK+W     
Sbjct: 39  KNEVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDS 98

Query: 82  -----------------------GTQHRHPDDALNQSLERLGLDYVDLYLMH 110
                                  G   +H  +A   S+ RLG  Y+D+Y +H
Sbjct: 99  SLEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLGT-YIDVYQIH 149

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 51/130 (39%), Gaps = 41/130 (31%)

Query: 21  VGLGTWQSKE-----NDAYKAVVAALKAGY----RHIDTAAIYGN---EEEVGRAIKDSG 68
           VG  ++ SKE      D  + V   LK  Y    R  DTA +Y N   E  +G  +K   
Sbjct: 22  VGCMSYGSKEWAPWVQDDKEKVFTILKHCYDRGLRTFDTADVYSNGYSERLLGEFLKKYN 81

Query: 69  VRRSEIFVTTKLW----------------------------GTQHRHPDDALNQSLERLG 100
           +RR  + + TKL+                            G   +H   A+  S+ERLG
Sbjct: 82  IRRETVVILTKLFAPVDESLKFKFADPSTSENILLDLTNQQGLSRKHIMQAVKNSVERLG 141

Query: 101 LDYVDLYLMH 110
             Y+D+  +H
Sbjct: 142 T-YIDVLQIH 150

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 45/148 (30%)

Query: 40  ALKAGYRHIDTAAIYGNEEEV-GRA---IKDSGVRRSEIFVTTKL-------WGTQHRHP 88
           A+  G   IDT+  YG  E + G+A   IKD    R E F+ TK+       +     + 
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDE-FPREEYFICTKVGRVGRAEFNYSKENV 108

Query: 89  DDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIK 148
             ++ +S ERL  DY+DL  +H                           D++   +D  K
Sbjct: 109 RFSVKRSCERLHTDYLDLVYLH---------------------------DIEYVEYD--K 139

Query: 149 TWELMQALPKSK----VKSIGVSNFSIN 172
            WE ++ L K K    ++ IG+S + ++
Sbjct: 140 IWEALRELRKLKDEGVIRHIGISGYPVD 167

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 106/273 (38%), Gaps = 78/273 (28%)

Query: 30  ENDAYKAVVAALKAGYRHIDTAAIY-GNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHRHP 88
           + +A K V    K     +DTA IY G+EE +G+      + +S I  T      +    
Sbjct: 19  QEEASKFVDVLEKYKVEELDTARIYPGSEEAIGKF----ELPKSFIIDTKARGFGEGTLT 74

Query: 89  DDALNQSLER----LGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASW 144
            +++N+S+E     LG++ V+++ +H P P               P+ E           
Sbjct: 75  KESINESIEESFGLLGVESVEIFYLHCPDPAT-------------PLEE----------- 110

Query: 145 DFIKTWELMQALPK-SKVKSIGVSNFSINNIKDLLASPGNKE----VPVVNQ-------- 191
               T + + AL K  K K  GVSNFS  +++ + +   NKE    +P V Q        
Sbjct: 111 ----TLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSY--NKEKGYVLPTVYQGNYNAVGR 164

Query: 192 ---VELHPLLPQFELVEFCKS-----------------------KNIVVEAYSPLGSTGA 225
                L P+L +  L  +  S                        N V   YS L +   
Sbjct: 165 KIETSLFPVLRELGLSFYAYSPIAGGFLAKTPEEVLGGKGRFDTSNHVGALYSKLYNKPL 224

Query: 226 PILELGTINEVSKKLAIPPANVVFSWLIQRKIV 258
            I  LG   ++++K+ I  A++ + W+    I+
Sbjct: 225 LIKGLGQWGKIAEKVGISRASLAYRWVYNNSIL 257

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 33/114 (28%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGNEEE----VGRAIKDSGVRRSEIFVTTKLW------- 81
           +YK +  A   G R  DTA +Y N +     +G  +K+  + R  + + TKL+       
Sbjct: 19  SYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEYNISRETVVIMTKLFAPVDDTL 78

Query: 82  ---------------------GTQHRHPDDALNQSLERLGLDYVDLYLMHWPVP 114
                                G   +H  +A   SL RLG  Y+D+Y +H   P
Sbjct: 79  PDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGT-YIDVYQVHRADP 131

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 22/130 (16%)

Query: 1   MTLSNSTAKVTLNDGNQLPYVGLG--TWQSKE-NDAYKA-----VVAALKAGYRHIDTAA 52
           M L  +  +V   D  +LP + LG  T   +  +D Y+      V  AL+AG   IDT+ 
Sbjct: 16  MELRTTVRRVKELDIVELPELILGGATLSPRYIDDPYEVPTLGLVRRALEAGICAIDTSP 75

Query: 53  IYGNEEEV-GRAIKDSGVR----RSEIFVTTKL-------WGTQHRHPDDALNQSLERLG 100
            YG  EE+ G A+  + VR    R   F+ TK+       +     H   ++++S  RL 
Sbjct: 76  YYGKSEEIYGEAL--AAVRDEHPRETYFICTKVGREGPSDFDYSAAHVRASVHRSCARLH 133

Query: 101 LDYVDLYLMH 110
            +Y+DL  +H
Sbjct: 134 TEYLDLVYLH 143

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 49/126 (38%), Gaps = 38/126 (30%)

Query: 22  GLGTWQS----KENDAYKAVVAALKAGYRHIDTAAIYGN---EEEVGRAIKDSGVRRSEI 74
           G   WQ+       +A+K +      G R  DTA +Y N   E+ +G  +K   +RR  +
Sbjct: 27  GSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESEKFLGEFLKRYNIRRETV 86

Query: 75  FVTTKLW------------------------------GTQHRHPDDALNQSLERLGLDYV 104
            + TK++                              G   +H    + +S+ERLG  Y+
Sbjct: 87  VILTKVYFPVDDELPEFGGFKDLAASEQMQLDVTNQRGLSRKHILAGVAKSVERLG-TYI 145

Query: 105 DLYLMH 110
           D+  +H
Sbjct: 146 DVLQLH 151

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 80/194 (41%), Gaps = 16/194 (8%)

Query: 37  VVAALKAGYRHIDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSL 96
           V+  L     H+D A      ++V  AI D       I     +W    +     +N+++
Sbjct: 262 VIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGIVDGRNIWKNDFKKSSAFVNKAI 321

Query: 97  ERLGLDYVDLY----LMHWPVPIN-----DAQCKKDNNYLQIPMNEDGTRDLDLASWDFI 147
           E+LG D V +     L+H PV +      DA+ K   ++    ++E      +++  D  
Sbjct: 322 EKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVA 381

Query: 148 KTWEL----MQALPKSKV---KSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQ 200
              E     +++  KSK+    S+     SI+      ASP  + +P   ++   PL P 
Sbjct: 382 AALEANAKSVESRGKSKLIHDSSVKARVASIDQKMSTRASPFEQRLPEQKKIFNLPLFPT 441

Query: 201 FELVEFCKSKNIVV 214
             +  F ++K+I +
Sbjct: 442 TTIGSFPQTKDIRI 455

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEIFVTTKLWGT------ 83
           A++ + A  +AG   IDTA  Y NEE    +G  +K   +R  +I + TK  G       
Sbjct: 9   AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKLR-DQIVIATKFTGDYKKYEV 67

Query: 84  ----------QHRHP-DDALNQSLERLGLDYVDLYLMHW 111
                      H+H    ++  SL +L  D++D+  +HW
Sbjct: 68  GGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3.441
           YGR098C
          Length = 1648

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 107 YLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGV 166
           YL H+ V I  A        L I M    T +L L +  FI  W L   L + K +   +
Sbjct: 581 YLYHYEVLIKSAYI------LNIDMKRHSTNNLLLLTRSFIDKWILRLELSQYKERKDDI 634

Query: 167 SNFSINNIKDLL 178
           S+F +N +K L 
Sbjct: 635 SSFEVNFVKTLF 646

>YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}
           MET6Cobalamin-independent methionine synthase, involved
           in methionine biosynthesis and regeneration; requires a
           minimum of two glutamates on the methyltetrahydrofolate
           substrate, similar to bacterial metE homologs
          Length = 767

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 33/231 (14%)

Query: 8   AKVTLNDGNQLPYVGLGTWQSK---ENDAYKAV-VAALKAGYRHIDTAAIYGNEEEVGRA 63
           A     + + LP + L T+        DA K + VAAL     H+D        +EV  A
Sbjct: 234 AYTYFGEQSNLPKITLATYFGTVVPNLDAIKGLPVAAL-----HVDFVRAPEQFDEVVAA 288

Query: 64  IKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLY----LMHWPVPIN--- 116
           I +       I     +W    +     +N+++E+LG D V +     L+H PV +N   
Sbjct: 289 IGNKQTLSVGIVDGRNIWKNDFKKSSAIVNKAIEKLGADRVVVATSSSLLHTPVDLNNET 348

Query: 117 --DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNF----- 169
             DA+ K   ++    ++E      +++  D       ++A  KS V+S G S F     
Sbjct: 349 KLDAEIKGFFSFATQKLDEVVVITKNVSGQDVAAA---LEANAKS-VESRGKSKFIHDAA 404

Query: 170 ------SINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVV 214
                 SI+      A+P  + +P   +V   PL P   +  F ++K+I +
Sbjct: 405 VKARVASIDEKMSTRAAPFEQRLPEQQKVFNLPLFPTTTIGSFPQTKDIRI 455

>Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {ON}
           YDL124W - Hypothetical ORF [contig 219] FULL
          Length = 313

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 83/205 (40%), Gaps = 46/205 (22%)

Query: 30  ENDAYKAVVAALKAGYRHIDTAAIY-GNEEEVGRAIKDSGVRRSEIFVT-TKLWG-TQHR 86
           ++DA+K +    + G   +DTA IY G+EE +G       +R  E FV  TK  G  +  
Sbjct: 19  KDDAHKYLDVLKEHGVDELDTARIYEGSEEALGE------LRAPETFVIDTKARGFAEGS 72

Query: 87  HPDDALNQSLER----LGLDYVDLYLMHWPVPINDAQCKKDN-NYLQIPMNEDGTRDLDL 141
              D++NQS++     L ++ V+++ +H P P    +   D  N L +            
Sbjct: 73  LTRDSINQSIDESFRLLKVESVNIFYLHSPDPATLLEETLDTINSLYV------------ 120

Query: 142 ASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASPGNKE--VPVVNQVELHPLLP 199
                           K K K  G+SN+   +++ + +    K   +P V Q   +    
Sbjct: 121 ----------------KGKFKKFGLSNYKPEDVRKVYSYCKEKGYVLPTVYQGNYNAFAR 164

Query: 200 QFELVEF--CKSKNIVVEAYSPLGS 222
           + E   F   +   I   AYSP+  
Sbjct: 165 KAESTLFPVLRELEIAFYAYSPIAG 189

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 18/106 (16%)

Query: 151 ELMQALPKSKVKSIGVSNFSINNIKDLLASPGNKEVPVVNQV---------------ELH 195
           +L +     K K I + NF INN+K       NK+  + N+                EL 
Sbjct: 293 QLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSELL 352

Query: 196 PLLPQFELVEFCKSK---NIVVEAYSPLGSTGAPILELGTINEVSK 238
           PL+P FE++ +   +   N  V       +  A + E   +N+++K
Sbjct: 353 PLIPDFEILSYYFPRIQNNHDVTYIKNQSTVNAKVFESDNVNDLTK 398

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 31/97 (31%)

Query: 44  GYRHIDTAAIYGN---EEEVGRAIKDSGVRRSEIFVTTKLW-------------GTQHRH 87
           G R  DTA +Y N   E  +G  +K   +RR  + + TK++              T  R+
Sbjct: 53  GLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDLHHGNSTNERN 112

Query: 88  PDDALNQ--------------SLERLGLDYVDLYLMH 110
             D +NQ              S+ERLG  Y+D+  +H
Sbjct: 113 ALDLVNQNGLSRKHIITGVKNSVERLG-TYIDVLQIH 148

>NDAI0B01300 Chr2 (303531..304532) [1002 bp, 333 aa] {ON} Anc_2.604
           YMR041C
          Length = 333

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 18/116 (15%)

Query: 21  VGLGTWQSKENDAYKAV------VAALKAGYRHIDTAAIYGNEE-EVGRAIKD--SGVRR 71
           VG GT+  + N   +++        A   G   IDT+  YG+ E  +G+A+K+      R
Sbjct: 9   VGGGTFSEQYNSDPESLPISEILRYAFTNGVNAIDTSPYYGDSEILIGKALKELSDEFPR 68

Query: 72  SEIFVTTKL-------WGTQHRHPDDALNQSLERLGLDYVDLYLMH--WPVPINDA 118
               + TK+       +     H + ++ +S ERL   Y+DL  +H    VP+ D 
Sbjct: 69  ESYSICTKVGRISLDSFDYSKEHVEFSVRRSCERLNTTYLDLVYLHDVEFVPLEDT 124

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 23/100 (23%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEIFVTTKLWGTQHRHPD 89
           A+K + A  +AG   IDTA  Y NE+    +G  ++   + R +I + TK   T ++  D
Sbjct: 55  AFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKF-STDYKWYD 112

Query: 90  DALNQ------------------SLERLGLDYVDLYLMHW 111
              N+                  SL +L  D++D+  +HW
Sbjct: 113 VGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 40  ALKAGYRHIDTAAIYGNEE-EVGRAIKDSGVR--RSEIFVTTKLWGTQHRHPDDALN--- 93
           A + G   IDT+  YGN E  +G+A+ + G +  R    + TK+        D + +   
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 94  ----QSLERLGLDYVDLYLMH 110
               +S +RL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 40  ALKAGYRHIDTAAIYGNEEEVGRAIKDS---GVRRSEIFVTTKL-------WGTQHRHPD 89
           A++ G R IDT+  YG+ E +  A  +S    + R   F+ TK+       +     H  
Sbjct: 52  AMQFGVRAIDTSPYYGDSEVLYGAALESLKEELPRENYFICTKVGRIRLEEFDYSRSHIH 111

Query: 90  DALNQSLERLGLDYVDLYLMH 110
            ++ +S ERL   Y+D+  +H
Sbjct: 112 FSVLRSCERLKTKYLDVVFLH 132

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 20/103 (19%)

Query: 28  SKENDAYKAVVAALKAGYRHIDTAAIYGNEEE--------VGRAIKDSGVRRSEIFVTTK 79
           SKE  A++ + A  +AG   IDTA  Y NE+         V R ++D  V  ++     K
Sbjct: 51  SKER-AFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYK 109

Query: 80  LW-----------GTQHRHPDDALNQSLERLGLDYVDLYLMHW 111
            +           G   R    ++  SL +L  D++D+  +HW
Sbjct: 110 KYDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 18/92 (19%)

Query: 22  GLGTW----QSKENDAYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEI 74
           G  TW    Q  + +A+K +  A   G R  DTA +Y N +    +G  ++   + R  +
Sbjct: 27  GSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRETV 86

Query: 75  FVTTKLWGTQHRHPDDALNQSLERLGLDYVDL 106
            + TKL     R P D      E + +D+ ++
Sbjct: 87  VIMTKL-----RFPAD------ENMDIDFKNM 107

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 21/99 (21%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEIFVTTKL--------- 80
           A++ + A  +AG   IDTA  Y NEE    +G  +    +R  +I + TK          
Sbjct: 55  AFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKLR-DQIVIATKFTGDYKKYEV 113

Query: 81  --------WGTQHRHPDDALNQSLERLGLDYVDLYLMHW 111
                    G   R    ++  SL +L  D++D+  +HW
Sbjct: 114 GGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 44/208 (21%)

Query: 23  LGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWG 82
           L   Q  + D   A++   KAG + IDTA IY + E++   ++      +   + TK  G
Sbjct: 14  LNLLQRSDIDEISAILE--KAGVKDIDTARIYPDSEKIIGELQ----LPNRFTIHTKASG 67

Query: 83  -TQHRHPDDALNQSLER----LGLDYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTR 137
            +      D +N+S+E     LG+  V+ + +H P P             + P+ E    
Sbjct: 68  FSGGCLTKDNINKSIEESLSLLGVPSVETFFLHSPDP-------------ETPIEE---- 110

Query: 138 DLDLASWDFIKTWELMQAL-PKSKVKSIGVSNFSINNIKDL--LASPGNKEVPVVNQVEL 194
                      T   + +L  + K K  G+SNF+  ++K +   A   N  +P V Q   
Sbjct: 111 -----------TLGAINSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSY 159

Query: 195 HPLLPQFE--LVEFCKSKNIVVEAYSPL 220
           +      E  L    +  +    AYSP+
Sbjct: 160 NAFSRAIENDLFPLLRELHFSFYAYSPI 187

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON}
          highly similar to uniprot|Q02895 Saccharomyces
          cerevisiae YPL088W Putative aryl alcohol dehydrogenase
          transcription is activated by paralogous transcription
          factors Yrm1p and Yrr1p along with genes involved in
          multidrug resistance
          Length = 344

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 22 GLGTWQSKENDAYKAVVAALKAGYRH----IDTAAIYGN---EEEVGRAIKDSGVRRSEI 74
          G   W +   D  + + + LK  Y H     DTA  Y N   E+ VG  +K   +RR  +
Sbjct: 27 GSKDWAAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKYNIRRETV 86

Query: 75 FVTTKLW 81
           + TK++
Sbjct: 87 VILTKVY 93

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 57/120 (47%), Gaps = 20/120 (16%)

Query: 10  VTLNDGNQLPYVGLG--TWQSKENDAYKAV--VAALKAGYRH----IDTAAIYGNEEEV- 60
           V   D  +LP + LG  T  ++ ND    V  V  LK G+ H    IDT+  YG  E + 
Sbjct: 11  VDHGDITKLPPLVLGGATVNTQYNDDPTKVPLVDMLKHGFNHGIRAIDTSPYYGPSEILY 70

Query: 61  GRA---IKDSGVRRSEIFVTTKLWGTQ-------HRHPDDALNQSLERLGLDYVDLYLMH 110
           G+A   I+D   R S  ++ TK+   Q         H   ++ +S +RL  DY+DL  +H
Sbjct: 71  GQALEHIRDEFPRNS-YYICTKVGRIQLDEFDYSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 21/102 (20%)

Query: 30  ENDAYKAVVAALKAGYRHIDTAAIYGNEEE---VGRAIKDSGVRRSEIFVTTKL------ 80
           +  A++ + A  +AG   +DTA  Y NE+    +G  +K   VR  +I + TK       
Sbjct: 52  KEQAFELLDAFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKVR-DQIVICTKYTGDYKK 110

Query: 81  -----------WGTQHRHPDDALNQSLERLGLDYVDLYLMHW 111
                       G   R    ++  SL +L  D++D+  +HW
Sbjct: 111 YEAGDGKSANYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Smik_5.232 Chr5 complement(348431..350734) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 94/231 (40%), Gaps = 33/231 (14%)

Query: 8   AKVTLNDGNQLPYVGLGTWQSK---ENDAYKAV-VAALKAGYRHIDTAAIYGNEEEVGRA 63
           A     + + LP + L T+        DA K + VAAL     H+D        +++  A
Sbjct: 234 AYTYFGEQSNLPKITLATYFGTVVPNLDAIKGLPVAAL-----HVDFVRAPEQFDDIVAA 288

Query: 64  IKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLY----LMHWPVPIN--- 116
           I D       I     +W    +     +N+++E+LG + V +     L+H PV +N   
Sbjct: 289 IGDKQTLSVGIVDGRNIWKNDFKKSSAIVNKAIEKLGAERVVVATSSSLLHTPVDLNNET 348

Query: 117 --DAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNF----- 169
             DA+ K   ++    ++E      +++  D       ++A  KS V+S G S F     
Sbjct: 349 KLDAEIKGFFSFATQKLDEVVVITKNVSGQDVAAA---LEANAKS-VESRGKSKFIHDSA 404

Query: 170 ------SINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVV 214
                 SI+      A P  + +P   +V   PL P   +  F ++K+I +
Sbjct: 405 VKARVASIDEKMSTRAVPFEQRLPEQQKVFNLPLFPTTTIGSFPQTKDIRI 455

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 21/99 (21%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGN---EEEVGRAIKDSGVRRSEIFVTTK---------- 79
           +++ + A  +AG   IDTA  Y N   EE +G  +    +R  +I + TK          
Sbjct: 55  SFELLDAFYEAGGNFIDTANNYQNGQSEEWIGEWMSSRKIR-DQIVIATKYTSDYKAYQI 113

Query: 80  -------LWGTQHRHPDDALNQSLERLGLDYVDLYLMHW 111
                    G   R    ++  SL +L  D++D+  +HW
Sbjct: 114 GKNKSANFSGNHRRSLQLSVRDSLRKLQTDWIDILYVHW 152

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa]
          {ON} Anc_2.604 YMR041C
          Length = 309

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 45 YRHIDTAAIYGNEEE-VGRAIKDSGVRRSEIFVTTKL 80
          +  +DT+  YG+ E  VG+A+++  + R EI+V TK+
Sbjct: 41 FNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKV 77

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 97/265 (36%), Gaps = 80/265 (30%)

Query: 21  VGLGTWQSKE---------NDAYKAVVAALKAGYRHIDTAAIYGN---EEEVGRAIKDSG 68
           VG  ++ SKE          + +K +  A   G R  DTA +Y N   E  +G  ++   
Sbjct: 58  VGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSERILGEFLRHYN 117

Query: 69  VRRSEIFVTTKLW---------------------------GTQHRHPDDALNQSLERLGL 101
           + R  + + TK++                           G   +H    +  S+ERLG 
Sbjct: 118 INRETVVILTKVFFPTDESIHVTSKFDFSEQELLTLTNQRGLSRKHILAGVKASIERLG- 176

Query: 102 DYVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQAL----P 157
            Y+D+  +H          + D+   + PM                   E+M+AL     
Sbjct: 177 TYIDVLQIH----------RLDH---ETPME------------------EIMRALNDVVT 205

Query: 158 KSKVKSIGVSNFSINNIKDL-LASPGNKEVPVVNQVELHPLL---PQFELVEFCKSKNIV 213
           +  V+ IG S+       +L   +  +     V+    + LL    + EL+ F K   I 
Sbjct: 206 QGDVRYIGASSMLATEFAELNFIAERHDWFKFVSSQSYYSLLYREDERELIPFAKRHGIA 265

Query: 214 VEAYSPLGSTGAPILELGTINEVSK 238
           +  +SPL S GA    LG  +  S+
Sbjct: 266 LIPWSPL-SGGALTRPLGGTSNRSQ 289

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 31/104 (29%)

Query: 33  AYKAVVAALKAGYRHIDTAAIYGNEEE--------VGRAIKDSGVRRSEIFVTTKL---- 80
           A++ + A  +AG   IDTA  Y NE+         V R ++D      +I + TK     
Sbjct: 55  AFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRD------QIVIATKFTTDY 108

Query: 81  ------------WGTQHRHP-DDALNQSLERLGLDYVDLYLMHW 111
                       +   H+H    ++  SL +L  D++D+  +HW
Sbjct: 109 KKYEVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 49/117 (41%), Gaps = 10/117 (8%)

Query: 110 HWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNF 169
           HW    N  Q     NY+Q   N+  ++ L +  +D  K WE    +    + ++   N 
Sbjct: 113 HWKEADNYLQ----QNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNI 168

Query: 170 SINNIKDLLASPGNKEV--PVVNQVELHPLLPQFELVEF----CKSKNIVVEAYSPL 220
           S+ N++ ++ S G   +   ++  +E H L  +  ++      C   N  + A  P+
Sbjct: 169 SVENVRGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPV 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,074,945
Number of extensions: 1505342
Number of successful extensions: 3659
Number of sequences better than 10.0: 157
Number of HSP's gapped: 3340
Number of HSP's successfully gapped: 165
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)