Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017405.439ON1261266593e-90
CAGL0I01078g5.439ON1261265943e-80
Smik_15.2995.439ON1261265892e-79
YOR122C (PFY1)5.439ON1261265892e-79
Skud_15.2845.439ON1261265864e-79
TDEL0D026205.439ON1261265856e-79
KAFR0D050405.439ON1261265857e-79
NDAI0C015805.439ON1261265848e-79
Suva_8.1745.439ON1261265812e-78
Kpol_1062.275.439ON1261265796e-78
SAKL0G02640g5.439ON1261265701e-76
KLTH0F15950g5.439ON1261265622e-75
NCAS0H020705.439ON1261265604e-75
ZYRO0F10142g5.439ON1261265587e-75
KNAG0B042205.439ON1261265589e-75
KLLA0E02289g5.439ON1261265552e-74
Ecym_45105.439ON1261265449e-73
TBLA0A065005.439ON1191265413e-72
ACL168C5.439ON1261265404e-72
Kwal_55.214135.439ON58582691e-31
ZYRO0F02574g8.17ON63046680.86
YKR004C (ECM9)2.514ON37748671.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01740
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   258   3e-90
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   233   3e-80
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   231   2e-79
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   231   2e-79
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   230   4e-79
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   229   6e-79
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   229   7e-79
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   229   8e-79
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   228   2e-78
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   227   6e-78
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   224   1e-76
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   221   2e-75
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   220   4e-75
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   219   7e-75
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   219   9e-75
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   218   2e-74
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   214   9e-73
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   213   3e-72
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   212   4e-72
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   108   1e-31
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    31   0.86 
YKR004C Chr11 complement(446799..447706,447811..448036) [1134 bp...    30   1.0  

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  258 bits (659), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  233 bits (594), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGKVDKA +YS+AGDA WA SGGLSL A E +EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  231 bits (589), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNL+ TGKVDKA +YSRAGDA WA SGGLSL   E  EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+IIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  231 bits (589), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNL+ TGKVDKA +YSRAGDA WA SGGLSL   E  EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+IIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  230 bits (586), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNL+ TGKVDKA +YSRAGDA WA SGGLSL   E +E+ +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQT+II+HYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  229 bits (585), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLL TGKVDKA +YSRAGD+ WA+SGGL+L A E  EIA+GFD P GLQ+ G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTI+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  229 bits (585), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLAT KVD+A +YSRAGDAAWA SGG++L   E  EIA+GFD+ +GLQ+ G
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  229 bits (584), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGKVDKA +YSRAGD+ WA SGG  L A E +EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNL+ TGKVDKA ++SRAGDA WA SGGLSL   E  EI +GFD+P GLQ+ G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQT+IIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  227 bits (579), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGK+DKA LYSRAGDA WA+SGGL+L A E + IA+GFDDPS LQ+ G
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQTI++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  224 bits (570), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLL TGKVDKA +YSRAGDA WA SGGL+L   E +EIA+GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQTI+IAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  221 bits (562), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLL TGK+DKAA+YSRAGD+ WAASGGLSL   E  EIA+GF++PSGLQ+TG
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI V Y
Sbjct: 121 LISVSY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  220 bits (560), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (89%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQA TDNLLATGKVD+A LYSRAGD+ WA SGGL L   E  EIA+GFD+P+GLQ+ G
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFMLLRADD+SIYGRHDAEG+VCVRT QTI+IAHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI V+Y
Sbjct: 121 LISVKY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  219 bits (558), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYT+NLL TGK+DKAA+YSRAGD+ WA+SGGL+   QE  +IA GFD+PSGLQ+TG
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQTII+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LIG QY
Sbjct: 121 LIGAQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  219 bits (558), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLL TGKVDKA +YSRAGD+ WA SGGL+L   E + I  GFD+ +GLQ+ G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTI++AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 113/126 (89%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGK+DK+ +YSRAGDA WA+SGGL L   E +EIA+GFD+PSGLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQTI+I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  214 bits (544), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 112/126 (88%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNL+ATGKVDKA +YSRAGD  WA+SGG+SL A E +EI++GFD+  GLQ+ G
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQA       TGKVDKA +YSRAGD+ WA+SGGL L A E  EIA+GFD+PSGLQ+ G
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRADDRSIYGRHDAEG+VCVRTKQTI+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LIGVQY 126
           LIGVQY
Sbjct: 114 LIGVQY 119

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  212 bits (540), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60
           MSWQAYTDNLLATGKVDKA +YSRAGD  WA+SGGL+L   E  EI++GFD+ +GLQ  G
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGVQY 126
           LI VQY
Sbjct: 121 LISVQY 126

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  108 bits (269), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126
           ML+RADDRSIYGRHDAEGVVCVRTKQTI++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 30.8 bits (68), Expect = 0.86,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 48  KGFDDPSGLQTTGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTK 93
           KG+D P  +   GL    ++F L   D+R +Y  +D +    VR K
Sbjct: 306 KGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMK 351

>YKR004C Chr11 complement(446799..447706,447811..448036) [1134 bp,
           377 aa] {ON}  ECM9Non-essential protein of unknown
           function
          Length = 377

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 36  LSLTAQEATEIAKGFDDPSGLQTTGLHIQGQKFMLLRADDRSIYGRHD 83
           LSL  +  T   K F D SG+    ++     F+L   +++++Y  H+
Sbjct: 58  LSLFQEAHTYFNKTFSDQSGISNENIYYMTVGFLLTTPENKTVYNVHE 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,020,646
Number of extensions: 388001
Number of successful extensions: 746
Number of sequences better than 10.0: 23
Number of HSP's gapped: 746
Number of HSP's successfully gapped: 23
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)