Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017305.440ON46946918200.0
Kpol_1062.265.440ON4572909961e-131
NCAS0H020805.440ON4352828991e-116
KNAG0B042105.440ON4632868991e-116
TDEL0D026105.440ON4403818911e-115
Suva_8.1755.440ON4532828911e-115
CAGL0K10230g5.440ON4462768871e-115
KAFR0D050505.440ON4192788841e-114
YOR123C (LEO1)5.440ON4642808871e-114
Smik_15.3005.440ON4632818771e-113
NDAI0C015905.440ON4702828621e-110
KLTH0F15928g5.440ON4232838321e-107
SAKL0G02662g5.440ON4792598311e-106
TBLA0A064905.440ON4282798241e-105
ZYRO0F10164g5.440ON4232698221e-105
Skud_15.2855.440ON4872808231e-104
Kwal_55.214085.440ON4362748011e-102
KLLA0E02311g5.440ON4173687941e-101
ACL167C5.440ON4392867704e-97
Ecym_45115.440ON4612527628e-96
SAKL0H08206g8.613ON35149751.0
Kwal_26.85308.613ON36648695.6
TPHA0P006807.390ON72747697.6
YML117W (NAB6)8.844ON113492689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01730
         (469 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   705   0.0  
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   388   e-131
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   350   e-116
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   350   e-116
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   347   e-115
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   347   e-115
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   346   e-115
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   345   e-114
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   346   e-114
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   342   e-113
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   336   e-110
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   325   e-107
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   324   e-106
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   322   e-105
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   321   e-105
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   321   e-104
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   313   e-102
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   310   e-101
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   301   4e-97
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   298   8e-96
SAKL0H08206g Chr8 (706959..708014) [1056 bp, 351 aa] {ON} simila...    33   1.0  
Kwal_26.8530 s26 complement(827073..828173) [1101 bp, 366 aa] {O...    31   5.6  
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    31   7.6  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    31   9.4  

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/469 (79%), Positives = 374/469 (79%)

Query: 1   MSAEESAQDPVNSMAAVTGEKNANENATIVEDNSXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSAEESAQDPVNSMAAVTGEKNANENATIVEDNS                          
Sbjct: 1   MSAEESAQDPVNSMAAVTGEKNANENATIVEDNSVAEQVEEQGGEQVEAEEEEIDDLFGD 60

Query: 61  XXXXXXXXXXXSILRKKRGVAESGXXXXXXXXXXXIARRRRGYMDEDEDEEHAMYTRKFY 120
                      SILRKKRGVAESG           IARRRRGYMDEDEDEEHAMYTRKFY
Sbjct: 61  DDNEEDDGEDESILRKKRGVAESGDDDDEHNDHDDIARRRRGYMDEDEDEEHAMYTRKFY 120

Query: 121 GDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYARIPPFL 180
           GDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYARIPPFL
Sbjct: 121 GDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYARIPPFL 180

Query: 181 TIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQTVFKESNAQI 240
           TIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQTVFKESNAQI
Sbjct: 181 TIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQTVFKESNAQI 240

Query: 241 IQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFVPISTNS 300
           IQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFVPISTNS
Sbjct: 241 IQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFVPISTNS 300

Query: 301 RLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQ 360
           RLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQ
Sbjct: 301 RLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQ 360

Query: 361 EALDSPGFSQGNYGSSSSRKRGQTPSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           EALDSPGFSQGNYGSSSSRKRGQTPSY                                 
Sbjct: 361 EALDSPGFSQGNYGSSSSRKRGQTPSYDPRRERADEYEEDDFIVDDEGEEDDDVEDDVED 420

Query: 421 XXXXXXXXXXXXXXRNLERLKNSKTQNDFEVEEDSKRRKVAVIDDEDDE 469
                         RNLERLKNSKTQNDFEVEEDSKRRKVAVIDDEDDE
Sbjct: 421 EEDEDEEEEEEEEERNLERLKNSKTQNDFEVEEDSKRRKVAVIDDEDDE 469

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  388 bits (996), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/290 (66%), Positives = 236/290 (81%), Gaps = 10/290 (3%)

Query: 96  IARRRRGYMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILE 155
           I RRRR Y+DEDEDEE AMYTRKFYG++D +K D++E+ HEF+E DV L RH+VP KI  
Sbjct: 77  IGRRRRNYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITS 136

Query: 156 QKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLI 215
           ++ND       +  + YYA++PPFLTIDP+PFDPP FE+ V+ERL N  + ++++ DRLI
Sbjct: 137 EEND-------ADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLI 189

Query: 216 DENTIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQ 275
           D+NTIRWRYSRD NQ VFKESNA I+QWSDGSYSLKLGD+YTD+L+ND  NTFLTVSHDQ
Sbjct: 190 DQNTIRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQ 249

Query: 276 QELMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKK 335
           QELMQCV GGEISKS +FVPIST S+LHQRLSKAI RR+   T  PRSMI+N+DPE+EKK
Sbjct: 250 QELMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKK 309

Query: 336 ELEKKQSQIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTP 385
           ELEKKQSQ+FR+RRK+KQ+EIE   E+L++ GF  GN   S+SRKR  TP
Sbjct: 310 ELEKKQSQVFRERRKKKQKEIEA-LESLETTGF--GNNSYSASRKRSTTP 356

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  350 bits (899), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 173/282 (61%), Positives = 221/282 (78%), Gaps = 15/282 (5%)

Query: 107 DEDEEHAMYTRKFYGDEDVNKY--DEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDD 164
           D DEE AMYTRKFYGD+D N+Y  D+D  +H FKE +VEL+RH+VPYK   +K D +   
Sbjct: 78  DIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDET--- 134

Query: 165 ATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRY 224
                + YYA++PPFLTI+PVPFDP  FES+V++RL N ++ +D++GDRLIDENT+RWRY
Sbjct: 135 -----TVYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRY 189

Query: 225 SRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDG 284
           SRDANQ VFKESNAQI+QWSDGS+SLKLGD+YTD+LVN+ +NTFL VSHDQQELMQC +G
Sbjct: 190 SRDANQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNG 249

Query: 285 GEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQI 344
           GEI+K+ MF+P STNS++HQ+LSKA+ RR+Q     P +MIIN DPE+EK+ELEKKQ QI
Sbjct: 250 GEITKTLMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQI 309

Query: 345 FRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPS 386
            RDRR+R+ +    E+E L+SP  +    G   +RKR  TP+
Sbjct: 310 IRDRRRRQLK----EKELLESPDTTMDVSGGYETRKRN-TPN 346

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  350 bits (899), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/286 (58%), Positives = 217/286 (75%), Gaps = 14/286 (4%)

Query: 100 RRGYMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKND 159
           RR  +D DE+EE  MY RKFYG EDV+  D ++  HEFKEA+VELV+HIVPYK++     
Sbjct: 90  RRKRLDMDEEEE--MYNRKFYG-EDVDMSDTEQAEHEFKEANVELVKHIVPYKLV----- 141

Query: 160 NSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENT 219
              DDA   N  Y A++PPFL IDP PFDP  FE +V +RL+ + + +DR+GDRLIDENT
Sbjct: 142 --PDDAIGTNDIYVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENT 199

Query: 220 IRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELM 279
           +RWRYSRD NQ+VFKESN QI+QWSDGSYSLKLG++YTD+L+ND  NTFLTVSHDQQELM
Sbjct: 200 VRWRYSRDTNQSVFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELM 259

Query: 280 QCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEK 339
           QCV+GG ++K+ MF+P ST+S++HQ+LSKA+ARR+   +  P + I++VDPEIEKKELE+
Sbjct: 260 QCVEGGLVNKTLMFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELER 319

Query: 340 KQSQIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTP 385
           KQ QIF++RR+R+ R    E+E  +SP  + G   S S+     TP
Sbjct: 320 KQGQIFKERRRRQLR----EKELAESPDTTIGGPRSGSAGSWHGTP 361

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  347 bits (891), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 240/381 (62%), Gaps = 21/381 (5%)

Query: 98  RRRRGYMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQK 157
           RR    MD++E +EHAMYTRKFYG++  N  D++E+ + F E +VELVRHIVPYK +   
Sbjct: 72  RRGEMQMDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTV--- 128

Query: 158 NDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDE 217
                + A  K++ YYA++P FLTIDPVPFDPP FES+VKERL N+++ +D++GDRLIDE
Sbjct: 129 ----GEGADEKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDE 183

Query: 218 NTIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQE 277
           NTIRWRYSRD NQ V+KESNAQI+QWSDG  SLKLG +YTD+LVND  NTF  VSHD+QE
Sbjct: 184 NTIRWRYSRDENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQE 243

Query: 278 LMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKEL 337
           LMQC  GGE++KS MF+P STNS++HQ+L+KA+ RRDQ  T+ P    +N DPE+EK EL
Sbjct: 244 LMQCSQGGEVTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNEL 303

Query: 338 EKKQSQIFRDRRKRKQREIETEQEALDSPGFSQG--NYGSSSSRKRGQTPSYXXXXXXXX 395
           EKKQ Q+ R+RRKR+ +EIE+     +SP  S G   Y  +      +  SY        
Sbjct: 304 EKKQQQVVRERRKRQLKEIESR----NSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNE 359

Query: 396 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNLERLKNSK-------TQND 448
                                                     ERL+  K       T+ +
Sbjct: 360 YEQDDFLVDDDEEEEAGYSEEDDVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPE 419

Query: 449 FEVEEDSKRRKVAVIDDEDDE 469
            E +  +KRRKVA+IDDEDDE
Sbjct: 420 PESDPSTKRRKVAIIDDEDDE 440

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  347 bits (891), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 171/282 (60%), Positives = 215/282 (76%), Gaps = 11/282 (3%)

Query: 104 MDEDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162
           +D+DE EE AMYTRKFYG ED N + D+DE  H FKE +VELVRHI+P K        + 
Sbjct: 100 LDDDEAEEQAMYTRKFYG-EDANDFSDQDEATHTFKEENVELVRHIIPSKA-------NV 151

Query: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222
           ++  S N  +YARIP FLTIDP+PFDPP FE++V ER  N+ + +D++ DRLIDENT+RW
Sbjct: 152 NETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRW 211

Query: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282
           RYSRD +Q VFKESN QI+QWSDGSYSLK+G++YTD+LVND SNTFLTVSHDQQELMQC 
Sbjct: 212 RYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCY 271

Query: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342
           +GGEI K+ MF+P ST+S++HQ+LSKA+ R++Q   + P + IIN+DPE+EK+ELEKKQS
Sbjct: 272 EGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQS 331

Query: 343 QIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQT 384
           QI RDRRKR+ +E E +QE+ D  GF       SS    G T
Sbjct: 332 QILRDRRKRQLKEKE-KQESPDV-GFETAFRKQSSPTAYGAT 371

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  346 bits (887), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 165/276 (59%), Positives = 207/276 (75%), Gaps = 16/276 (5%)

Query: 111 EHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNS 170
           E  MYTRKFYG++ VN Y +D+  H FKE++V+L+RHI+PYK     N++        + 
Sbjct: 108 EQEMYTRKFYGEDAVN-YSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEH--------DE 158

Query: 171 TYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQ 230
            +YA++P FLTIDPVPFDP  FE+ V ERL  + + +D++GDRLIDENTIRWRYSRDA Q
Sbjct: 159 IFYAKVPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQ 218

Query: 231 TVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKS 290
            VFKESNAQI+QWSDGS+SLKLGD+YTD++VND  NTFLTVSHDQQELMQC DGGEI+K+
Sbjct: 219 HVFKESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKT 278

Query: 291 AMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRK 350
            MF+P STNS++HQ+LSKA++RR+      P S II  DPEIEKKELEK Q QI R+RRK
Sbjct: 279 MMFIPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRK 338

Query: 351 RKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPS 386
           R+Q+EIET + A       +  +  +   KRG TPS
Sbjct: 339 RQQKEIETRENA-------ENGFAETGEFKRGNTPS 367

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  345 bits (884), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 213/278 (76%), Gaps = 17/278 (6%)

Query: 109 DEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSK 168
           DEE AMY RKFYG+E  +  D +E    FKEADVELVRH+VPYK   +  D+        
Sbjct: 66  DEEEAMYNRKFYGEEGSDMSDHEEEAL-FKEADVELVRHVVPYKTFPENEDD-------- 116

Query: 169 NSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDA 228
            + YY ++P FL+IDP+PFDPP FE++VKER  N ++V+D++GDRLIDENTIRWRYSRDA
Sbjct: 117 KTIYYTKVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDA 176

Query: 229 NQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEIS 288
            Q VFKESNAQI+QWSDGSYSLKLG +YTD+LVN   NTFLTVSHDQQELMQCVDGG+I+
Sbjct: 177 EQRVFKESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQIN 236

Query: 289 KSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDR 348
           K+ +F+P STNS++HQRLSKAIARRDQ     P +MI+N+DPE+EK+ELEKKQ+QI R+R
Sbjct: 237 KTLIFIPTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRER 296

Query: 349 RKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPS 386
           R+R+ +    EQE L+SP         S S +R QTPS
Sbjct: 297 RRRQMK----EQERLESPELG----AFSHSNRRSQTPS 326

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  346 bits (887), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 165/280 (58%), Positives = 217/280 (77%), Gaps = 15/280 (5%)

Query: 104 MDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163
           +D+DE EE AMYTRKFYG++  N  D+DE  H FKE +VELVRHI+P K        + +
Sbjct: 108 LDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKA-------NVN 160

Query: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223
           +  S N  +YARIP FLTIDP+PFDPP FE++V ER  N+ + +D++ DRLIDENT+RWR
Sbjct: 161 ETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWR 220

Query: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283
           YSRD +Q VFKESN QI+QWSDG+YSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC +
Sbjct: 221 YSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYE 280

Query: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQ 343
           GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q  ++ P + I+++DPE+EKKELE+KQSQ
Sbjct: 281 GGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQ 340

Query: 344 IFRDRRKRKQREIETEQEALDSP---GFSQGN----YGSS 376
           I RDRR+R+ +E E +QE+ D+    GF + N    YG+S
Sbjct: 341 ILRDRRRRQLKEKE-KQESPDAAFETGFRKQNSPTTYGAS 379

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  342 bits (877), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/281 (59%), Positives = 217/281 (77%), Gaps = 17/281 (6%)

Query: 104 MDEDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162
           +D+DE EE AMYTRKFYG ED+N + D+DE  H FKE +VELVRHI+P K +        
Sbjct: 102 LDDDEAEEQAMYTRKFYG-EDLNDFSDQDEATHTFKEENVELVRHIIPSKGI-------V 153

Query: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222
           ++  S N  +YARIP FLTIDPVPFDPP FE++V ER  N+ + +D++ DRLIDENT+RW
Sbjct: 154 NETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRW 213

Query: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282
           RYSRD +Q VFKESN QI+QWSDG+YSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC 
Sbjct: 214 RYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCY 273

Query: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342
           +GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q   + P + I+++DPE+EK+ELEKKQS
Sbjct: 274 EGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQS 333

Query: 343 QIFRDRRKRKQREIETEQEALDSP---GF----SQGNYGSS 376
           QI RDRR+R+ +E E +QE+ D+    GF    S   YG+S
Sbjct: 334 QILRDRRRRQLKEKE-KQESPDAAFETGFRKQSSPTAYGTS 373

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  336 bits (862), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 175/282 (62%), Positives = 220/282 (78%), Gaps = 16/282 (5%)

Query: 106 EDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDD 164
           ED D+E AMYTRKFYGD D  KY D +E+ H+FKEA+VE++RH+VPYK        S D 
Sbjct: 113 EDMDDEEAMYTRKFYGDTD--KYSDNEEDAHDFKEANVEIIRHMVPYK-------TSSDQ 163

Query: 165 ATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRY 224
           A +  + YYA++PPFLTIDP+PFDP  FE++VK+RL + ++ +D++GDRLIDENTIRWRY
Sbjct: 164 ADT--TIYYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRY 221

Query: 225 SRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDG 284
           SRD NQ VFKESNAQI+QWSDGS+SLKLGD+YTD+LVND  NTFLTVSHDQQELMQC +G
Sbjct: 222 SRDQNQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNG 281

Query: 285 GEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQI 344
           GEI+K+ MF+P STNS++HQ+LSKA+ RR+Q     P +MII  DPE+EKKELEKKQ QI
Sbjct: 282 GEITKTMMFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQI 341

Query: 345 FRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPS 386
            R+RRKR+ +E E ++    SP  +    GS+SS+ R   PS
Sbjct: 342 LRERRKRQLKEREIQE----SPDTTFDVRGSASSKNRSPAPS 379

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  325 bits (832), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 208/283 (73%), Gaps = 28/283 (9%)

Query: 105 DEDEDEEHAMYTRKFYGD--EDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162
           +E+ED+E AMY RKFYGD  ED N    DE   EF+EAD+++++HIVPY         S 
Sbjct: 61  NEEEDDEQAMYNRKFYGDKGEDSN----DEGSQEFREADIDIMKHIVPY---------ST 107

Query: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222
           + +    + YY ++P FLTIDP+PFDPP F+S+++ER    T+V+D+I DRLI+ENT+RW
Sbjct: 108 EPSQGDKTIYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRW 167

Query: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282
           RYSRD NQ VFKESNA I+QWSDG+YSL+LGD+YTD+L+ND  +T+L VSHDQQEL+Q V
Sbjct: 168 RYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSV 227

Query: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342
            GGE++K+ +F+P STNS+ HQRLSKA+AR++Q     P + I+ VDPE+E+KELEKKQ 
Sbjct: 228 KGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQG 287

Query: 343 QIFRDRRKRKQREIETEQEALDS------------PGFSQGNY 373
           QI R+RRKR+ RE + E+E +DS            PG+SQ  Y
Sbjct: 288 QIIRERRKRQLRE-QQEREGMDSPAPTSKPRSASRPGYSQTRY 329

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  324 bits (831), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 155/259 (59%), Positives = 201/259 (77%), Gaps = 10/259 (3%)

Query: 107 DEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDAT 166
           +EDEE AMY RKFYGD+  N  D +++  EFKEADVE+ +HIVPYK       NS+D   
Sbjct: 127 EEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKT----TSNSQD--- 179

Query: 167 SKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSR 226
                YYA++P FLTIDPVPFDPP F+  V+ RL   ++ +D++ DRLIDENTIRWRYSR
Sbjct: 180 --KEVYYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSR 237

Query: 227 DANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGE 286
           D+ Q VFKESNAQIIQWSDG++SL+LGD+++D+L+ND  NTFLTVSH+QQELMQCV+GGE
Sbjct: 238 DSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGE 297

Query: 287 ISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFR 346
           I+K+ MF+P ST+S++HQRLSKA+ RR+Q     P + I+  DPE+E++ELEKKQ QI R
Sbjct: 298 ITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVR 357

Query: 347 DRRKRKQREIETEQEALDS 365
           +RRKR+ +E + E+E  DS
Sbjct: 358 ERRKRQLKE-QLEKENRDS 375

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  322 bits (824), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 204/279 (73%), Gaps = 9/279 (3%)

Query: 96  IARRRRGYMDEDEDEEH--AMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKI 153
           + + RR   DE+ D+E   AMY +KFYG++  N+ D+D+N +E+KE+D+ELVRHIVPYK 
Sbjct: 38  VRKNRRSEYDENSDDEQDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKT 97

Query: 154 LEQKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDR 213
                  S  +       YYA++PPFL +DPVPFD   FES VKER++N+ N   +I DR
Sbjct: 98  RP-----SNKELDKHRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDR 152

Query: 214 LIDENTIRWRYSRDANQT--VFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTV 271
           L DENTIRWRYSRD+N    VFK+SNAQIIQWSDGSYSLKLG+DYTD+L N+  N FLTV
Sbjct: 153 LRDENTIRWRYSRDSNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTV 212

Query: 272 SHDQQELMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPE 331
           SHDQQELMQC +GGEI+K+ MF+P ST S++HQRL+ A+  RD+ +T  P  M+IN DPE
Sbjct: 213 SHDQQELMQCYNGGEITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPE 272

Query: 332 IEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGFSQ 370
           IEKK LEKKQ Q+ RDRR+++ +E E  +    + GFS+
Sbjct: 273 IEKKLLEKKQWQMMRDRRRKQLQERENNEVDGITSGFSK 311

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  321 bits (822), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 161/269 (59%), Positives = 206/269 (76%), Gaps = 10/269 (3%)

Query: 96  IARRRRGYMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILE 155
           +  R R  MD++E EEHAMYTRKFYG EDV++  ++E   EF+E DVELVRHIVPY+  +
Sbjct: 73  VTLRHRQEMDDEEAEEHAMYTRKFYG-EDVDRVSDEEEAQEFREEDVELVRHIVPYRATQ 131

Query: 156 QKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLI 215
                     T K   YYA+IP FLTIDPVPFDPP FE+ VKERL N  + +D++GDRLI
Sbjct: 132 ---------GTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLI 182

Query: 216 DENTIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQ 275
           DENT+RWRYSRDANQ VFKESNAQI+QWSDG++SLKLGD+YTD+L ND  NTF  VSHDQ
Sbjct: 183 DENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQ 242

Query: 276 QELMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKK 335
           QELMQC +GGE++K+ MF+P ST+SR+HQ+L+KA+ RRD      P + I+  DPE+E+ 
Sbjct: 243 QELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERG 302

Query: 336 ELEKKQSQIFRDRRKRKQREIETEQEALD 364
           ELEKKQ Q+ R+RR+R+ +E+E+ + + D
Sbjct: 303 ELEKKQQQVVRERRRRQVKEMESREASGD 331

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  321 bits (823), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 214/280 (76%), Gaps = 11/280 (3%)

Query: 104 MDEDEDEEHAMYTRKFYGDEDVNKY-DEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162
           +D+DE EE AMYTRKFYG ED N Y D+DE  H FKE ++E+VRHI+P K        + 
Sbjct: 130 LDDDEAEEQAMYTRKFYG-EDANDYSDQDEAAHTFKEENIEIVRHIIPNKA-------NV 181

Query: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222
           ++  S N  +YARIP FLTID VPFDPP FE++V ER  N+T+ +D++ DRLIDENT+RW
Sbjct: 182 NETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRW 241

Query: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282
           RYSRD +Q VFKESN QI+QWSDGSYSLK+G++ TD+LVND SNTFLTVSHDQQEL+QC 
Sbjct: 242 RYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCY 301

Query: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342
           +GGEI K+ MF+P STNS++HQ+LSKA+ RR+Q   + P + I+N+DPE+EKKELEKKQS
Sbjct: 302 EGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQS 361

Query: 343 QIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRG 382
           Q+ RDRR+R+ +E E +QE+ D+  F  G    SS    G
Sbjct: 362 QVLRDRRRRQLKERE-KQESPDA-AFETGFRKQSSPTSYG 399

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  313 bits (801), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 202/274 (73%), Gaps = 23/274 (8%)

Query: 112 HAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNST 171
            AMY RKFYGD   +  DE  +  EF+EADV++V+H+VPY  +  + D +          
Sbjct: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSEGDKT---------I 130

Query: 172 YYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQT 231
           +YA++P FLTIDP+PFDPP F++++++R    ++ +D+I DRLI+ENT+RWRYSRD+ Q 
Sbjct: 131 FYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQ 190

Query: 232 VFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSA 291
           VFKESNAQI+QWSDG++SL+LGD++TD+L+ND  +T+LTVSHDQQEL+Q V GGE++K+ 
Sbjct: 191 VFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNM 250

Query: 292 MFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKR 351
           +F+P STNS+ HQRLSKA+AR++Q     P + I+ VDPE+E+KELEKKQ QI R+RRKR
Sbjct: 251 IFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKR 310

Query: 352 KQREIETEQEALDSP------------GFSQGNY 373
           + RE + E+E LDSP            G+SQ  Y
Sbjct: 311 QLRE-QQEREGLDSPAPAAKPKSTSSLGYSQSRY 343

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  310 bits (794), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 233/368 (63%), Gaps = 14/368 (3%)

Query: 104 MDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163
           +D++EDEE AMY RKF G ED     E+E   ++KE DVE+V+H+VPYK       N  D
Sbjct: 62  IDDEEDEEQAMYNRKFLG-EDYEGQSEEEYEKKYKEVDVEIVKHVVPYKTA-----NGAD 115

Query: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223
           D T     YYA++P FLTIDPVPFDPP F+ +V++R+   ++ +D++GDRLI+ENTIRWR
Sbjct: 116 DKT----IYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWR 171

Query: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283
           YSRD ++ VFKESNAQI++WSDG++SLK+GD+YTD+LVN+  NT+LTVSH++QEL+QCV+
Sbjct: 172 YSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVE 231

Query: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQ 343
           GGEI+KS MFVP STNS++H+ LSKA+ARRD+     P + I   DPE+EK+ELEKK  Q
Sbjct: 232 GGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQ 291

Query: 344 IFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYXXXXXXXXXXXXXXXX 403
           I R+RRK++ +E    + A DSP   Q N   + S KR     Y                
Sbjct: 292 ILRERRKKQLKEKLELENAGDSPE-PQFNIQKNLS-KRHNLDEYEYDDGFVAQDDEEEDD 349

Query: 404 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNLERLKNSKTQNDFEVEED--SKRRKVA 461
                                           N +RL+  K     E +ED  +K+RK+A
Sbjct: 350 EEEEEDEDFSGEDNDVGDEEESDGGDSEKEYENAKRLREVKQTGAQEYQEDAQAKKRKIA 409

Query: 462 VIDDEDDE 469
           V+DDEDDE
Sbjct: 410 VLDDEDDE 417

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  301 bits (770), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 148/286 (51%), Positives = 207/286 (72%), Gaps = 23/286 (8%)

Query: 97  ARRRRGY---MDEDEDEEHAMYTRKFYGD---EDVNKYDEDENMHEFKEADVELVRHIVP 150
           +RR RG    +  +++EE  MY RKFYGD   +  +  DEDE   E KEAD+ELV+H+VP
Sbjct: 64  SRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDE-AREIKEADLELVKHVVP 122

Query: 151 Y---KILEQKNDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVK 207
               K LE            K   YY ++P FLTIDPVPFDPP F+ ++++R+   ++ +
Sbjct: 123 LLYNKPLE-----------GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKE 171

Query: 208 DRIGDRLIDENTIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNT 267
           D++GD LIDENTIRWRYSR ++Q VFKESNAQ+I+WSDG+ SLKLGD+YTD+L N+I NT
Sbjct: 172 DQLGDSLIDENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENT 231

Query: 268 FLTVSHDQQELMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIIN 327
           +LTVSH+QQE+MQCV+GG IS S +F+P STNS++H+RL+KAIARR+      P + I+ 
Sbjct: 232 YLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVR 291

Query: 328 VDPEIEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGFSQGNY 373
            DPE+EK+EL+KK  Q+ R+RRKR+ +E + +++ L+  G +QG++
Sbjct: 292 KDPELEKRELQKKHDQVLRERRKRQLKE-QLDRDNLEG-GLAQGSF 335

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  298 bits (762), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 199/252 (78%), Gaps = 12/252 (4%)

Query: 107 DEDEEHAMYTRKFYGDEDVNK--YDED-ENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163
           DE++E  MY RKFYGD D+ K  Y+ D E   E KEA+V++++H+VPY      N + KD
Sbjct: 82  DEEDEQEMYNRKFYGD-DLKKTSYESDVEEEREIKEANVQIMKHVVPYYTT---NASEKD 137

Query: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223
                +S YYA++P FLTIDP+PFDPP F+S++++RL+  ++ +D++GDRLIDENTIRWR
Sbjct: 138 -----SSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWR 192

Query: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283
           YSR ANQ VFKESNAQIIQWSDG++SLKLGD+++D+L+NDI NT++TVSH+Q+ELMQCV+
Sbjct: 193 YSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVE 252

Query: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQ 343
           GGEI KS +F+P STNS+ HQRLS AIARR+      P + I+ +DPE+EKKELEKK  Q
Sbjct: 253 GGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPELEKKELEKKHDQ 312

Query: 344 IFRDRRKRKQRE 355
           + R+RRKR+ +E
Sbjct: 313 VIRERRKRQLKE 324

>SAKL0H08206g Chr8 (706959..708014) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q02950 Saccharomyces cerevisiae YPL118W MRP51
           Mitochondrial ribosomal protein of the large subunit
           MRP51 exhibits genetic interactions with mutations in
           the COX2 and COX3 mRNA 5'-untranslated leader sequences
          Length = 351

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 321 PRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGFS 369
           P S ++N+DP   + ++EKK SQ+   R+  K+  +  + EAL +  FS
Sbjct: 122 PLSSLLNIDPTSSRTDVEKKLSQVKSLRKVFKKWLLSKDPEALKNKSFS 170

>Kwal_26.8530 s26 complement(827073..828173) [1101 bp, 366 aa] {ON}
           YPL118W (MRP51) - Component of small subunit of the
           mitochondrial ribosome [contig 61] FULL
          Length = 366

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 321 PRSMIINVDPEIEKKELEKKQSQIFRDRRKRKQREIETEQEALDSPGF 368
           P S ++NVDP   K E+E++ +Q+   R   K+  +E + EAL +  F
Sbjct: 137 PLSSLLNVDPSTPKPEIERRFAQMKDLRSAFKKWLLEHDPEALVNKSF 184

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 116 TRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162
           + KFY  E  N+Y E E +   KE    LV H+  +K  E+KN N K
Sbjct: 517 SNKFYC-EICNEYQEAERLIGIKELPKHLVVHLKRFKYCEEKNCNIK 562

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 268 FLTVSHDQQELMQCVDGGEISKSAMFVPISTNSRL-HQRLSKAIARRDQNSTESPRSMII 326
           F+ +++D + L   ++   ++++A    I+  S +    L   IA +D     + RS+II
Sbjct: 301 FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKD-----ATRSIII 355

Query: 327 NVDPEIEKKELEKKQSQIFRDRRKRKQREIET 358
                +EK +L KK+ Q F DR K K+  +E+
Sbjct: 356 EFKSPVEKSDLFKKKLQ-FLDRSKNKRYILES 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,951,452
Number of extensions: 1990061
Number of successful extensions: 11632
Number of sequences better than 10.0: 136
Number of HSP's gapped: 12037
Number of HSP's successfully gapped: 147
Length of query: 469
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 356
Effective length of database: 40,524,141
Effective search space: 14426594196
Effective search space used: 14426594196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)