Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017205.441ON53753728660.0
ZYRO0F10186g5.441ON51945712981e-174
Kpol_1062.255.441ON53347212721e-170
TBLA0A027905.441ON54755812681e-169
TDEL0D026005.441ON52348212631e-169
SAKL0G02684g5.441ON53949212491e-167
NDAI0B057105.441ON56348812251e-163
NCAS0F034205.441ON52552111561e-153
CAGL0A02904g5.441ON50146111361e-150
KLLA0E02333g5.441ON48045910821e-142
KNAG0C048705.441ON45847010641e-140
Ecym_45125.441ON52748110621e-139
Skud_4.6405.441ON51146310451e-136
Smik_4.6375.441ON51145810441e-136
Suva_2.5435.441ON51146310381e-135
KAFR0E038105.441ON49047110221e-133
YDR371W (CTS2)5.441ON51147910191e-132
Kwal_55.214025.441ON5164649831e-127
KLTH0F15906g5.441ON5154589801e-127
ACL166W5.441ON4904529651e-125
SAKL0B04158g4.173ON190397742.1
TPHA0B029602.171ON1142103723.9
Ecym_55765.622ON50082705.6
Skud_4.4178.340ON130549715.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01720
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...  1108   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   504   e-174
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   494   e-170
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   493   e-169
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   491   e-169
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   485   e-167
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   476   e-163
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   449   e-153
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   442   e-150
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   421   e-142
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   414   e-140
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   413   e-139
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   407   e-136
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   406   e-136
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   404   e-135
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   398   e-133
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   397   e-132
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   383   e-127
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   382   e-127
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   376   e-125
SAKL0B04158g Chr2 (370872..376583) [5712 bp, 1903 aa] {ON} highl...    33   2.1  
TPHA0B02960 Chr2 complement(673638..677066) [3429 bp, 1142 aa] {...    32   3.9  
Ecym_5576 Chr5 complement(1184265..1185767) [1503 bp, 500 aa] {O...    32   5.6  
Skud_4.417 Chr4 (741302..745219) [3918 bp, 1305 aa] {ON} YDR159W...    32   5.8  

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/537 (100%), Positives = 537/537 (100%)

Query: 1   MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRFDAKPGNISSELNQHDREYDP 60
           MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRFDAKPGNISSELNQHDREYDP
Sbjct: 1   MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRFDAKPGNISSELNQHDREYDP 60

Query: 61  IMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEG 120
           IMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEG
Sbjct: 61  IMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEG 120

Query: 121 TIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPI 180
           TIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPI
Sbjct: 121 TIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPI 180

Query: 181 HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE 240
           HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE
Sbjct: 181 HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE 240

Query: 241 DDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQ 300
           DDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQ
Sbjct: 241 DDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQ 300

Query: 301 QMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKY 360
           QMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKY
Sbjct: 301 QMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKY 360

Query: 361 MKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLP 420
           MKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLP
Sbjct: 361 MKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLP 420

Query: 421 IKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLN 480
           IKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLN
Sbjct: 421 IKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLN 480

Query: 481 NPKLSLINSFTFDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET 537
           NPKLSLINSFTFDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET
Sbjct: 481 NPKLSLINSFTFDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET 537

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  504 bits (1298), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 328/457 (71%), Gaps = 8/457 (1%)

Query: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137
           Y+ G+YYS+WSPY PR  FPHDID S+VSH+YY+F L+DG  G +KSSD WSDFQ+D+YK
Sbjct: 68  YTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYK 127

Query: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197
           PL + L Q+    D V  SM   +LP GC+GE FYLR+T I +   K   FKV M+VGGW
Sbjct: 128 PLAVKLNQLQLKNDDVHASMG--VLPKGCVGELFYLRHTGI-LDRDKGRHFKVMMAVGGW 184

Query: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257
           SNR+ +PKMVRDP++V+ FINSC++TMF YGFDGIDLDWEFP++DGFEP MYL++ ++++
Sbjct: 185 SNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMR 244

Query: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317
           +K  ELE  I+    +H    P F+LS+A PAF +KL +LP++++D+++D WNMMTYDY 
Sbjct: 245 LKFDELEEVIFAGEPNH----PKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300

Query: 318 GEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMA 377
           GEWS VTGYH NL+  P    S  K   S+ +E L  ++A+  M +   + SRKI LGMA
Sbjct: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360

Query: 378 AYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC 437
           AYGRGF+ V  S  + +   K F+GV G+S  EPG+WLYN+LPIKGSKEE+D E VS +C
Sbjct: 361 AYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC 420

Query: 438 YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNI 497
           +D K+K FV YDN +S+ +K+ YV++  L GGF WE+CG+   +P+ SL+N+FT  +  I
Sbjct: 421 FDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTI 480

Query: 498 DK-QKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533
            K + S++   + L YYL K+G+  FLS +I+ ++++
Sbjct: 481 AKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISK 517

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  494 bits (1272), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 329/472 (69%), Gaps = 16/472 (3%)

Query: 75  NSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQID 134
           +S Y +GVYYSNWSPY+PRL  PHD+D SR++HVYY+F +VD   G + +SD WSDF++D
Sbjct: 61  DSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD 120

Query: 135 MYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSV 194
            YKPL + L ++  D    P    K  LPMGCIGE FYLR++++      S  FK+ MSV
Sbjct: 121 CYKPLAMKLKKLQLDHFFNPKF--KNGLPMGCIGELFYLRHSQL-FDSNNSRKFKLIMSV 177

Query: 195 GGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIK 254
           GGWSNREAFP+M+RD +K+D F+NSCI+ MF YGFDGI+LDWEFP+DD  EP MYL+++K
Sbjct: 178 GGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVK 237

Query: 255 RLKMKMLELEATIYKDAISHNTS-YPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMT 313
           +LK K  ELE  I+ ++ + N S  P F LSIAAPAF EKL IL +++MD +VD WNMMT
Sbjct: 238 KLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMT 297

Query: 314 YDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSN-----------ETLCGDNAVKYMK 362
           YDY GEWS+ TGYHSNL+SP +           + +             L GD A+ Y+ 
Sbjct: 298 YDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVI 357

Query: 363 DNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIK 422
               I+ +KI LGMAAYGRGF+ V+ S  + +   K + GV G+S  EPG+WLYN+LPIK
Sbjct: 358 KKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIK 417

Query: 423 GSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNP 482
            S EEFD + VSA+CYD KSK FV YDN  SM +K++YV+++NL GGF WE+CG+   NP
Sbjct: 418 NSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNP 477

Query: 483 KLSLINSFTFDMNNI-DKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533
           + SL+N+FT ++ ++ +K ++MF+N +VL+YYL   G  GFLS +I+ +L R
Sbjct: 478 EKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYR 529

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  493 bits (1268), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 257/558 (46%), Positives = 358/558 (64%), Gaps = 39/558 (6%)

Query: 1   MVNPNIYIFSSCIFIA--AVTFGFEMVLYN-IYKKYTDQLQRFDAKPGNISSELNQHDRE 57
           M N N   + + I +   A+T   EM  Y+ ++ K  +Q      +P      LN  D E
Sbjct: 1   MRNDNKAYWRATIILTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNE 60

Query: 58  YDPIMKPENSEQNNGTENSL-YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVD 116
                  +N   N    N   Y+ GVYYSNWSPYSPR  FPHDID SR+SHVYYSF LV+
Sbjct: 61  IK-----DNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVN 115

Query: 117 GDEGTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFD----SVPISMKKELLPMGCIGEFFY 172
           GD G ++  D WSD ++D+YKPL + LG++ N  D        S  K  LP GCIGEFFY
Sbjct: 116 GDNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFY 175

Query: 173 LRNTRI--PIHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFD 230
           LRN+++   I+   S +FK+ M++GGWSNR++FPKM + PQK+  F+ S I+ MF YGFD
Sbjct: 176 LRNSKLLPTINTENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFD 235

Query: 231 GIDLDWEFPEDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAF 290
           GIDLDWEFP+++  EP +YL I+++L+  M ELE  IYK++        HF+LS+A+PAF
Sbjct: 236 GIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAF 295

Query: 291 DEKLRILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNE 350
           +EKL +LP+++M+K +D WNMMTYDY+GEWS+ TGYHSNL+      GS +K  +    E
Sbjct: 296 EEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY-----DGSKVKHDE----E 346

Query: 351 TLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNG--------KLTGK---- 398
            L  D+A+KYM +   +   K++LG+A YGRG++ V+ +   G        +LTG     
Sbjct: 347 VLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFI 406

Query: 399 --KFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVI 456
             ++ GV G S  EPG+W+YN+LPIKGS E+FD + VSAYCYD K+   V YDN +SM +
Sbjct: 407 DLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNV 466

Query: 457 KSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNIDKQK-SMFSNRKVLEYYLM 515
           K +YV+D  L GGF+WE+CG+  +NPK SLI +FT ++  I KQ+ S+F + K  E+YL 
Sbjct: 467 KGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLE 526

Query: 516 KYGKQGFLSGYILSVLNR 533
           ++G +G+LS  I  +LN+
Sbjct: 527 EFGNEGYLSEAIAKLLNK 544

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 327/482 (67%), Gaps = 13/482 (2%)

Query: 63  KPENSE--QNNGT-ENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDE 119
           +P+ ++   N GT E   Y  G+YYSNWSPYSPR+ FPHDID SRVSH+YY+F LVDG  
Sbjct: 46  QPQQAQLVTNPGTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGAT 105

Query: 120 GTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIP 179
           G +K  D WSD  +D+YKP+ + L +++ +  +  +  ++ +LP GC+GE FY+RN  + 
Sbjct: 106 GALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKN-DLERQRRILPNGCLGELFYMRNANL- 163

Query: 180 IHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFP 239
                  DFKV M VGGWSNRE FPKMVR+P++VDKFI+SCI+TMF YGFDGIDLDWEFP
Sbjct: 164 FPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFP 223

Query: 240 EDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPV 299
           EDDGFEP MYL + KRLK +M ELE  I+   ++H    P F+LS+A PAF EKL ILP+
Sbjct: 224 EDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNH----PKFQLSMATPAFSEKLDILPI 279

Query: 300 QQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCG---DN 356
            +MDK++D WNMMTYDY GEWS+ TGYH NL++    S     +    S E++ G    +
Sbjct: 280 TEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHS 339

Query: 357 AVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLY 416
           A+++M +   ++S KI LGMAAYGRGF+ V    T+ +   K F+GV G+S  EPG+WLY
Sbjct: 340 AIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLY 399

Query: 417 NKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACG 476
           N+LPI+G+ E FD + VS +CY   SK FV YD+ +S+  K++YVR+ NL GGF WE+CG
Sbjct: 400 NQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCG 459

Query: 477 EKLNNPKLSLINSFTFDMNNIDK-QKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMN 535
           +   N   SL+N+FT ++  + K    M+    VL YY+ K+G   FLS +IL++L    
Sbjct: 460 DDHANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQG 519

Query: 536 ET 537
           E 
Sbjct: 520 EA 521

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  485 bits (1249), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 245/492 (49%), Positives = 341/492 (69%), Gaps = 17/492 (3%)

Query: 39  RFDAKPGNISSELNQHDREYDPIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPH 98
           R   K   I S++N +D   +  ++ E    +N +++  Y  GVYY+NWSPY+PR  FPH
Sbjct: 54  RATQKFKQIYSDMNSNDNNQN--LQEEVGPASNDSQS--YISGVYYTNWSPYAPRNHFPH 109

Query: 99  DIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLY--LSLGQVDNDFDSVPIS 156
           D++  R+++V+YSF +VD   GT+KSSD WSDFQ+D+YK  Y       + +   S   S
Sbjct: 110 DMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQS 169

Query: 157 MKKELLPMGCIGEFFYLRNTRI--PIHGPK-STDFKVFMSVGGWSNREAFPKMVRDPQKV 213
            KKE+LPMGCIGE FYL+ + I   +HG     +FKV MSVGGWSNR+AFP +VRD  K 
Sbjct: 170 HKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKF 229

Query: 214 DKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKMLELEATIYKDAIS 273
           D FI +C++TMF YGFDG+D+DWEFP++DG EP MYL +I+RL+  + +LE  I++D   
Sbjct: 230 DTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQD--E 287

Query: 274 HNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSP 333
           H++   HF L++A PAF EKL++LP++ MD +VD WN+M YDY GEWS++TGYHSNL+S 
Sbjct: 288 HHSE--HFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYS- 344

Query: 334 PDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNG 393
            + S  V +R   +    L  D+AVKY+  N  I+SRK++LGMAAYGRGF+ V  +  +G
Sbjct: 345 -EDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG 403

Query: 394 KLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQS 453
              GK +NGV G+S  EPG+WLYN+LP+ G+ E FD  SVSAY +DPKSK FV YDN  S
Sbjct: 404 SYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDS 463

Query: 454 MVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNIDKQK-SMFSNRKVLEY 512
           M  K++YV+++NL GGF WE+CG+   + + SL+N+FT D+ ++ KQ+ S++++  V+ Y
Sbjct: 464 MRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRY 523

Query: 513 YLMKYGKQGFLS 524
           YL  Y  QGFLS
Sbjct: 524 YLKNY-PQGFLS 534

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  476 bits (1225), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 237/488 (48%), Positives = 331/488 (67%), Gaps = 36/488 (7%)

Query: 72  GTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDF 131
           G  N+ +  GVYYS+WSPY PR  FPHDID ++++HVYYSF LV+G  G +  SD WSD 
Sbjct: 87  GKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDL 146

Query: 132 QIDMYKPLYLSLGQVDNDFDSV-----------PISMKKELLPMGCIGEFFYLRNTRIPI 180
           ++D+YKPL L L  +  + D V            I   K+ LP+GC+GE FYL+      
Sbjct: 147 KMDLYKPLSLKLNTLHQN-DKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK------ 199

Query: 181 HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE 240
              K  +FK+ MS+GGWSNRE FP MVRD  K+++FI S ++ MF YGFDGIDLDWEFPE
Sbjct: 200 ---KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPE 256

Query: 241 DDGFEPMMYLDIIKRLKMKMLELEATIY-KDAIS-----HNTSYPHFELSIAAPAFDEKL 294
           DDGFEP  YL+I++RL+ +M +LE  I+ K  IS     H+  +P FELS+A PAF EKL
Sbjct: 257 DDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKL 316

Query: 295 RILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSV---MKRSQSNSNET 351
            ILP+++M+K++D WNMMTYDY G+WS+ TGYH NL+   + +G++    K   ++SN+ 
Sbjct: 317 NILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGN-NGTINAQYKHEHTSSNKG 375

Query: 352 LCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEP 411
           L  ++A+ YM  N  +SSRK++LG+AAYGRGF+ V  +K +     KKF+GV G+S  EP
Sbjct: 376 LNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEP 435

Query: 412 GVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFL 471
           G+WLYN+LPIK SKE FD   VSA+CYDPK+K FV YDN  +M +K+KYV+D +L GGF 
Sbjct: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495

Query: 472 WEACGEKLNNPKLSLINSFT--FDMNNIDKQKS---MFSNRKVLEYYLMKYGKQGFLSGY 526
           WE+CG+   +P+ SL+N+FT   ++ ++ K +    ++     ++YYL  +G  GFLS +
Sbjct: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555

Query: 527 ILSVLNRM 534
            + +++ M
Sbjct: 556 FIQIMSAM 563

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  449 bits (1156), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 235/521 (45%), Positives = 328/521 (62%), Gaps = 25/521 (4%)

Query: 15  IAAVTFGFEMVLYNIY--KKYTDQLQRFDAKPGNISSELNQHDREYDPIMKPENSEQNNG 72
           +A V    +M L+ +Y  +K T  L +   + G I +      +E D +M   NS    G
Sbjct: 19  LAIVVLVLQMCLHKLYFKQKATQDLIQSHFRNGTIPNR-----QEIDYLMNQTNSNGEKG 73

Query: 73  TENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQ 132
                Y  G+YYS+WSPY PR  FPHDID +RVSH+YY+F LVD   G +  SD WSD Q
Sbjct: 74  -----YLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQ 128

Query: 133 IDMYKPLYLSLGQVDNDFDSVPISMK-KELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVF 191
           +D+YKPL + L  ++   +  P+ ++ K  LP+GCIGE FYL+++ I I G  ST  K+ 
Sbjct: 129 MDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGI-IPGGSST--KMI 185

Query: 192 MSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLD 251
           +S+GGWSNR+ FP +VRD +K + FI+S ++TMF YGFDGIDLDWEFP+DDG EP  YL+
Sbjct: 186 LSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLE 245

Query: 252 IIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNM 311
           +I +L+ KM +LE  I+ +   H    P F+LS+A PAF  KL ILP+ QMD++VD WNM
Sbjct: 246 MISKLRRKMDDLELEIFGETKDH----PKFQLSVATPAFIYKLSILPIIQMDQYVDYWNM 301

Query: 312 MTYDYSGEWSDVTGYHSNLFSPPDVS-GSVMKRSQSNSNETLCGDNAVKYMKDNLKISSR 370
           MTYDY G WS+ TGYH NLF+       +  K   +  N  L  + A+ +M  +  + S 
Sbjct: 302 MTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSS 361

Query: 371 KIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVS-GSSPDEPGVWLYNKLPIKGSKEEFD 429
           K++LGMAAYGR F  V   +    L  +KF GV  G   DEPG+WLYN+LP+KG+ E +D
Sbjct: 362 KVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYD 421

Query: 430 KESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINS 489
               +A+CYD KS+ F+ YDN  S+ +K++YV+   LGGGF WE+CG+   N + SL+ +
Sbjct: 422 PNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYN 481

Query: 490 FTFDMNNIDK---QKSMFSNRKVLEYYLMKYGKQGFLSGYI 527
           F+ ++  I K   Q  +F  ++ + YYL +YG  GFLSG +
Sbjct: 482 FSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  442 bits (1136), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 300/461 (65%), Gaps = 19/461 (4%)

Query: 75  NSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQID 134
           N+ Y  G+YYSNWSPY PRL FPHDID  +VSH+YY+FLL+D + G + SSD WSD Q++
Sbjct: 53  NTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLN 112

Query: 135 MYKPL--YLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFM 192
           + K    Y+      ++  +V         P GCIGE  YLR     I   K  + K+ M
Sbjct: 113 LAKQCREYMFKRFTGDELKAV----TNIRAPPGCIGELNYLRYIYSKI---KKRNVKLIM 165

Query: 193 SVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDI 252
           SVGGWSNRE+FP MVRD  K   FINSCI+TM  YGFDGIDLDWEFPEDD +EP  YL +
Sbjct: 166 SVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRM 225

Query: 253 IKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMM 312
            + LK+++ +LEA I  D      S   F+LS+A PAF +KL ILP+ ++DK++D WN+M
Sbjct: 226 ARELKLQLQKLEANILGDH-----SNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLM 280

Query: 313 TYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKI 372
           TYDY GEWS+ TG H+NL++     G ++   + + +  L GD A+ YM +  KI  RK+
Sbjct: 281 TYDYYGEWSERTGLHANLYNE---KGKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKV 337

Query: 373 ILGMAAYGRGFSGVSKSKTN-GKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKE 431
           ILGMAAYGRGF+ V    TN     G KF+GV G+S  EPG+WLYN+LPI GS E++D  
Sbjct: 338 ILGMAAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYR 397

Query: 432 SVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFT 491
            V AYCYD ++   V YDN  S++ K+ Y+  N+LGG F WE+CG+   NPK SL+N++ 
Sbjct: 398 HVGAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYI 457

Query: 492 FDMNNIDKQK-SMFSNRKVLEYYLMKYGKQGFLSGYILSVL 531
             + N+   K +++S  K+ +YYL  Y   GFL+G+I  ++
Sbjct: 458 RVIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDII 498

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  421 bits (1082), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 220/459 (47%), Positives = 299/459 (65%), Gaps = 46/459 (10%)

Query: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137
           +S+  YYSNWSPY+ R   P DI TS+++HVYY+F +VD   G +KSSD+WSDF+     
Sbjct: 66  FSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFE----- 120

Query: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197
            L LS+G                    GCI E   L+  ++        +FK  + +GGW
Sbjct: 121 -LPLSVGV------------------KGCIKE---LQKIKLE----SKHEFKTILCLGGW 154

Query: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257
           SNREA+ K+ +  +KV KFI + +D MF YGFDGIDLDWEFPE+D  EP++YL++++ ++
Sbjct: 155 SNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIR 214

Query: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317
             M +LE  I+  + +    +PHF+LS+A PAF EKL ILP+ +M K+VD WNMM YD+ 
Sbjct: 215 EGMDQLERQIF-GSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFH 273

Query: 318 GEWSDVTGYHSNLFSPPDVSGSVMKRSQSN--SNETLCGDNAVKYMKDNLKISSRKIILG 375
           GEWSDVTGYHSNL+    + G   +RS SN  SN +L  D AVK M D   ISSR+I LG
Sbjct: 274 GEWSDVTGYHSNLY----LQGHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALG 329

Query: 376 MAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSA 435
           MAAYGRGF+ V  +  N    GKK++GV G S  EPG+WLYN+LPI GSKE+FD  +VSA
Sbjct: 330 MAAYGRGFTNVETNDDN--YLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSA 387

Query: 436 YCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMN 495
           YC+DPKS+ FV YDN QSM IK KY++  NL GGF WE+CG+   +P+ SL+N+F+ ++ 
Sbjct: 388 YCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIG 446

Query: 496 NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRM 534
             +   S+F + KV +++L KY K      YI S+  ++
Sbjct: 447 LSEGFVSLFKSDKVKQFHLQKYPKD-----YISSLFQKL 480

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/470 (44%), Positives = 291/470 (61%), Gaps = 58/470 (12%)

Query: 60  PIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDE 119
           P   P+N  Q        Y  GVYYS+WSPY PR+ FP +IDTS+++H+YYSF LVD D 
Sbjct: 40  PAQCPQNVNQK-------YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADS 92

Query: 120 GTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIP 179
             +K  D+WSD ++ M K   L                       GCIG    LR+ +  
Sbjct: 93  SALKLGDSWSDIEMPMGKNTVLK----------------------GCIGALNSLRDEK-- 128

Query: 180 IHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFP 239
                   FK  M+VGGWSN++AFP  +R    V+K   SC++TMF YGFDGIDLDWE+P
Sbjct: 129 ------PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYP 182

Query: 240 EDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPV 299
           +DDG EP +YL+++++++  M ELE  I+ D          F LS+A PAF +KL   P+
Sbjct: 183 KDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR------FHLSVATPAFYDKLETFPI 236

Query: 300 QQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVK 359
           ++MD+++D WNMMTYDY GEWS  TG+HSNL+            +   S  +LC D A++
Sbjct: 237 KEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDG----------TNKFSEHSLCADGAIR 286

Query: 360 YMKDNLKISSRKIILGMAAYGRGFSGVSKS---KTNGKLTGKKFNGVSGSSPDEPGVWLY 416
           YM + + I+SRK++LGMA YGRGF+ V +    KT+G L  +KF GV G S  EPG+WLY
Sbjct: 287 YMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSG-LINRKFKGVGGESEGEPGMWLY 345

Query: 417 NKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACG 476
           N+LPI+G++E FD++  SAYC+DPK+K  V YDN  S   K++YVR +NL GGF WE+CG
Sbjct: 346 NQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCG 405

Query: 477 EKLNNPKLSLINSFTFDMNNIDKQKS-MFSNRKVLEYYLMKYGKQGFLSG 525
            K +N + SL++ F  D+  +D+ ++ ++ + K+ E+YL  + K GFL+ 
Sbjct: 406 NKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAA 455

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 219/481 (45%), Positives = 313/481 (65%), Gaps = 40/481 (8%)

Query: 61  IMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEG 120
           I +P +    +G     Y++GVYY++WSPY PRL FPHDID  RV++V Y+F +VD   G
Sbjct: 50  ITRPVDRNLQHGK----YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTG 105

Query: 121 TIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPI 180
            ++ +D+WSD ++  + P              +P  +       G IGE  YL+  R   
Sbjct: 106 KVQPTDSWSDLEMPSHAP-------------GIPQGV------TGMIGELNYLKLQR--- 143

Query: 181 HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE 240
               +T+F++FM+VGGWSNREAFPK+VR  +K+  F+NS ID MF YGFDGIDLDWEFP+
Sbjct: 144 ----NTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPK 199

Query: 241 DDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQ 300
           DDG+EP MYL++  RL+ KM +LE  I+    ++NT YP FELS+A PAF + L+ILP+ 
Sbjct: 200 DDGYEPGMYLEMCSRLRSKMDKLEDEIWG---ANNTDYPKFELSVATPAFSQTLKILPII 256

Query: 301 QMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQS----NSNETLCGDN 356
           +M+KFV  WNMMTYD+ G WS  TGYHSNL+     +  + KR       + NE L  D+
Sbjct: 257 EMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADD 316

Query: 357 AVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLY 416
           A+K M +N K+ ++K+ LGM AYGRGF+ V ++K +  L  KK++GV G S  EPG+WLY
Sbjct: 317 AIKIMVENFKVHAKKVRLGMPAYGRGFTNV-QTKDDDDLLNKKYSGVGGGSEGEPGIWLY 375

Query: 417 NKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACG 476
           N+LP+  + E+FD   VSAYC+D   K FV YDN QSM +KS YV+  +L GGF WE+CG
Sbjct: 376 NQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCG 435

Query: 477 EKLNNPKLSLINSFTFDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNE 536
           +  N+PK +L+ +F+ +++ + +  ++F + + + YYL K+ ++GFL       L ++NE
Sbjct: 436 DTHNDPKRNLVRAFSQELSEM-RIPTIFKDPRAIAYYL-KHRQKGFLYSLFSQHLQKINE 493

Query: 537 T 537
           T
Sbjct: 494 T 494

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  407 bits (1045), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 210/463 (45%), Positives = 295/463 (63%), Gaps = 45/463 (9%)

Query: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137
           Y  GVYYSNWSPY+PR  FPHDI+  +VSHVYY+F  ++   G I+S+D+WSD ++++YK
Sbjct: 73  YVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYK 132

Query: 138 PLYLSLGQ-VDNDF-DSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVG 195
           PL +   Q V+N+  DSV     + +LP+GC+GE FYL+N            FKV MS+G
Sbjct: 133 PLAIKSSQLVENNLNDSV-----QNILPLGCVGELFYLKN------ACSEKKFKVIMSIG 181

Query: 196 GWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKR 255
           GWS+ E F  +V D + +  F++S ++TMF  GFDGID+DWEFPE++  EP  YL ++K 
Sbjct: 182 GWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKM 241

Query: 256 LKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYD 315
           L++K+  LE+ I+ ++I       HF++SIAAPAF +KL  LP+ ++D+++D WNMMTYD
Sbjct: 242 LRLKLNNLESQIFGESIE-----DHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYD 296

Query: 316 YSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILG 375
           Y G WS+ TGYHSNLFS  ++SG+                 A+ YM D   + S K++LG
Sbjct: 297 YYGSWSETTGYHSNLFSETELSGNF----------------AMHYMIDEFSVDSSKLVLG 340

Query: 376 MAAYGRGF----SGVSKSKTNGKLTGKKFNGVS--GSSPDEP----GVWLYNKLPIKGSK 425
           MAAYGR F    S       N  L  + F GV   G   D+     G+W Y  LP KG+ 
Sbjct: 341 MAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTI 400

Query: 426 EEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLS 485
           E++D + VSAYC+D K+ IF++YDN++S   K++YV  N LGGGF WE+CGE   N   S
Sbjct: 401 EQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRS 460

Query: 486 LINSFTFDMN-NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527
           LIN+F   +  N+  + SMF + +V+++YL KYG  GFLS Y+
Sbjct: 461 LINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYL 503

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  406 bits (1044), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/458 (44%), Positives = 292/458 (63%), Gaps = 41/458 (8%)

Query: 81  GVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLY 140
           GVYYSNWSPY PR  FPHDI+ ++VSHVYY+F  ++   G I+S+D WSD ++++YKPL 
Sbjct: 76  GVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLA 135

Query: 141 LSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGWSNR 200
           +   ++ +   S  I   +++LP+GCIGE FYL+      H      FKV MS+GGWS+ 
Sbjct: 136 IKSSELIDGNSSNDI---QKILPLGCIGELFYLK------HSCSGKKFKVIMSIGGWSDS 186

Query: 201 EAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKM 260
           E F  ++++   +  F++S ++TMF  GFDGIDLDWEFPE++  EP  YL +++ L+ K+
Sbjct: 187 ENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKL 246

Query: 261 LELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEW 320
             LE+ I+ + +       HF+LSIAAPAF +KL  LP+ ++D+++D WNMMTYDY G W
Sbjct: 247 NSLESQIFGEGVE-----DHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSW 301

Query: 321 SDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYG 380
           S+ TGYHSNLFS  ++SG+                 A+ YM D   I+SRK++LGMAAYG
Sbjct: 302 SETTGYHSNLFSETELSGNF----------------AIHYMIDKFGINSRKLVLGMAAYG 345

Query: 381 RGF----SGVSKSKTNGKLTGKKFNGVSGSSPD------EPGVWLYNKLPIKGSKEEFDK 430
           R F    SG      N  L  + F GV   + +      + G+W Y  LP KG+ E +D 
Sbjct: 346 RSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDP 405

Query: 431 ESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSF 490
           + VSAYC+D K+ IF++YDN++S+  K++YV  N LGGGF WE+CGE   N   SLI++F
Sbjct: 406 KYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAF 465

Query: 491 TFDM-NNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527
              + +N+  + SMF N +V+ +YL KYG  GFL+ Y+
Sbjct: 466 NEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYL 503

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  404 bits (1038), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/463 (44%), Positives = 295/463 (63%), Gaps = 44/463 (9%)

Query: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137
           Y  GVYYSNWSPY PR  FPHDI+  +VSHVYY+F  +D   G I S+D+WSD ++D+YK
Sbjct: 73  YVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYK 132

Query: 138 PLYLSLGQ-VDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGG 196
           PL +   Q VD++ D   +   + +LP+GCIGE FYL+N      G K   FK  MS+GG
Sbjct: 133 PLAIKASQLVDDNLDDNNM---QSILPLGCIGELFYLKNA---CSGRK---FKSIMSIGG 183

Query: 197 WSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRL 256
           WS+ E F  +V++ + +  F++S ++TMF  GFDGID+DWEFPE++  EP  YL +++ L
Sbjct: 184 WSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRML 243

Query: 257 KMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDY 316
           ++K+  LE+ I+       ++  HFELSIAAPAF +KL  LP+ ++D+++D WNMMTYDY
Sbjct: 244 RLKLNSLESQIFG-----GSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDY 298

Query: 317 SGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGM 376
            G WS+ TGYHSNLFS  ++SG+                 A+ YM     ++ RK++LGM
Sbjct: 299 YGSWSETTGYHSNLFSETELSGNF----------------AIHYMIGEFGVNPRKLVLGM 342

Query: 377 AAYGRGFSGVSKSK-----TNGKLTGKKFNGVS--GSSPDEP----GVWLYNKLPIKGSK 425
           AAYGR F  +   K      N  L  ++F GV   G   D+     G+W Y  LP KG+ 
Sbjct: 343 AAYGRSFH-IKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTT 401

Query: 426 EEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLS 485
           E++D + VSAYC+D K+ IF+ YDN++S+  K+ YV    LGGGF WE+CGE   +   S
Sbjct: 402 EQYDPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRS 461

Query: 486 LINSFTFDMN-NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527
           LIN+F   ++ N+  + SMF +++V++YYL KYG  GFL+ Y+
Sbjct: 462 LINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYL 504

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  398 bits (1022), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 292/471 (61%), Gaps = 44/471 (9%)

Query: 66  NSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSS 125
           + E+ + + N  +S G+YYSNWS Y PRL FPH+I+   +SHVYY+F LVDG  G + S 
Sbjct: 46  DDERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSG 105

Query: 126 DTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLR-NTRIPIHGPK 184
           D W+DFQ    +P+                 +K   L  G +GE F L+   R+      
Sbjct: 106 DKWADFQ----RPI-----------------LKNNKLVKGNVGELFDLKMKNRV------ 138

Query: 185 STDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGF 244
               K  M +GGWSNREA+     DP K++ F    +  MF YGFDGIDLDWE+PEDDG 
Sbjct: 139 ----KCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGI 194

Query: 245 EPMMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDK 304
           EP +YL+I++R+K  M +LE+ I+KD  S  TSY  FELS+A PAF +KL I P+++MD 
Sbjct: 195 EPQLYLEIMRRIKHHMNKLESEIFKDT-SATTSY--FELSVATPAFKDKLEIFPLKEMDT 251

Query: 305 FVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSV--MKRSQSNSNETLCGDNAVKYMK 362
            +D WNMMTYDY GEWS+ TGYHSNL+     S ++  + R   +  E L GD AVKYM 
Sbjct: 252 VIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI 311

Query: 363 DNLKISSRKIILGMAAYGRGFSGVS----KSKTNGKLTGKKFNGVSGSSPDEPGVWLYNK 418
            N  I   KIILGMAAYGRGF+ V     +   + +  G+ F+GV G+S  EPG+W Y++
Sbjct: 312 -NQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQ 370

Query: 419 LPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEK 478
           LPI G+ E+FD   VS YC++P +  FV YD   S+ +K++Y++  ++GGGF WE+CG+ 
Sbjct: 371 LPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDT 430

Query: 479 LNNPKLSLINSFTFDM--NNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527
             NP+ SL+N++  ++  +NI K +S++ N   + +Y   +  +GFLS Y+
Sbjct: 431 HKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  397 bits (1019), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 205/479 (42%), Positives = 302/479 (63%), Gaps = 45/479 (9%)

Query: 69  QNNGTE--NSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSD 126
           QN+GT   +  +  GVYYSNWSPY PR  FPHDI+  +VSH+YY+F  ++   G I+++D
Sbjct: 62  QNHGTHIRDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTD 121

Query: 127 TWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKST 186
           +WSD ++++YK L +   ++  +  +  +   + +LP+GCIGE FYL+NT          
Sbjct: 122 SWSDLEMNLYKSLAIKNSELIKESSNNSV---QNILPLGCIGELFYLKNT------CSDK 172

Query: 187 DFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEP 246
            FKV MS+GGWS+ E F  +++D + +  F++S ++TMF  GFDGIDLDWEFP ++  EP
Sbjct: 173 KFKVIMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEP 232

Query: 247 MMYLDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFV 306
             YL +++ L++K+  LE+ I+           HF+LSIAAPAF +KL  LP+ ++D++V
Sbjct: 233 RGYLKLVRMLRLKLNSLESQIFGKRTE-----DHFQLSIAAPAFKDKLFYLPITEIDQYV 287

Query: 307 DKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLK 366
           D WNMMTYDY G WS+ TGYHSNLFS  +++G+                 A+ YM D   
Sbjct: 288 DYWNMMTYDYYGSWSETTGYHSNLFSETELNGNF----------------AMHYMIDRFG 331

Query: 367 ISSRKIILGMAAYGRGFSGVSKSK-----TNGKLTGKKFNGVSGSSPD------EPGVWL 415
           ++SRK++LGMAAYGR F  +  +K      N  L  K F GV   + +      + G+W 
Sbjct: 332 VNSRKLVLGMAAYGRSFH-IKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWP 390

Query: 416 YNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEAC 475
           Y  LP  G+ E++D + VSAYC+D K+ IF++YDN++S+  K++YV  NNLGGGF WE+C
Sbjct: 391 YKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESC 450

Query: 476 GEKLNNPKLSLINSFTFDMN-NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533
           GE   N   SLIN+F   ++ N+  + S+F + +V +YYL KYG  GFLS Y+  + +R
Sbjct: 451 GEAYANESRSLINAFNEGLHFNVSSKPSIFQDVRVKKYYLNKYGDGGFLSPYLKHLDSR 509

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 212/464 (45%), Positives = 295/464 (63%), Gaps = 23/464 (4%)

Query: 73  TENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQ 132
           +E  L S G+YYSNWSPY  R  FPHDID  R++ V+YSFL+V+G+ G  + SD WSD Q
Sbjct: 67  SERGLTS-GIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQ 125

Query: 133 IDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRI--PIHGPKST-DFK 189
           +D+YK ++ +  +VD      P S + +L P+GCIGE FYL+ T     + GP+   +FK
Sbjct: 126 MDLYKQMFSAFEKVDLK-RQFPQSSRNDL-PLGCIGELFYLKYTDFLSKMGGPEDVKNFK 183

Query: 190 VFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMY 249
             MSVGGWSNREAF  +V+ P K+  FINSC+D MF YGFDGID+DWEFP++D  EP  Y
Sbjct: 184 TIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAY 243

Query: 250 LDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKW 309
           LD+++ L+ K+ +LE+ I+           HF L+ A  A    L  LP+ ++D++VD+W
Sbjct: 244 LDMMRSLRKKLDDLESDIF----GTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQW 299

Query: 310 NMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISS 369
           N+M YD+SG WS  T Y SNL+S      S+ KRS+  ++E    D AV+ + +  K+ +
Sbjct: 300 NLMAYDFSGAWSRHTAYQSNLYS----RSSLGKRSE--NSEGGSADTAVRLLLNKHKLPA 353

Query: 370 RKIILGMAAYGRGFSGVS-KSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEF 428
           +KI+LGM AYGRGF GVS    +   + G+ F  VSG S  E G+ LYN+LP+KG +E F
Sbjct: 354 KKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWF 413

Query: 429 DKESVSAYCYDPKSKI----FVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKL 484
           D+++VSAY     S       V YDN QSM IK++YV  NNLGGGF WE+CGE   +   
Sbjct: 414 DQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSR 473

Query: 485 SLINSFTFDMNNIDKQ-KSMFSNRKVLEYYLMKYGKQGFLSGYI 527
           SL  +FT ++  ++K   ++++  +V EYY  KY   GFL+  I
Sbjct: 474 SLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/458 (43%), Positives = 291/458 (63%), Gaps = 25/458 (5%)

Query: 76  SLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDM 135
           S +  G+YYSNWSPY+ R  FPHDID  +++HVYY+FL+V+ + G  + SD WSD Q+D+
Sbjct: 69  SGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDL 128

Query: 136 YKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKST---DFKVFM 192
           YK +  S  ++D    +   +  K+ LP+GCIGE F+L+ +        S    +FK  M
Sbjct: 129 YKQMISSFKKLD--LRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIM 186

Query: 193 SVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDI 252
           SVGGWSNREAF  +V  P K++ F++SC+  MF YGFDGID+DWEFP++D  EP +YL +
Sbjct: 187 SVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQM 246

Query: 253 IKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMM 312
           +K L+ ++  LE+ I+      +    HF L+ A  A +E L+ LP+Q+ D++VD WN+M
Sbjct: 247 LKALRERLDTLESQIFGSKDHKH----HFALTSAISADEECLKYLPLQEADRYVDYWNLM 302

Query: 313 TYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKI 372
            YD+SG WS  T Y SNL++P        K ++ ++N     D AV+++ D  K++S+KI
Sbjct: 303 AYDFSGAWSAQTAYQSNLYTPA-------KTNKRSTNGRGSADKAVRFLTDKSKLASKKI 355

Query: 373 ILGMAAYGRGFSGVSKS-KTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKE 431
           +LGM AYGRGF GV  S K+   + GK F  VSGSS  E G+ LY +LP+KG  E FD  
Sbjct: 356 VLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHN 415

Query: 432 SVSAYC----YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLI 487
           +VSAYC    ++ K    + YDN  SM+ K+ YV  N+LGGGF WE+CGE       SL+
Sbjct: 416 AVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGK--SLV 473

Query: 488 NSFTFDMNNIDK-QKSMFSNRKVLEYYLMKYGKQGFLS 524
            +FT ++  ++K + +++S  +V+++YL K    GFL+
Sbjct: 474 GAFTKEIKCLNKTEPTIYSLPEVVQHYL-KLHPGGFLA 510

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  376 bits (965), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 285/452 (63%), Gaps = 39/452 (8%)

Query: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137
           Y++GVYYS+WSPY PRL +P +ID  RV+HVYY+F +VD   G I S D WSD ++ M  
Sbjct: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM-- 120

Query: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197
                      +   +P  +       G IGE  YL+ TR        TDFK+ M+VGGW
Sbjct: 121 -----------NLTGMPRGLN------GAIGELNYLK-TR------PGTDFKLMMAVGGW 156

Query: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257
           SNRE F K+VRD +K + FI+S ID MF YGFDGIDLDWEFP+DDG+EP MYL++  RL+
Sbjct: 157 SNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLR 216

Query: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317
            KM ELE  I+       T+ P F LS+AAPAF + L I PV++M+K++  WNMMTYDY 
Sbjct: 217 HKMDELEDNIWGPG---GTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYH 273

Query: 318 GEWSDVTGYHSNLFSP---PDVSGSVMKRSQS---NSNETLCGDNAVKYMKDNLKISSRK 371
           G WS+ TGYHSNL++    P  S    +R +    ++ + L   +A+  M +  K+S RK
Sbjct: 274 GAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRK 333

Query: 372 IILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKE 431
           I LGMAAYGRGF+ V       +L G+K++GV G S  EPG+WLYN+LP+    E+FD  
Sbjct: 334 IALGMAAYGRGFTNVRGD--GEQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNV 391

Query: 432 SVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFT 491
            VSAY YDP +K  V YDN  SM IK +YV+D  L G FLWE+CG+   +   +L+ +FT
Sbjct: 392 WVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFT 451

Query: 492 FDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFL 523
            +M    ++ + + + K+++YYL +   +GFL
Sbjct: 452 ENMKGA-RKATAYKDSKLIQYYL-RTRPEGFL 481

>SAKL0B04158g Chr2 (370872..376583) [5712 bp, 1903 aa] {ON} highly
           similar to uniprot|P38631 Saccharomyces cerevisiae
           YLR342W FKS1 Catalytic subunit of 1 3-beta-D- glucan
           synthase functionally redundant with alternate catalytic
           subunit Gsc2p binds to regulatory subunit Rho1p involved
           in cell wall synthesis and maintenance localizes to
           sites of cell wall remodeling
          Length = 1903

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 10/97 (10%)

Query: 35  DQLQRFDAKPGNISSELNQHDREYDPIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRL 94
           DQ Q +  +P     +  Q+D+   P+  PE      G      + G YY+   PY P  
Sbjct: 21  DQQQEYAGEPHQGYDQQPQYDQYGQPVYPPEAYAAQEGDAYYDPNAGDYYAQQQPYDPE- 79

Query: 95  FFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDF 131
              H +D    +  Y      D   GT + ++ +SDF
Sbjct: 80  ---HGVDYPNGAAYY------DQPRGTNQDTENFSDF 107

>TPHA0B02960 Chr2 complement(673638..677066) [3429 bp, 1142 aa] {ON}
           Anc_2.171 YNL106C
          Length = 1142

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 211 QKVDKFINSCIDTMFM--YGFDGI----DL-DWEFPEDDGFEPMMYLDIIKRLKMKMLEL 263
           +K D F +     +F+  Y  +GI    DL  W FP  D F+P    DI+     +++E+
Sbjct: 560 KKKDNFTSYSSADIFIGTYNVNGISRPTDLSQWLFPIGDKFKP----DIVILGMQEVIEM 615

Query: 264 EATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFV 306
            A    +A S   S+    +S     FDEK  +L VQQM   +
Sbjct: 616 SAGSILNADSTKGSFWESMVSQCLNQFDEKYLLLRVQQMTSLL 658

>Ecym_5576 Chr5 complement(1184265..1185767) [1503 bp, 500 aa] {ON}
           similar to Ashbya gossypii AEL219W
          Length = 500

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 5   NIYIFSSCIF--IAAVTFGFEMVLYNIYK--KYTDQLQRFDAKPGNISSELNQHDREY-D 59
           N  +F S ++     VTF   M+  N++      ++ +R  +K   +  ++  HDR + D
Sbjct: 339 NSIVFHSALYWLFTVVTFLRVMITVNVWGLIGILEKRERVVSKMTVLGRKITNHDRFFVD 398

Query: 60  PIMKPENSEQNNGTENSLYSMG 81
           P +K E++++N+GTE    + G
Sbjct: 399 PHVKIEDNKRNSGTEEQQRNFG 420

>Skud_4.417 Chr4 (741302..745219) [3918 bp, 1305 aa] {ON} YDR159W
            (REAL)
          Length = 1305

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 251  DIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPV 299
            DI +R+K KMLE E   Y+  +    +Y H E  IAA    +K R LP+
Sbjct: 1114 DIDQRMK-KMLEKEKNKYQQQMGERNTYAHLESHIAASPRAKK-RKLPI 1160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,567,688
Number of extensions: 3116913
Number of successful extensions: 8939
Number of sequences better than 10.0: 29
Number of HSP's gapped: 9091
Number of HSP's successfully gapped: 29
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)