Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017505.436ON45945923000.0
Kpol_1062.285.436ON4654646341e-76
SAKL0G02574g5.436ON4844753931e-41
ZYRO0F10076g5.436ON4824693791e-39
TDEL0E018905.436ON4744703693e-38
KLTH0F16016g5.436ON4844703245e-32
KLLA0E02223g5.436ON4804762981e-28
Ecym_47605.436ON4784762963e-28
AER403C5.436ON4804812742e-25
Kwal_55.214185.436ON4844732691e-24
TBLA0A028105.436ON4814742494e-22
KAFR0C008003.217ON36660810.18
KNAG0K015403.217ON36560810.21
Smik_6.2243.489ON705102790.42
TBLA0I017303.217ON36760741.2
Suva_14.3192.304ON48456713.8
NDAI0G007102.304ON49148714.0
SAKL0E07194g2.304ON49558704.6
TDEL0C013808.109ON25953686.4
KAFR0B029508.299ON48553687.5
Kwal_34.162011.430ON29692678.2
Skud_14.3022.304ON48456679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01750
         (459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    890   0.0  
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   248   1e-76
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   155   1e-41
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   150   1e-39
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    146   3e-38
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   129   5e-32
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   119   1e-28
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   118   3e-28
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   110   2e-25
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   108   1e-24
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    100   4e-22
KAFR0C00800 Chr3 complement(153439..154539) [1101 bp, 366 aa] {O...    36   0.18 
KNAG0K01540 Chr11 complement(317936..319033) [1098 bp, 365 aa] {...    36   0.21 
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...    35   0.42 
TBLA0I01730 Chr9 complement(384157..385260) [1104 bp, 367 aa] {O...    33   1.2  
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    32   3.8  
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    32   4.0  
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    32   4.6  
TDEL0C01380 Chr3 (237170..237949) [780 bp, 259 aa] {ON} Anc_8.10...    31   6.4  
KAFR0B02950 Chr2 complement(617932..619389) [1458 bp, 485 aa] {O...    31   7.5  
Kwal_34.16201 s34 (242852..243742) [891 bp, 296 aa] {ON} YCR015C...    30   8.2  
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    30   9.8  

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/459 (96%), Positives = 442/459 (96%)

Query: 1   MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNI 60
           MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNI
Sbjct: 1   MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNI 60

Query: 61  RNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYK 120
           RNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYK
Sbjct: 61  RNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYK 120

Query: 121 NYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLR 180
           NYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLR
Sbjct: 121 NYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLR 180

Query: 181 NSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTLG 240
           NSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTLG
Sbjct: 181 NSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTLG 240

Query: 241 PLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNETXX 300
           PLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNET  
Sbjct: 241 PLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNETNS 300

Query: 301 XXXXXXXXXXXXXXXFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFWDNEKEI 360
                          FEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFWDNEKEI
Sbjct: 301 ISNEIKKNISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFWDNEKEI 360

Query: 361 FKTLCQNDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEYLKNYSADTGV 420
           FKTLCQNDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEYLKNYSADTGV
Sbjct: 361 FKTLCQNDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEYLKNYSADTGV 420

Query: 421 SLVYKGDHSQMKLSYQIPLIHGNDNKHSGLSFDVAVTYC 459
           SLVYKGDHSQMKLSYQIPLIHGNDNKHSGLSFDVAVTYC
Sbjct: 421 SLVYKGDHSQMKLSYQIPLIHGNDNKHSGLSFDVAVTYC 459

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  248 bits (634), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/464 (33%), Positives = 247/464 (53%), Gaps = 15/464 (3%)

Query: 1   MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNI 60
            ++++I  S TKP+Y++QV V+N      LS +F +N+L +V+SNP+++V      F +I
Sbjct: 12  FVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDI 71

Query: 61  RNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYK 120
           + NL+ +GLY +VDV L  D+  SLLN SLK+ T++IGIES+VP SAT+ + P  L    
Sbjct: 72  KRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNL 131

Query: 121 NYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLR 180
                 TSN   SV+ ++ W N  G +D   I   A  N   +   +K    +F +P  +
Sbjct: 132 QTTFTTTSN-DCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTK 190

Query: 181 NSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTLG 240
             S+RT+L    S  K  +          G+ KL L   + + P+FYSGL+I   +    
Sbjct: 191 VPSLRTVLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIVNNK---- 246

Query: 241 PLSDEESETEIIGNISDEVINSLSLKSEYIT----DSRFYTSKFPSGGHLFKLVHQHVLN 296
           P+ + E   ++    S E   + S +S ++T    DS  +   FP+ G    L +++VL+
Sbjct: 247 PIFNGEIPIDV---PSPE--QTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLS 301

Query: 297 ETXXXXXXXXXXXXXXXXXFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFWDN 356
           +                  FEK++S LN ++ ++ + +G    P+  +  +   GE WD 
Sbjct: 302 QLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWDK 361

Query: 357 EKEIFKTLCQNDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEYLKNYSA 416
              + K +  N   ++ K G +SSF++PN  + SP+R Q+S L  NK K +A Y    +A
Sbjct: 362 RNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDGCAA 421

Query: 417 DTGVSLVYKGDHSQMKLSYQIPLIH-GNDNKHSGLSFDVAVTYC 459
           DTGVSLVYK   + M LSY++PL+   N    SG SFD+A+TYC
Sbjct: 422 DTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 130/475 (27%), Positives = 233/475 (49%), Gaps = 28/475 (5%)

Query: 4   DSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNN 63
           D++  S TKP+Y+T V V        LSD  Y++IL  V+S P++++ +    F  I+  
Sbjct: 17  DALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKK 76

Query: 64  LILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYV 123
           L  +GL+++V + LD D   +  +   +  +++ G+E  +P  A +++ P      K  +
Sbjct: 77  LFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYN--KLCL 134

Query: 124 TFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLLRN 181
           T  TS+  +S+     +IN  G ++  T+ L +D+N      ++++KS+D KF +PL +N
Sbjct: 135 TSGTSDMLSSMGGRISFINALGKAE--TLILQSDINYVPFSGKLNEKSLDGKFLLPLQKN 192

Query: 182 SSIRTILESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNI 232
            SI+ +++   +         +A       +Q+  NIG+ K  L     + PI ++G++ 
Sbjct: 193 PSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVST 252

Query: 233 QRKQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQ 292
             +   L   +D  + +E I   +   I S S  S+   D+R +   FP  G  F LV++
Sbjct: 253 VIR--NLYGFNDIANVSESIKQFNGSFIKS-SFVSQITNDTRKFVGLFPISGSRFNLVNE 309

Query: 293 HVLNE--TXXXXXXXXXXXXXXXXXFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS 350
           +VL +  +                 +E+H S LN++ITSS  F     +P  S  A +++
Sbjct: 310 YVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHT 369

Query: 351 GE-FWDNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKS 404
            + F+    +  K    N +  S     +++G+ SS+R+PN    SP+RFQ+       S
Sbjct: 370 MDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQV-FFNAGDS 428

Query: 405 KRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458
               E  ++++A TG SLVYK   + M L+Y +PL     D    G SF V +++
Sbjct: 429 LNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSF 483

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/469 (26%), Positives = 218/469 (46%), Gaps = 29/469 (6%)

Query: 10  DTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGL 69
           +TKP+Y++++++        LSD+    I  + ++ P++SV++   IF++IR  L+ +GL
Sbjct: 22  ETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGL 81

Query: 70  YKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTSN 129
           + +V++ LD D   + L+   K  +E  GIE+ +   A +    L   P  N ++  T+ 
Sbjct: 82  FSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKV----LLKRPDYNTISGTTTL 137

Query: 130 TQNSVSL--NRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTI 187
           + +++SL  ++ W NL G +D   ++L  + N   S+ D K     F++PL++  S+R I
Sbjct: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197

Query: 188 LESK------CS---IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTT 238
           +E++      CS   +A       +Q+ +  G  K  +    KS+P+ Y+G+++ R+   
Sbjct: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257

Query: 239 LGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNET 298
               +  E      G       +  S  + +  D+R +   FP  G  F+L +++V++++
Sbjct: 258 EFKPTASELYAPFKG-----PFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQS 312

Query: 299 XXXXXXXXXXXXXXXXXF--EKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS-GEFWD 355
                            F  E H S   D+IT SF   G    PL S    ++    F  
Sbjct: 313 QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQL 372

Query: 356 NEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEY 410
                 K    N +        +K+GL  S ++ N P  SP+R Q      N S      
Sbjct: 373 GGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTI 432

Query: 411 LKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458
             +Y+A TG+SLVYK   + + L+Y  PL     D    GLS  V++T+
Sbjct: 433 FNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  146 bits (369), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 219/470 (46%), Gaps = 29/470 (6%)

Query: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68
           S+TKP+Y++++ +        LS + Y+ IL   +S+PV++V      F +IR  L+ +G
Sbjct: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72

Query: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128
           LY++V + L+ D  A     + K S ++ GIES +   A + + P   +   N     TS
Sbjct: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKP---SGVYNSTAGTTS 129

Query: 129 --NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRT 186
             +   SV+++R ++NL G +D+ +  L    N   S+ + KS+   F++PL +N S+R 
Sbjct: 130 LVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRA 189

Query: 187 IL---------ESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGL-NIQRKQ 236
            L          SK  IA+  +    Q+ L+ GL K  ++    S+P FY+G+ +  R  
Sbjct: 190 SLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDI 249

Query: 237 TTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLN 296
           + LG        +++  N S +  N +SL+S++  D+R Y   FP  G+   + +++V++
Sbjct: 250 SGLG-----AQASKVFSNYSGK-FNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVIS 303

Query: 297 ETXXXXXXXXXXXXXXXXXF--EKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFW 354
           +T                 F  + H S   +++T+S        +P           +++
Sbjct: 304 QTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMDKWY 363

Query: 355 DNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAE 409
               +  K    N +        +KV L +S ++ N PI SP+R    +   N    +  
Sbjct: 364 LGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNT 423

Query: 410 YLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458
              +Y+A TG+SL YK   + M L+Y  PL     D    G SF V  +Y
Sbjct: 424 ATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  129 bits (324), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 118/470 (25%), Positives = 220/470 (46%), Gaps = 30/470 (6%)

Query: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68
           S  KP+Y T + V        LS+T Y ++L  V+  P++++      F  I+  LI +G
Sbjct: 22  SSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTG 81

Query: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128
           L+++V + LD +  +  L    K   +   +E  +P  A + +TP+ L   +  +T  T 
Sbjct: 82  LFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLN--RASLTSFTG 139

Query: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTIL 188
           +T +S+      IN FG ++  T++        +S  D+K ++AK  +PL +N S++ + 
Sbjct: 140 DTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVF 199

Query: 189 ESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTL 239
           ++  +         I K      KQ  +N+G+ K  +       P+ Y+G ++  +   L
Sbjct: 200 DANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVAR--NL 257

Query: 240 GPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNETX 299
             +  E SE   I       + + S  S+ + D+R +   FP+ G  F + +++VL+E+ 
Sbjct: 258 DEVRKEASEA--IRQFDAPFVKN-SFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESF 314

Query: 300 XXXXXXXXXXX----XXXXXFEKHISTLNDQITSSF-IFDGHVGVPLQSTFANLNSGEFW 354
                               FE H +   ++I +S  +  G +    +S+    +  +F+
Sbjct: 315 DKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHHIDKFY 374

Query: 355 DNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSV-LGINKSKRMA 408
                  K   +N +     K+ +K+GL SSF++PN P  SP+R Q     G  ++K+  
Sbjct: 375 LGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKPT 434

Query: 409 EYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457
           ++  + +A +GVSL+YK   + M L+Y  PL   G D +  G SF V+++
Sbjct: 435 QF--SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  119 bits (298), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 114/476 (23%), Positives = 218/476 (45%), Gaps = 42/476 (8%)

Query: 12  KPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGLYK 71
           K +Y T+V V        +SD  Y++I   ++++P++ V       ++I+  L+ +GL++
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 72  NVDVKL--DLDERASLLNHSLKLSTEQI----GIESVVPISATLNMTPLYLTPYKNYVTF 125
           + ++ L  D+D R+S      +L TE +     IE  +P  A + + P      K  ++ 
Sbjct: 77  SAEITLDHDVDVRSS------RLLTENVPKTLDIELPIPTIAQVKLVPAVYN--KGSLST 128

Query: 126 NTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLLRNSS 183
            T +T +S      WIN FG ++  TI L  D+N T    ++D++ + AK  +P  +N S
Sbjct: 129 TTRDTYSSAGARLFWINKFGNAE--TISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPS 186

Query: 184 IRTILESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQR 234
           ++  + +  +         I +       QF L+ G+ K  L    KS+   ++G+ +  
Sbjct: 187 VKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVA 246

Query: 235 KQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHV 294
           +   +   +D  + ++ I         S S  SE  +DSR + ++FP  G   +L H+++
Sbjct: 247 RN--IYGFADALAVSDSIKQFQGTFTKS-SFISELKSDSREFYNRFPVSGKRVQLFHEYI 303

Query: 295 LNE--TXXXXXXXXXXXXXXXXXFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS-- 350
           L++  T                 +E H    N ++ +S   D     P ++    L    
Sbjct: 304 LSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLL 363

Query: 351 GEFWDNEKEIFKTLCQNDIK-----VSHKVGLVSSFRVPNIPITSPIRFQ--LSVLGINK 403
             F+    +  K   +N +        +K+G+ SSF++PN PI SP+R Q  ++   +  
Sbjct: 364 DSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLN 423

Query: 404 SKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
           + R A   +  +  TG+SL+Y    + + LSY +PL +   D    GL+F + +++
Sbjct: 424 NWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  118 bits (296), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 120/476 (25%), Positives = 221/476 (46%), Gaps = 46/476 (9%)

Query: 10  DTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGL 69
            TKP+++T V V N      LS++ +E+IL  V+S P ++++        I   L+ +GL
Sbjct: 21  QTKPLFITSVYV-NDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGL 79

Query: 70  YKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTSN 129
           Y +V++ LD D+   + ++  +++ ++ G+E  VPI A + + P +  P     T  T +
Sbjct: 80  YDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTT--TRD 137

Query: 130 TQNSVSLNRDWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLLRNSSIRTI 187
           +  +  ++   +N F  ++  TI L  +LN T    +ID+K +  K  +PL +  S++ +
Sbjct: 138 SYAAAGIHLSSLNKFQQAE--TIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAV 195

Query: 188 LESKCSIAK-------PRNDTMKQFEL--NIGLTKLKLIGGIKSLPIFYSGLNIQRKQTT 238
            +   ++         P +D  KQ ++  NIG+ + ++       PI YSG++I      
Sbjct: 196 FDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISI------ 249

Query: 239 LGPLSDEESETEIIGNISDEVINS-LSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNE 297
           LG    +  +TE+  +I+  V +S +S   + + +++ +    P  G  F L ++ VL +
Sbjct: 250 LGRNLLDLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQ 309

Query: 298 TXXXXXXXXXXXXXXXXXFEKHISTLNDQITSSF------IFDGHVGVPLQSTFANLNSG 351
           T                 +E + S L + I +S       IF    G  L+    +    
Sbjct: 310 T-VAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMD---- 364

Query: 352 EFWDNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLG---INK 403
           +F+       K   +N +        +KV   SSF +P  P+ SP+R Q  V      N 
Sbjct: 365 QFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNS 424

Query: 404 SKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
            + + E L   +  TG+SLVY+   + + L+Y +PL +   D    G SF V++ Y
Sbjct: 425 ERGIPEDL---ATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAY 477

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  110 bits (274), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 118/481 (24%), Positives = 216/481 (44%), Gaps = 44/481 (9%)

Query: 4   DSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNN 63
           D +  S TKP+Y+T V V++G     LSD   ++IL  V++ P++S+       + I  N
Sbjct: 17  DQLGKSQTKPLYITSVQVEDGK-DYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75

Query: 64  LILSGLYKNVDVKLDLDERASLLNHSLK-LSTEQIGIESVVPISATLNMTPLYLTPYKNY 122
           L+ +GLY+++ + LD D ++ L+N  L  ++ ++  IE  +P+ A + + P    PY+  
Sbjct: 76  LMYTGLYQDISITLDHD-KSRLVNQFLSNIAPKEYDIELPLPVKALVKVLP---APYQRL 131

Query: 123 VTFNTSNTQNSVSLNR-DWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLL 179
               T+    + +  R   +N FG ++     L AD+N T    ++D K +D +  +P  
Sbjct: 132 SLVTTTRDSYASAGGRLASVNKFGLAE--VFSLQADVNYTPFSGKLDDKLVDLRCLVPFQ 189

Query: 180 RNSSIRTILESKCSIAKPRNDTM---------KQFELNIGLTKLKLIGGIKSLPIFYSGL 230
            N SI+ + +   ++    N            +Q   NIG+ K  L   + S P  ++G+
Sbjct: 190 NNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGV 248

Query: 231 NIQRKQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLV 290
           +I  +    G   D  S    +   +D  + + S  ++++  +R     FP  G  F  V
Sbjct: 249 SIVGRNLH-GIQLDRASYH--VSAWADSSLKT-SFVTQFLHSNRKLIGTFPVQGMKFNAV 304

Query: 291 HQHVLNETXXXXXXXXXXXXXXXXXFEKHISTLNDQITS-------SFIFDGHVGVPLQS 343
           ++ VL++T                 +EKH+S L + +T+       S I       P+  
Sbjct: 305 NELVLSQT-VAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVH 363

Query: 344 TFANLNSGEFWDNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSV 398
                   +F+       K   +N +      + +++ L SS  +P  P+ SP+R Q   
Sbjct: 364 IM-----DQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFF 418

Query: 399 LGINKSKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457
              +      +  ++ +A TG+SLVY+   + + L+Y +PL     D    G SF VA+ 
Sbjct: 419 NAGDVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478

Query: 458 Y 458
           Y
Sbjct: 479 Y 479

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 111/473 (23%), Positives = 210/473 (44%), Gaps = 36/473 (7%)

Query: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68
           S  KP+Y T + V        LSD  Y ++L  V+S P+++++     F  I+  LI +G
Sbjct: 22  SSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTG 81

Query: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128
           ++ +V + LD D   + L    + + +++ +ES VP  A + + PL     K   T +T+
Sbjct: 82  MFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFN--KLCFTSSTN 139

Query: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTIL 188
           +T  S+     ++N  G ++  T++        K+   +K++DAK  +PL +N S++ + 
Sbjct: 140 DTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVF 199

Query: 189 ESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTL 239
           ++  +         + K      +Q  +N+G+ K  L   +   P+FY+G ++  +    
Sbjct: 200 DTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARN--- 256

Query: 240 GPLSDEESETEIIGNISDEVINSLSLKSEYIT----DSRFYTSKFPSGGHLFKLVHQHVL 295
             L D  +E    G I     N+  LK+ +++    D+R +   FP+ G    L +++VL
Sbjct: 257 --LHDVPNEAS--GAIRQ--FNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVL 310

Query: 296 NETXXXXXXXXXXX----XXXXXXFEKHISTLNDQITSSF-IFDGHVGVPLQSTFANLNS 350
           ++                       E   S   ++I +S  I  G +     S     + 
Sbjct: 311 SQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHM 370

Query: 351 GEFWDNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSK 405
            +F+       K   +N +        +K+ + SSF++P  P  SP+R Q   L   +  
Sbjct: 371 DKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQF-FLNAGEVS 429

Query: 406 RMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457
                  + +A +G+SL+YK   + M L+Y +PL     D    G SF V+++
Sbjct: 430 NEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 116/474 (24%), Positives = 220/474 (46%), Gaps = 40/474 (8%)

Query: 11  TKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGLY 70
           TKP+Y+++V + +    + +SD+F +++L  V+S P+++++     F+NI + L  + L+
Sbjct: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80

Query: 71  KNVDVKLDLDERASLLNHSL--KLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128
           ++V + LD ++  S    +L   +S   I ++S +PI+A + + P       NY T+  S
Sbjct: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNY-TWTIS 139

Query: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSA--DLNQTKSEIDKKSIDAKFTMPLLRNSSIRT 186
           N ++  S +++WIN    +D   I  SA  DL+ TK +  K   D   T PL+  +S+++
Sbjct: 140 NNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFK--FDGLSTYPLVPFTSVKS 197

Query: 187 ILESKCSIAKPRNDTMK--QFELNIGLTKLKLIG---GIKSLPIFYSGLNIQRKQTTLGP 241
           +  S  S+ KP   +    Q+ +  G  K        G+KS  + Y+GL I       G 
Sbjct: 198 V--SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNL-YTGLAIN------GA 248

Query: 242 LSDEESETEIIGNIS----DEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLN- 296
           + DE +   ++ N +     ++    S+ S++ TDSR +    P  G  F + +++VLN 
Sbjct: 249 IKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVLNG 308

Query: 297 ----ETXXXXXXXXXXXXXXXXXFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGE 352
               +                  FEK+ +   D I  S +      +       N  +  
Sbjct: 309 LNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWETKR 368

Query: 353 FWDNEKEIFKTLCQ-----NDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRM 407
              NE  +   L +     ND    + V L +S  + +    SP+RFQ S+  + +    
Sbjct: 369 REANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSI-QLERYNNC 427

Query: 408 AEYLKNYSADTG-VSLVYKGDHSQMKLSYQIPL--IHGNDNKHSGLSFDVAVTY 458
             + +     TG + LVYK + +   + Y +P+  I G+D K +G + + ++++
Sbjct: 428 CPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTK-AGFAMNASISF 480

>KAFR0C00800 Chr3 complement(153439..154539) [1101 bp, 366 aa] {ON}
           Anc_3.217 YBR018C
          Length = 366

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 142 NLFGTSDTGTIKL-SADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTILESKCSIAKPRND 200
           NLF TS   ++ +  A LN T+ E+D+  +   F  PLLR++++R  L     + +P+ D
Sbjct: 284 NLFQTSFPYSMGIHQAPLNATQEELDRSWLHLHFYPPLLRSATVRKFLVGFELLGEPQRD 343

>KNAG0K01540 Chr11 complement(317936..319033) [1098 bp, 365 aa] {ON}
           Anc_3.217 YBR018C
          Length = 365

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 142 NLFGTSDTGTIKL-SADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTILESKCSIAKPRND 200
           NLF TS   ++ +  A LN TK E+D   +   F  PLLR++++R  L     + +P+ D
Sbjct: 283 NLFETSFPYSMGIHQAPLNATKEELDHSWLHLHFYPPLLRSATVRKFLVGFELLGEPQRD 342

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 2/102 (1%)

Query: 353 FWDNEKEIFKTLCQ-NDIKVSHKVGLVSSFR-VPNIPITSPIRFQLSVLGINKSKRMAEY 410
           F +N  E    LC   D KV +K+  ++ +    N PI       +     + SK   ++
Sbjct: 214 FTENGIEFIFVLCPLQDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQF 273

Query: 411 LKNYSADTGVSLVYKGDHSQMKLSYQIPLIHGNDNKHSGLSF 452
            K Y  + G   VY   H Q++   ++PLI+ +D +H  +SF
Sbjct: 274 GKLYKLNKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISF 315

>TBLA0I01730 Chr9 complement(384157..385260) [1104 bp, 367 aa] {ON}
           Anc_3.217 YBR018C
          Length = 367

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 142 NLFGTSDTGTIKL-SADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTILESKCSIAKPRND 200
           N+F  S   ++ L  A LN +K E+D       F  PLLR++++R  L     + +P+ D
Sbjct: 285 NMFECSFPYSMGLHQAPLNASKEELDNSWFHMHFYPPLLRSATVRKFLVGFEMLGEPQRD 344

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 404 SKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
           S  + +  K +S  TG+ LV +   ++ +L++ +P+  H ND    GL F + + +
Sbjct: 428 SNCIGQLSKEHSTSTGIGLVLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAF 483

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 412 KNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
           + +S  TGV ++ +   ++ +L++ +PL IH  D+   G  F V +++
Sbjct: 443 RQHSISTGVGILLRHPMARFELNFSVPLTIHQGDDVRKGFQFGVGLSF 490

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 402 NKSKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
           N S  +    + +S  TGV LV+K   ++ +L++ +P+  H +D+   G  + + +T+
Sbjct: 437 NLSSCIKSLAQEHSTSTGVGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTF 494

>TDEL0C01380 Chr3 (237170..237949) [780 bp, 259 aa] {ON} Anc_8.109
           YGL162W
          Length = 259

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 65  ILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLT 117
           +LSGL +      DL+  AS+    LKLS+  +      P+SA ++ +P Y+T
Sbjct: 36  MLSGLKRTNGS--DLESLASVATKRLKLSSHLVTPPPTAPVSAAISPSPSYVT 86

>KAFR0B02950 Chr2 complement(617932..619389) [1458 bp, 485 aa] {ON}
           Anc_8.299 YLR108C
          Length = 485

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 226 FYSGLNIQRK----QTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSR 274
           FY  LN++++     T L P+ ++E + EI+ N++D  I  L LK   I D R
Sbjct: 209 FYRLLNLEQRLINCMTNLNPMINDEIQEEILINLNDVAIRGLQLK---IDDDR 258

>Kwal_34.16201 s34 (242852..243742) [891 bp, 296 aa] {ON} YCR015C -
           Hypothetical ORF [contig 265] FULL
          Length = 296

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 16/92 (17%)

Query: 365 CQNDIKVSHKVGLVSSFRVPNIPITSPI-------------RFQLSVL-GINKSKRMAEY 410
           CQ  IK + K          N+PI +               +F+ S+L G +K K++ + 
Sbjct: 143 CQEFIKTTLKSAAAMRGYSENLPIPTVYCNTLLSDNNKLNGKFEKSILTGFDKVKKLEQL 202

Query: 411 LKNYSADTGVSLVYKGDHSQMKLSYQIPLIHG 442
           LK+     G S+ Y GD     LS   P +HG
Sbjct: 203 LKDLK--NGTSVWYVGDSETDLLSALYPSVHG 232

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 404 SKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458
           S  M    K +S  TG+ LV +   ++ +L++ +P+  H ND    G  F + + +
Sbjct: 428 SNCMGRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVF 483

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,709,618
Number of extensions: 2193844
Number of successful extensions: 7674
Number of sequences better than 10.0: 60
Number of HSP's gapped: 7944
Number of HSP's successfully gapped: 62
Length of query: 459
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 346
Effective length of database: 40,524,141
Effective search space: 14021352786
Effective search space used: 14021352786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)