Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E017105.443ON1283128365200.0
Kpol_1062.235.443ON1266123035250.0
ZYRO0G01606g5.443ON1305127832500.0
TDEL0D025805.443ON1272122931940.0
Suva_8.1765.443ON1270122831910.0
NCAS0H021005.443ON1269124131680.0
TBLA0A064705.443ON1320132631520.0
YOR124C (UBP2)5.443ON1272123331480.0
Smik_15.3015.443ON1272123731470.0
SAKL0G02728g5.443ON1237123131460.0
Skud_15.2865.443ON1278123531220.0
NDAI0C015505.443ON1295124230980.0
KLTH0F15862g5.443ON1241124830490.0
Kwal_55.213935.443ON1233125330410.0
KNAG0B041905.443ON1262126629810.0
KAFR0D050705.443ON1227124129380.0
Ecym_45145.443ON1246126328400.0
KLLA0E02377g5.443ON1220122527270.0
CAGL0K10252g5.443ON1267125127240.0
ACL164C5.443ON138979417320.0
Kpol_1016.15.443ON1251119716620.0
TPHA0J026205.443ON1225123515450.0
Kwal_34.162681.369ON449331344e-07
KLTH0H13354g1.369ON4951131282e-06
TBLA0C012001.369ON503361255e-06
TDEL0D024001.369ON494521229e-06
SAKL0D10120g1.369ON492561221e-05
KLLA0A10791g1.369ON484661202e-05
TPHA0P006807.390ON727901166e-05
TPHA0A025101.369ON505521157e-05
NCAS0D006001.369ON493551141e-04
Suva_5.2177.390ON754901141e-04
ZYRO0G01188g1.369ON500331131e-04
Ecym_27171.369ON483331112e-04
KAFR0A075802.69ON802731112e-04
YFR010W (UBP6)1.369ON499511103e-04
Skud_6.941.369ON499631103e-04
KNAG0C019401.369ON499551093e-04
KAFR0C045201.369ON499431093e-04
AEL029W1.369ON446331084e-04
Smik_7.3141.369ON499631076e-04
KLLA0A00396g5.712ON10122081086e-04
Suva_6.831.369ON500511067e-04
Smik_13.5215.18ON1231951079e-04
YMR304W (UBP15)5.18ON1230951070.001
KAFR0L017307.390ON701881050.001
Skud_13.4785.18ON1231951050.001
Skud_5.2237.390ON748901040.002
Smik_5.2447.390ON749901030.002
ZYRO0C17908g1.137ON1204891040.002
CAGL0M13783g5.18ON1196581040.002
Kpol_534.231.369ON496331030.002
NCAS0A143707.390ON729901030.002
CAGL0K10494g1.369ON495331020.002
Ecym_56715.18ON11761011030.003
KNAG0F012202.69ON784681020.003
ABL145W2.69ON749681020.003
Suva_13.4955.18ON1230951010.004
NCAS0D023905.18ON12111011010.004
Kpol_2001.541.137ON1223791010.005
YER098W (UBP9)7.390ON7541061000.005
NDAI0A016707.390ON846901000.005
TDEL0B020805.712ON1025311000.005
NCAS0E026107.390ON71782990.006
NCAS0G036802.307ON48250980.006
Suva_14.1562.69ON78868990.006
TPHA0D046605.712ON104530990.007
TPHA0A025401.137ON128647990.008
TBLA0E017605.712ON121248980.008
TBLA0B097602.69ON89868980.010
Smik_2.497.390ON74531970.010
CAGL0J11352g2.69ON77173970.011
Smik_14.1442.69ON76368970.011
Kwal_55.196455.712ON97027970.011
KLTH0F03674g1.137ON119880970.012
AGL357W5.18ON116649970.014
YJL197W (UBP12)1.137ON125481960.014
Ecym_46857.390ON77864960.015
NDAI0F002005.712ON110531960.016
NCAS0G001705.712ON103027960.016
Skud_14.1482.69ON77668950.018
Kpol_1018.937.390ON75590950.018
Kwal_33.144302.69ON51168940.020
NDAI0E041807.390ON82797950.020
TBLA0C070205.18ON124749950.021
NCAS0G018002.69ON87568950.021
Suva_6.2761.137ON125681950.022
TPHA0L022905.18ON119396950.023
Kpol_1045.417.390ON71236940.023
NDAI0I025305.18ON119748940.025
KAFR0I026005.18ON121399940.025
TPHA0E008707.390ON71531940.026
Skud_10.221.137ON125579940.027
SAKL0E13002g2.69ON73968940.029
KLTH0B07150g2.69ON75668930.029
SAKL0H00418g5.18ON1190112940.030
ZYRO0B16544g5.712ON1044203930.033
CAGL0I05522g7.390ON72492930.034
TBLA0D010708.742ON48343920.034
KLTH0E00814g5.712ON97427930.036
KLTH0B09944g5.18ON1189109930.038
CAGL0H06721g5.712ON1081209930.040
SAKL0E15136g5.712ON1037205920.041
YNL186W (UBP10)2.69ON79268920.044
KNAG0L022005.712ON116131920.044
TDEL0C056401.137ON117849920.047
NDAI0H035501.369ON50251910.047
Smik_10.371.137ON124754920.051
AGR370W7.390ON740100910.053
Smik_9.135.712ON106044910.053
Kpol_1044.242.69ON72468910.058
AFR627C1.137ON128748910.060
YBL067C (UBP13)7.390ON74733910.060
KAFR0D021605.712ON84627910.063
KNAG0A054502.307ON76469900.066
Kpol_513.255.18ON119049910.068
NDAI0G007802.307ON48663900.072
KNAG0B023707.390ON75398900.072
YIL156W (UBP7)5.712ON107131890.100
NDAI0C059508.202ON108073890.10
ZYRO0D07062g5.18ON119396890.10
Suva_2.507.390ON75065880.11
KNAG0C021801.137ON123152890.12
NCAS0I031401.137ON1201107890.12
Skud_11.3385.712ON71227880.13
KNAG0E012905.18ON119649880.14
Suva_9.305.712ON106231880.14
Suva_13.4078.742ON47170870.15
KNAG0C035807.390ON77692870.15
CAGL0G02563gsingletonON63126870.15
KLLA0F18700g3.270ON77065870.15
KLLA0E20351g7.390ON69731870.15
KAFR0C004103.270ON76927870.16
Kpol_1003.532.307ON78851870.16
Skud_9.125.712ON106431870.17
Ecym_40095.712ON151727870.17
NDAI0B034302.307ON85651870.20
SAKL0D03322g3.270ON76562860.20
SAKL0E07106g2.307ON79151860.20
Kwal_26.95985.18ON119190870.20
Klac_YGOB_Anc_5.18b5.18ON116658860.22
TBLA0E025703.270ON78582860.22
KAFR0F015601.137ON117126860.23
KAFR0K018107.390ON71485860.23
CAGL0H10582g2.307ON79051850.26
Ecym_81401.137ON126492860.27
NDAI0B004801.137ON125381860.27
Kwal_27.114442.307ON75751850.28
Kwal_33.136281.137ON116048850.30
Smik_13.4318.742ON47150840.31
KAFR0H001505.712ON65630850.32
KLTH0G10934g2.307ON75851840.33
TPHA0C027708.188ON97068840.35
SAKL0C04246g1.137ON1297164840.36
TDEL0G023702.307ON747157840.38
TBLA0B060802.307ON82465840.39
KLLA0C06974g8.742ON44666830.39
Skud_2.387.390ON74831840.42
CAGL0G05247g8.188ON94766840.45
CAGL0L01639g1.137ON114726830.48
Suva_4.1252.307ON79350830.48
TDEL0C015707.390ON765100830.49
Smik_4.1152.307ON79050830.51
NCAS0B061302.307ON77051830.51
Skud_4.1332.307ON78750830.51
YDL122W (UBP1)2.307ON80950830.52
AGR389C2.307ON77551820.58
KNAG0D019308.188ON98696820.61
AFR296C5.712ON116927820.72
Smik_5.3188.202ON90968810.80
CAGL0M11198g8.742ON46150810.81
KAFR0A069102.307ON67848810.84
Kwal_56.230843.270ON76259810.91
CAGL0A04477g7.390ON77031810.97
Ecym_55448.202ON83465801.0
YER151C (UBP3)8.202ON91268801.1
NCAS0I016203.270ON795190801.1
NDAI0A077003.323ON100196801.1
TBLA0D006207.390ON117131801.2
TDEL0G004105.18ON118694801.3
Kwal_27.108427.390ON71131801.3
TPHA0M010903.270ON78052801.3
ZYRO0A05962g8.742ON46569791.3
NDAI0A027907.160ON123073791.4
YDR069C (DOA4)8.188ON926101791.5
Skud_2.1773.270ON78224791.6
Suva_11.3355.712ON72427791.6
ZYRO0B11044g8.202ON82681791.6
ZYRO0A02420g2.307ON74551791.7
Kpol_1032.288.188ON88268781.8
Smik_11.3625.712ON72127781.9
SAKL0F12430g7.390ON75431782.0
YKR098C (UBP11)5.712ON71727782.0
KLTH0C06732g7.390ON71451782.1
TBLA0J006001.137ON146265782.1
TPHA0G008502.307ON78251772.3
KLLA0C03476g1.137ON125257782.3
KNAG0J008003.270ON76526772.4
TDEL0B036708.742ON463130772.4
Skud_5.2898.202ON91067772.5
NCAS0A038408.202ON91767772.5
Ecym_62488.742ON46664763.0
KLTH0E04224g8.765ON130893763.2
CAGL0I06765g8.188ON88732763.4
Smik_2.1893.270ON78223763.6
ZYRO0B03300g7.390ON81331763.7
KAFR0A042108.742ON44051754.1
CAGL0I06600g8.202ON81676754.4
Suva_4.2953.270ON78225754.4
Skud_13.3928.742ON47350754.4
YMR223W (UBP8)8.742ON47150744.7
TPHA0G005608.742ON46365744.8
NDAI0A036808.188ON111632755.2
ZYRO0F01276g3.270ON77626745.3
SAKL0H04994g8.742ON45454736.8
CAGL0H05335g8.540ON48354729.5
Kwal_14.19578.202ON444787210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01710
         (1283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  2516   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1362   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1256   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1234   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1233   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1224   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1218   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1217   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1216   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1216   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1207   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1197   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1179   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1176   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1152   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1136   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1098   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1055   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1053   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   671   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   644   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   599   0.0  
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    56   4e-07
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    54   2e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    53   5e-06
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    52   9e-06
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    52   1e-05
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    51   2e-05
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    49   6e-05
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    49   7e-05
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    49   1e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    49   1e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   1e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    47   2e-04
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    47   2e-04
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    47   3e-04
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    47   3e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    47   3e-04
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    47   3e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    46   4e-04
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    46   6e-04
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    46   6e-04
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    45   7e-04
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    46   9e-04
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    46   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.001
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    45   0.001
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    45   0.002
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.002
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    45   0.002
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    45   0.002
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    44   0.002
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    44   0.002
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    44   0.002
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    44   0.003
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    44   0.003
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    44   0.003
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    44   0.004
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    44   0.004
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    44   0.005
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    43   0.005
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    43   0.005
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    43   0.005
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    43   0.006
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    42   0.006
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    43   0.006
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    43   0.007
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    43   0.008
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    42   0.008
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    42   0.010
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    42   0.010
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    42   0.011
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    42   0.011
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    42   0.011
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    42   0.012
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    42   0.014
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    42   0.014
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    42   0.015
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      42   0.016
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      42   0.016
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    41   0.018
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    41   0.018
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    41   0.020
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    41   0.020
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    41   0.021
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      41   0.021
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    41   0.022
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    41   0.023
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    41   0.023
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    41   0.025
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    41   0.025
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    41   0.026
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    41   0.027
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    41   0.029
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    40   0.029
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    41   0.030
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    40   0.033
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    40   0.034
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    40   0.034
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    40   0.036
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    40   0.038
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    40   0.040
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    40   0.041
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    40   0.044
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    40   0.044
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    40   0.047
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.047
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    40   0.051
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    40   0.053
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    40   0.053
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    40   0.058
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    40   0.060
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    40   0.060
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    40   0.063
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.066
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.068
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               39   0.072
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    39   0.072
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    39   0.100
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    39   0.10 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.10 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.11 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    39   0.12 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    39   0.12 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    39   0.13 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    39   0.14 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    39   0.14 
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    38   0.15 
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    38   0.15 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    38   0.15 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    38   0.15 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    38   0.15 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    38   0.16 
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    38   0.16 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    38   0.17 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.17 
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     38   0.20 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    38   0.20 
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    38   0.20 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.20 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    38   0.22 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    38   0.22 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    38   0.23 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    38   0.23 
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    37   0.26 
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    38   0.27 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    38   0.27 
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    37   0.28 
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    37   0.30 
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    37   0.31 
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    37   0.32 
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    37   0.33 
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    37   0.35 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    37   0.36 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    37   0.38 
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    37   0.39 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    37   0.39 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.42 
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    37   0.45 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.48 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    37   0.48 
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    37   0.49 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    37   0.51 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    37   0.51 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    37   0.51 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    37   0.52 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    36   0.58 
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    36   0.61 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    36   0.72 
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    36   0.80 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    36   0.81 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    36   0.84 
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    36   0.91 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    36   0.97 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    35   1.0  
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    35   1.1  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   1.1  
NDAI0A07700 Chr1 complement(1769901..1772906) [3006 bp, 1001 aa]...    35   1.1  
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    35   1.2  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    35   1.3  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.3  
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    35   1.3  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    35   1.3  
NDAI0A02790 Chr1 (629617..633309) [3693 bp, 1230 aa] {ON} Anc_7....    35   1.4  
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    35   1.5  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   1.6  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    35   1.6  
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    35   1.6  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    35   1.7  
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    35   1.8  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    35   1.9  
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    35   2.0  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    35   2.0  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   2.1  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    35   2.1  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    34   2.3  
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    35   2.3  
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    34   2.4  
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    34   2.4  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    34   2.5  
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    34   2.5  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    34   3.0  
KLTH0E04224g Chr5 complement(380176..384102) [3927 bp, 1308 aa] ...    34   3.2  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    34   3.4  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    34   3.6  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    34   3.7  
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    33   4.1  
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    33   4.4  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   4.4  
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    33   4.4  
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    33   4.7  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    33   4.8  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              33   5.2  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    33   5.3  
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    33   6.8  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    32   9.5  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    32   10.0 

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 2516 bits (6520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1238/1283 (96%), Positives = 1238/1283 (96%)

Query: 1    MLEDTLINHIEYELDSESMDVDNDVNSTSNLQIDSNVSRDVGTDVELSDEIQVPVSVIGN 60
            MLEDTLINHIEYELDSESMDVDNDVNSTSNLQIDSNVSRDVGTDVELSDEIQVPVSVIGN
Sbjct: 1    MLEDTLINHIEYELDSESMDVDNDVNSTSNLQIDSNVSRDVGTDVELSDEIQVPVSVIGN 60

Query: 61   EMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFN 120
            EMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFN
Sbjct: 61   EMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFN 120

Query: 121  NSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST 180
            NSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST
Sbjct: 121  NSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST 180

Query: 181  QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNA 240
            QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNA
Sbjct: 181  QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNA 240

Query: 241  ANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDI 300
            ANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDI
Sbjct: 241  ANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDI 300

Query: 301  PTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDV 360
            PTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDV
Sbjct: 301  PTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDV 360

Query: 361  ETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXX 420
            ETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMIN              
Sbjct: 361  ETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSL 420

Query: 421  RTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEV 480
            RTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEV
Sbjct: 421  RTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEV 480

Query: 481  ISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALS 540
            ISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALS
Sbjct: 481  ISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALS 540

Query: 541  SLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAY 600
            SLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAY
Sbjct: 541  SLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAY 600

Query: 601  NMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXXQ 660
            NML           QTAYSIKVNDAPGLKLDCDRALYTIAIARRSIS            Q
Sbjct: 601  NMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNLIFQ 660

Query: 661  EYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAFQ 720
            EYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDH        TKIAFQ
Sbjct: 661  EYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIAFQ 720

Query: 721  RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTK 780
            RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTK
Sbjct: 721  RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTK 780

Query: 781  TVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA 840
            TVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA
Sbjct: 781  TVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA 840

Query: 841  YLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLV 900
            YLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLV
Sbjct: 841  YLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLV 900

Query: 901  DLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQL 960
            DLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQL
Sbjct: 901  DLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQL 960

Query: 961  ESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKN 1020
            ESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKN
Sbjct: 961  ESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKN 1020

Query: 1021 IYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPF 1080
            IYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPF
Sbjct: 1021 IYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPF 1080

Query: 1081 GNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKR 1140
            GNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKR
Sbjct: 1081 GNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKR 1140

Query: 1141 LLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIK 1200
            LLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIK
Sbjct: 1141 LLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIK 1200

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYF 1260
            YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYF
Sbjct: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYF 1260

Query: 1261 LVYVKNENIDDIEPLKRIVSDCA 1283
            LVYVKNENIDDIEPLKRIVSDCA
Sbjct: 1261 LVYVKNENIDDIEPLKRIVSDCA 1283

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1362 bits (3525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1230 (55%), Positives = 901/1230 (73%), Gaps = 15/1230 (1%)

Query: 59   GNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQ 118
            G+   ++  DDG +LLY +  +++P KTSER+LD+I+ ++P + +    E+ N      +
Sbjct: 43   GDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFN------E 96

Query: 119  FNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLID 178
            F+N +LK+ ++ YSK R  V P S+G+IVDQI++Q+KFEYKS TCP  N I V +GVLID
Sbjct: 97   FSNGLLKKQLLSYSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLID 156

Query: 179  ST-QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFD 237
            +  Q  +T DD++++ I H+KITVK R+ LERT+R +G+ ++HL+  LHPFDQ+DLL FD
Sbjct: 157  TNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFD 216

Query: 238  KNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPST 297
                 L+DHAIYVS+DTNKL+L+EIF PEFDS+EER   T   I +R++ +  + +    
Sbjct: 217  PKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDK 276

Query: 298  EDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLE 357
            ++IPT I+CINT+FK+FKGPLTRKS+++P+K ++SDN +L   MNP+WLV+KYGF  ++E
Sbjct: 277  DEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIE 336

Query: 358  KDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXX 417
             + ET ++  +Y PP+L D+ ++Q  RK RE+VTRKCLELI+ GK+ I+           
Sbjct: 337  TEEETEEQLIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESAS 396

Query: 418  XXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQM 477
               RTFNLLQTSFST F+  ++ E      ++     N+DYH I+LS SYHY++RDIIQ 
Sbjct: 397  KSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQN 456

Query: 478  FEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVT 537
            +E+  K+DP NIG Y+DSL FIAN +GSY LI YC K DIVGQE+LE A+KTF+LD    
Sbjct: 457  YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516

Query: 538  ALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTR 597
             LS   D++ M+IY+ E+K       R  NLRNAL++LA +K S +LKF+VDYEPY + +
Sbjct: 517  DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576

Query: 598  TAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXX 657
             A+N+L           QTAYSIKVND PGLK+DCDRALYT+A+++RS+           
Sbjct: 577  RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636

Query: 658  XXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKI 717
              Q++Y  D ++Y+ AL  LQVNENA+D+ ILE+FQ++W  ++++  D         TKI
Sbjct: 637  PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696

Query: 718  AFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
            AF+RNSKLIS++LETGV++P CLPA+NWP GLNNIGNTCYLNSLLQYYF ISPLR+ + +
Sbjct: 697  AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756

Query: 778  YTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKK 837
            Y KT++ +EN L+     RR+GGR  N +EVERSVQFVYQLRDLF+EMI+S SRCVTP K
Sbjct: 757  YQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTK 816

Query: 838  ELAYLAFAPSNVEVEFD--SEDGKSQRDNISTETVDVGAD---GKNDNLLVDFDSNIGAN 892
            ELAYLAFAPSNVEVEFD  +E      +++  + V +  D    K  +L++D +++   N
Sbjct: 817  ELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVEN 876

Query: 893  GRDEKLL-VDLDSNISDKIKEEEVKKINTLKPV--TSTRVAKISPDQLENALEMGRQQDV 949
              + +L+ +D  S+ S   K EE+ +         TSTRVAKIS DQLENALE+GRQQDV
Sbjct: 877  SPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDV 936

Query: 950  TECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLS 1009
            TECIGNVL QLESAS P+SL++D+EQ DL+K  F  KTKQSIIPL+ +   RNKIERF+S
Sbjct: 937  TECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVS 996

Query: 1010 LLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKF 1069
            LLVN+ DHPK++YDALDLYF+DE L M+EYGEV+K+L++TEFP+ILQIQIQRVYYDRE+F
Sbjct: 997  LLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERF 1056

Query: 1070 IPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGL 1129
            +PFKSIEPLPF   +YMDRY E  + +L+  K++   +KK+L+ M+KRQKELLSRNELGL
Sbjct: 1057 MPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGL 1116

Query: 1130 SRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNI 1189
            SRKE+ +ET++ L SD L+  GI+   K  LI ++   L +ID ELT L+N+I ++E  I
Sbjct: 1117 SRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKI 1176

Query: 1190 SNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
               F +FQ+I Y+LFAVFIHRGEASYGHYW YIKDF +N IWRKYNDETITEVP++EVFN
Sbjct: 1177 DRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236

Query: 1250 FIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
            F EGNTATPYFLVYVK EN+++IEPLKRIV
Sbjct: 1237 FTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1278 (51%), Positives = 858/1278 (67%), Gaps = 72/1278 (5%)

Query: 56   SVIGNEMGLNEL----DDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCN 111
            S I  + G NEL    D G   LY       P KT++R+LDDIL +   +  INS ++  
Sbjct: 42   SEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHD---LSFINSDDH-- 96

Query: 112  TLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEV 171
            ++ Y++  +N ILK P++ YS+        ++GS+VDQ+V+Q+KFEY SV+CP HN ++V
Sbjct: 97   SILYSD-LSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQV 155

Query: 172  FMGVLIDSTQK-ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLV--KELHPF 228
            FMGVLID TQ+   T ++L+ + I H+K+TVKTR VLERT++  G++ +H +   E+HP+
Sbjct: 156  FMGVLIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPY 215

Query: 229  DQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHS 288
            D++DLLTFD     L+D+AIYVS D+NKLILIEIF PEFDS EER  F    IN RY  +
Sbjct: 216  DKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMA 275

Query: 289  LAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVS 348
                +      IPT  +CINTLFK+FKGPL RKSS +P K IN +N  L  H++P WL S
Sbjct: 276  CNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTS 335

Query: 349  KYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXX 408
            KYGF + +EKD ETG++  EY PPDLT+Y  + + R++RES TR+CLELIF G++ I   
Sbjct: 336  KYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLL 395

Query: 409  XXXXXXXXXXXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYH 468
                        R F+++QT+FST F+  L+ E       E+ S  + D+HFI+LS  Y+
Sbjct: 396  SQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYN 455

Query: 469  YSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIK 528
            Y +RDII+ +E    +DP+N+G Y D+L FIAN KG+YQLIAYC K D VGQE+L+ A+ 
Sbjct: 456  YIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALG 515

Query: 529  TFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQE---RHVNLRNALQVLASYKKSKKLK 585
             F +D       +L DSV++SIY    KN+S S     RH  L+N+L++LA +KKS KLK
Sbjct: 516  VFQIDSKEFDPHNLNDSVLLSIY----KNESASTRNPNRHAELKNSLRLLAKFKKSPKLK 571

Query: 586  FFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRS 645
            F+ DYEPY N   AY +L           QTAY++KVND+PGLK+DCDRALYTIA+  RS
Sbjct: 572  FYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRS 631

Query: 646  ISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFD 705
            ++            QEY+  D FSY  ALS+LQVNENA D+ ILE+FQ+KW++E +   D
Sbjct: 632  LALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDAD 691

Query: 706  HXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYY 765
                     +KI F+RNSKLIS+F++TG +D SCLPAENWPTGLNNIGNTCYLNSLLQYY
Sbjct: 692  QFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYY 751

Query: 766  FAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEM 825
            F+IS LR  +++Y  TV    NN +    +RR+GGR     EVERSVQFVYQLRDLF  M
Sbjct: 752  FSISSLRQYVLDYRNTVQHFLNNQEYA--SRRIGGREITEAEVERSVQFVYQLRDLFDSM 809

Query: 826  IYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVD-------------- 871
            I++  RCVTP+KELAYLAF PS + VEF+  +      N   E  +              
Sbjct: 810  IHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPND 869

Query: 872  ------------------VGADGKNDNLLVDFD-SNIGANGRDEKLLVDLDSNISDKIKE 912
                              +  +  +D  + +FD S  G N       VD+D +++D   E
Sbjct: 870  EPLLIDLDDDSDPNNHSKLNKNSNDDGKINEFDNSQAGEND------VDVDISMTDSPAE 923

Query: 913  EE-VKKINTL-------KPV---TSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLE 961
            EE V K ++        K V   TSTRVAKIS DQLENALEMGRQQDVTECIGNVL QLE
Sbjct: 924  EEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLE 983

Query: 962  SASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNI 1021
            SAS P+SL DD EQNDL+K  F    KQ+IIPL+     R K ERFLSLLVNIGDHPK+I
Sbjct: 984  SASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDI 1043

Query: 1022 YDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFG 1081
            YDALDLYF DE L++EEYG+V++T+++T+FP+ILQIQIQRVYYDRE+F+PFKS+ PLPF 
Sbjct: 1044 YDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFN 1103

Query: 1082 NVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRL 1141
              +YMDRY++ +N  LI+ K +   + +EL  +K RQ+ELLS+NELGLSRK +LIET   
Sbjct: 1104 ETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNF 1163

Query: 1142 LMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKY 1201
            L SDVL+  GI +  +T L  +++  +L I+ EL+ L++NI  +E  IS+ F +F+SI Y
Sbjct: 1164 LKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGY 1223

Query: 1202 NLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFL 1261
            +LFAVFIHRGEASYGHYW YIKD  ++ IWRKYNDETITEVP+SEVFNF EGNTATPYFL
Sbjct: 1224 SLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFL 1283

Query: 1262 VYVKNENIDDIEPLKRIV 1279
            VYVK  +  +IEPLKR++
Sbjct: 1284 VYVKQGHEQEIEPLKRVL 1301

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1234 bits (3194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1229 (50%), Positives = 852/1229 (69%), Gaps = 27/1229 (2%)

Query: 64   LNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSI 123
            L   D G ++LY+ +    P KTS+R+LDD++ ++     INSK++   + Y++  +N I
Sbjct: 55   LTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAF---INSKDH--DILYSD-LHNGI 108

Query: 124  LKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKA 183
            LK P++ YS+  + ++P S G++VDQI +Q+ FEY S++CP HNK+ V+MGVLID     
Sbjct: 109  LKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDY 168

Query: 184  N-TLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKE--LHPFDQKDLLTFDKNA 240
              T   LS   + H+K+TVKTR++LE T++  G++ +H + E  LH FD++DL  FD   
Sbjct: 169  KITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTD 227

Query: 241  ANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDI 300
              L+DHAIYVS DTNKL+LIE+F PEFD +E+   ++   I  RY  +    +     +I
Sbjct: 228  PRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEI 287

Query: 301  PTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDV 360
            PT  +CINTL K+F+GPL R++S +P+K INSDN +L   +NP WL SKYGF + +EKD 
Sbjct: 288  PTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDE 347

Query: 361  ETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXX 420
             TG+ + E+EPP+LT+Y+ +++ R++RES  RKC+ELIF GK  I               
Sbjct: 348  STGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVY- 406

Query: 421  RTFNLLQTSFS-TSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFE 479
            RTFN +Q +FS T++FK+L + R +    E+ S  + +Y+FINLS  ++Y +RDII+ +E
Sbjct: 407  RTFNAIQIAFSKTTWFKMLGEHRSI-FSFESASPLDANYNFINLSACFYYIDRDIIKNYE 465

Query: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539
                +DP+N G Y+D+L +IAN KG+YQL+AYC K D+VGQE+L+ A+K F +D     +
Sbjct: 466  AQCALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDV 525

Query: 540  SSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTA 599
            ++++DS+++SIY++E      ++ RH +L+NAL++LA YKKS KLKFF DYEPY N   A
Sbjct: 526  ATIDDSLLVSIYKSETMANP-NENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRA 584

Query: 600  YNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXX 659
            Y +L           +TAYSI +ND+PGLK+DCDRALYTI + +RS+             
Sbjct: 585  YEILEVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDF 644

Query: 660  QEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAF 719
            Q YY   T  Y+ ALS+LQ+NENA DE +LEVFQ+KW +E     D+        TKI  
Sbjct: 645  QLYYGPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGI 704

Query: 720  QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYT 779
            +RNSKLI +F++TG ID SCLPA+NWPTGLNNIGNTCYLNSLLQYYF+++PLR  ++ Y 
Sbjct: 705  ERNSKLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQ 764

Query: 780  KTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKEL 839
            +T++   ++   +   RR+GGR  +  EVERSVQFVYQLRDLF  MIYS  RCVTP+KEL
Sbjct: 765  ETMEHFRHHTGNE--LRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKEL 822

Query: 840  AYLAFAPSNVEVEFDSEDGKSQRD------NISTETVDVGADGKNDN---LLVDFDSNIG 890
            AYLAFAPSN EVEF+     +Q +      + + + +  G   ++DN     ++ DS+ G
Sbjct: 823  AYLAFAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSG 882

Query: 891  ANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVT 950
                D  +  +      + I   + +K N +   TSTRVAKIS DQLENALEMGRQQDVT
Sbjct: 883  NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIIS--TSTRVAKISSDQLENALEMGRQQDVT 940

Query: 951  ECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSL 1010
            ECIGNVL QLESAS P++LD+D EQNDL+K  F  K KQ+IIPL KS   + KIER+LSL
Sbjct: 941  ECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000

Query: 1011 LVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFI 1070
            LVNIGDHPK+IYDALD YF+DE L M EYG+V++T+++TEFP+ILQIQIQRVYYDRE+F+
Sbjct: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060

Query: 1071 PFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLS 1130
            PFKSIEPLPF  VLYMDRY++  + ++++ K ++  +K +L+ +K RQKELLS NELGLS
Sbjct: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120

Query: 1131 RKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNIS 1190
            RK + +ET   L SD++ +  +       LI Q++ ++ +ID+ELT+L+++I  +E  I 
Sbjct: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180

Query: 1191 NMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNF 1250
              F+EF+ I Y+LFAVFIHRGEASYGHYW YIKD  +N  WRKYNDETITEVP++EVFNF
Sbjct: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240

Query: 1251 IEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
             EGNTATPYFLVYV+  +  DIEPLKRI+
Sbjct: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRII 1269

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1228 (51%), Positives = 837/1228 (68%), Gaps = 24/1228 (1%)

Query: 66   ELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILK 125
            ++DDG  LLY ++    PLKTS+R+LDDIL +       +       L+      + ILK
Sbjct: 52   DVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQ-----TSGILK 106

Query: 126  QPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---QK 182
            + M+ YS  R+ + PD++GS+ DQ+V+Q+K EY S++CP +NKI+V   V+ + +   Q+
Sbjct: 107  KSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQ 166

Query: 183  ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAAN 242
                DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D  DL TFD +  N
Sbjct: 167  IAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPN 226

Query: 243  LIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPT 302
            L D+ IYVS+DTNKLILIEIFNPEFDS EER  FT   I +RY     + E  +  + P+
Sbjct: 227  LKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPS 286

Query: 303  GIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVET 362
              +C  TLFK+FKGPL RKS+ DPIK I+S N +L  H+NPEWL SKYGF    E D ET
Sbjct: 287  QPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEET 346

Query: 363  GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRT 422
             + FTEY PPD+ DYV + + RKIRES  RKCL+LIF+G++  +              + 
Sbjct: 347  NESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKG 406

Query: 423  FNLLQTSFST-SFFKLLIQERG-VGLPIENQSNYNIDY--HFINLSVSYHYSERDIIQMF 478
             + +QTSFS   +F+LL + R  + L    Q++  +D   HFINLSVS++Y++RDII+ +
Sbjct: 407  LSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNY 466

Query: 479  EVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTA 538
            E +S +DP+NIG Y+D+L +IAN KG+YQ+IAYC K DI+GQE+LE A+  F +D     
Sbjct: 467  EALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYD 526

Query: 539  LSSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTR 597
            ++ L ++ ++SIY+ E  NK+ +   H+ NL+NAL++LA Y KS KLKF+VD+EPY    
Sbjct: 527  IAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALS 586

Query: 598  TAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXX 657
             AY+ L           +TAYSIK+ND+PGLKLDCDRALYTIAI++RS+           
Sbjct: 587  QAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECP 646

Query: 658  XXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKI 717
              Q YY  +   Y  AL LLQVNENASDE IL++F+ KWF+E +   D         TKI
Sbjct: 647  QFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKI 706

Query: 718  AFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
            + +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I+N
Sbjct: 707  SIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

Query: 778  YTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKK 837
            Y KT+++  ++L      RRVGGR  +  EVERS+QF++QLR+LF  M++S  RCVTP K
Sbjct: 767  YQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSK 826

Query: 838  ELAYLAFAPSNVEVEFDSEDGKSQRDNI---STETVDVGADGKNDNLLVDFDSNIGANGR 894
            ELAYLAFAPSNVEVEF+ E  K   D       ET    A  + D +L+DF+ +   NG 
Sbjct: 827  ELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGD 886

Query: 895  DEKLLVDLDSNISDKIKEEEVKKINT---LKPVTSTRVAKISPDQLENALEMGRQQDVTE 951
             EK     D N  +K +  +V+ I T       + TRVAKIS DQLENALEMGRQQDVTE
Sbjct: 887  VEK-----DENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTE 941

Query: 952  CIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLL 1011
            CIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQ I+PL  +   R K+ERFLSLL
Sbjct: 942  CIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLL 1001

Query: 1012 VNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIP 1071
            VNIGDHPK+IYDA D YF DE L M EYG+V++T+++T FP+ILQ+QIQRVYYDRE+F+P
Sbjct: 1002 VNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMP 1061

Query: 1072 FKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSR 1131
            FKSIEPLPF  V+YMDRYA+ DN  L+  K +   +K++  +MK RQ+ELL+R+  GL+R
Sbjct: 1062 FKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTR 1121

Query: 1132 KESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISN 1191
            K++ +ET +LL S +++N  +++  K +LI  ++  + +ID EL +L+++I  +E  IS+
Sbjct: 1122 KDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISH 1181

Query: 1192 MFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFI 1251
             F +F+   Y+LF+VFIHRGEASYGHYW YIKD  QN +WRKYNDETI+EVP+ EVFNF 
Sbjct: 1182 QFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFN 1241

Query: 1252 EGNTATPYFLVYVKNENIDDIEPLKRIV 1279
            EGNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1242 EGNTATPYFLVYVKQGQEADIEPLKRIL 1269

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1241 (50%), Positives = 857/1241 (69%), Gaps = 41/1241 (3%)

Query: 68   DDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQP 127
            DDG +LLY N+ N  P+KT+ER++DDI++++  +  I + +N +    +    N ILKQ 
Sbjct: 36   DDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGI-AVDNGSRGDIDTMLGNGILKQS 94

Query: 128  MIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANTLD 187
            M+ YSK++       +GS++DQ+ +Q+K+EYKSVTCP  NK++VF GVL +++ +   LD
Sbjct: 95   MLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNSTQITNLD 154

Query: 188  DLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANLIDHA 247
            +++   I H+K+TVKTR  LE T++  G+++FHLV +LH +D++D+ TF+    NL+D+A
Sbjct: 155  EVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNLLDYA 214

Query: 248  IYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTGIECI 307
            IYVS DTNKLILIE+F PEF S +E   F    IN+RY  +  + +  +  + PT ++C+
Sbjct: 215  IYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQLDCL 274

Query: 308  NTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVETGDEFT 367
            NTLFKVFKGPL+RKSS++P K I+S N  L  H+NPEWL SKYGFN+V+++D+    +  
Sbjct: 275  NTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNAQQSV 334

Query: 368  EYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRTFNLLQ 427
            EYEPP+L +YV + + R++RE+  R+CL+LIF+GK+ IN              ++ N LQ
Sbjct: 335  EYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSINALQ 394

Query: 428  TSFSTSFFKLLIQERGVGLPI--ENQSNYNIDYHFINLSVSYHYSERDIIQMFEVISKVD 485
            T+F+ +    L +  G    +  E++S  + ++HFINLS  YHY++RD+I+ +E +  +D
Sbjct: 395  TNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERLCHLD 454

Query: 486  PDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALSSLEDS 545
            P N+G Y+D+L +IAN KGSYQLIAYC K DIVGQE+L+ A+K+FNLD     ++ + DS
Sbjct: 455  PQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITKINDS 514

Query: 546  VIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAYNMLXX 605
            V++++Y+ ELK   +S     NL+NA+++ A  K S KLKF++D+EPY     AY  L  
Sbjct: 515  VLLTLYKNELK---ISTSDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYETLDI 571

Query: 606  XXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXXQEYYTA 665
                     QTAY IKV D+PGL +DCDRALYTIAI +RS+             QEYY  
Sbjct: 572  DESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQEYYCP 631

Query: 666  DTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAFQRNSKL 725
            D F+Y  ALS+ QVNENA+DE I++ FQ +WF E++   +          +I  QRNS L
Sbjct: 632  DRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQRNSSL 691

Query: 726  ISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDD- 784
            ISNFL+TG IDP+CLP ++WP G+NNIGNTCYLNSLLQYYF+I+PLR+ ++ Y+KT++D 
Sbjct: 692  ISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKTIEDF 751

Query: 785  --IENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYL 842
              +ENN       RR+GGR  +  EVERS+QF+YQLRDLF  M+YS+ RCVTP++ELAYL
Sbjct: 752  KTLENN---ASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAYL 808

Query: 843  AFAPSNVEVEFDSEDGK--SQRDNISTETVDVGADGKNDNLLVD-----FDSNIGANGRD 895
            AFAPSN+EVEF++ + +  +Q+DN    T ++G D       VD        NI     +
Sbjct: 809  AFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSDNITPKDAE 868

Query: 896  EKLLVDLDSNISDKIKEEEVKKI------------NTLKPV----TSTRVAKISPDQLEN 939
            E+     +  +++  K ++V  I            NT   V    TST+VAKIS DQLEN
Sbjct: 869  EE-----EDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISSDQLEN 923

Query: 940  ALEMGRQQDVTECIGNVLNQLESASIPLSL-DDDEEQNDLLKNCFLVKTKQSIIPLEKSK 998
            ALEMGRQQDVTECIGNVL QLES S PL L ++D EQ+DL+K  F  + +Q+I+PL    
Sbjct: 924  ALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLANPD 983

Query: 999  PPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQ 1058
              R K+ERFLSLLVNIGDHP++IYDALDLYF DE L+MEEYG+V++T+++T+FP+ILQIQ
Sbjct: 984  QRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPTILQIQ 1043

Query: 1059 IQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQ 1118
            IQRVYYDREKF+PFKSIEPLPF   +YMDRY+  DN ELI  KN+  +MK++L  +KK+Q
Sbjct: 1044 IQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVELKKKQ 1103

Query: 1119 KELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTL 1178
            ++LLSRN +GLS+K+S IE  +LL SD L++ GI +P K  ++S ++     ID EL  L
Sbjct: 1104 RDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDDELNQL 1163

Query: 1179 FNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDET 1238
            +  I  +E  I+  F EF+ I Y++FAVFIHRGEASYGHYW YIKD  QN IWRKYNDET
Sbjct: 1164 YAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDET 1223

Query: 1239 ITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
            ++EVP+ EV+NF EGNTATPYFLVYVK     +IEPLKRI+
Sbjct: 1224 VSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRII 1264

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1218 bits (3152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1326 (48%), Positives = 881/1326 (66%), Gaps = 70/1326 (5%)

Query: 19   MDVDNDVNSTSNLQIDSNVSRDVGTDVELSDEI--QVPVSVIGNEMGLNEL--------- 67
            MD     + TS++ + S++      D++LSD    Q   S + NE   N+L         
Sbjct: 1    MDPAISTHQTSDIGVPSDLESTTNIDIQLSDNSTEQTSTSSMYNEELANQLSQDSNIIPE 60

Query: 68   -DDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYN---------- 116
             DDG  +LY +  N S  KT++R+LDD++ ++  M   NS E+ N    N          
Sbjct: 61   VDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNN 120

Query: 117  -----------EQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPN 165
                       + + N IL+ P  +YSK R +    ++G+IVDQI +Q++FE+KSVTCP 
Sbjct: 121  TSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPE 180

Query: 166  HNKIEVFMGVLIDSTQKANTLDDLSNII-INHVKITVKTRTVLERTRRLMGLSKFHLVK- 223
             N + V +GVL+D+  +A     L   + + H KITVKTR+ LE+T++ +G+S FHL+  
Sbjct: 181  FNDVHVLLGVLMDNRSQA----PLGTFLPVYHFKITVKTRSYLEKTKKHVGISHFHLIDF 236

Query: 224  -ELHPFDQKDL--LTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNV 280
             +LH FD+KDL     D N  +L+D AI++SEDTNKL+++EIF PEF+  EE   F+   
Sbjct: 237  DDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQES 296

Query: 281  INQRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLH 340
            I +RY+++ +       + IPT +EC+NT+FK+FKGPL  K+ N+P+K IN+DNP+L  H
Sbjct: 297  IAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNSH 356

Query: 341  MNPEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFF 400
             NP WL++KYGF   L+ + +T +EF EY PP+L DY+++  TR +RES  RKCLELIF 
Sbjct: 357  WNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIFI 416

Query: 401  GKMMINXXXXXXXXXXXXXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHF 460
             K  I+              R+FN+LQT F+TSF+   + E    L   N+ +Y  +YH+
Sbjct: 417  SKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQLDTYNKLDY--EYHY 474

Query: 461  INLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQ 520
            INL  S++Y+ERDII+ +  ++ +DP NIG YYD+L +IA +K SYQLI++ SK D++GQ
Sbjct: 475  INLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQDVIGQ 534

Query: 521  ESLETAIKTFNLDLS-VTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYK 579
            E+L  A+  FN+D +  +A+S+L +S+I +IY+ E K  ++S  R   ++NAL++LA YK
Sbjct: 535  EALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNALRLLAKYK 594

Query: 580  KSKKLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTI 639
             S +LKF+ DYEPY +    YN L           QTAY+IKVNDAPGLK+DCDRAL T+
Sbjct: 595  HSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDRALLTV 654

Query: 640  AIARRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEE 699
            A  R+S++             E+Y  D F Y  AL+ LQVNENA+DE ILE+FQ++W  +
Sbjct: 655  ATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQRWSND 714

Query: 700  AMVAFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLN 759
              + +D         +KIA+++NSKLISNF++TG++DP+CLP ENWP GLNNIGNTCYLN
Sbjct: 715  KSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGNTCYLN 774

Query: 760  SLLQYYFAISPLRDEIINYTKTVDDIEN----NLQLQGITRRVGGRVTNTIEVERSVQFV 815
            SLLQYYF+I PLRD I+ Y  T+   +N    N QL+   RR+GGR  N +EVERSVQF+
Sbjct: 775  SLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEK-RRRIGGREVNELEVERSVQFI 833

Query: 816  YQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDS---EDGKSQRDNISTETVDV 872
            YQ+RDLF EMI+S  RCV+P++ELAYLAF PSN+EVEF+S   ED    + N + + V +
Sbjct: 834  YQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSN-AQDAVVL 892

Query: 873  GADGKND---NL----LVDFDSNIGANGRDEKLLVDLDSNISDKI-KEEEVKKINTLKPV 924
              + KND   NL    L+D +     +  +++  +D    +++   K +E+ K N  + V
Sbjct: 893  QDEAKNDTDINLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKELSKTNPFREV 952

Query: 925  T-------STRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLD-DDEEQN 976
            +       STRVAKIS DQLENA EMGRQQDVTECIGNVL QLE+   P+SLD +D EQ 
Sbjct: 953  SPNEDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDNEDNEQY 1012

Query: 977  DLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQM 1036
            DL+K  F  KTKQSIIPL  +   R K+ERFLSLLVNI DHPK+IYDAL+ YF DE L M
Sbjct: 1013 DLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFADEFLTM 1072

Query: 1037 EEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKE 1096
            EEYG+V+KTLS+TE+P ILQIQIQRVYYDRE+F+PFKSIEPLPF  V+YMDRYAE  + E
Sbjct: 1073 EEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYAESSDPE 1132

Query: 1097 LIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPM 1156
            LI  K +   +K +L   + RQKELLS+NELGLSRKE+++ET + L S V+  NGID   
Sbjct: 1133 LISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILENGIDTTN 1192

Query: 1157 KTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYG 1216
            K  L+ +++  +  I+ EL+ L+N I  ++  I + F +F+ + Y+LFAVFIHRGEASYG
Sbjct: 1193 KDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVFIHRGEASYG 1252

Query: 1217 HYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLK 1276
            HYW YIKD  +N IWRKYNDE++TEVP+ EVFNF EGNTATPYFLVYVK +++ DIEPLK
Sbjct: 1253 HYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQDSLSDIEPLK 1312

Query: 1277 RIVSDC 1282
            RI+ + 
Sbjct: 1313 RIIQNT 1318

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1217 bits (3148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1233 (50%), Positives = 831/1233 (67%), Gaps = 30/1233 (2%)

Query: 65   NELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSIL 124
             ++DDG  LLY ++    PLKTS+R+LDDIL +   +   + K     L+     +  IL
Sbjct: 51   GDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQ-----SRGIL 105

Query: 125  KQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---Q 181
            K+ M+ YS  R+++ P+ +GS+ DQ+V Q+K EY S++CP +NKI VF  V+ + +   Q
Sbjct: 106  KESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQ 165

Query: 182  KANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAA 241
            + +T DD+  I I H+K++VK R  LER ++ +G+++FH +  LH +D+ DL TFD +  
Sbjct: 166  QISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDP 225

Query: 242  NLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIP 301
            NL+D+ IYVS+DTNKLILIEIF PEF+S EE   FT + I +RY     + E     + P
Sbjct: 226  NLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETP 285

Query: 302  TGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVE 361
            + ++C  TLFK+FKGPLTRKS  +P K I+S N  L  H+NPEWL SKYGF    E D E
Sbjct: 286  SQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEE 345

Query: 362  TGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXR 421
            T + FTEY PPD+ DYV++ +TRKIRES  RKCL+LIF+G++  +              +
Sbjct: 346  TNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVK 405

Query: 422  TFNLLQTSFST-SFFKLLIQERGVGLPIENQSNY---NIDYHFINLSVSYHYSERDIIQM 477
              + LQTSFST  +F LL + R   L   N+  +   + + HFINLSVS++Y++RDII+ 
Sbjct: 406  GMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRN 465

Query: 478  FEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVT 537
            +E +S +DP+NIG Y+D+L +IAN KG+YQLIAYC K DI+GQE+LE A+  F ++    
Sbjct: 466  YESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKEC 525

Query: 538  ALSSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNT 596
             +S L ++ ++SIY+ E  NKS     H+ NL+NAL++LA Y KS KLKF+VD+EPY   
Sbjct: 526  NISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRAL 585

Query: 597  RTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXX 656
              AY+ L           +TAYS+K+ND+PGLKLDCDRALYTIAI++RS+          
Sbjct: 586  SQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEEC 645

Query: 657  XXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTK 716
                 YY  +   Y  AL LLQVNENASDE IL++F++KWF+E +   D         TK
Sbjct: 646  PQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTK 705

Query: 717  IAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII 776
            I+ +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  ++
Sbjct: 706  ISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765

Query: 777  NYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPK 836
             Y KTV++  ++L   G  RR+GGR  +  EVERS+QF+YQLR+LF  M+++  RCVTP 
Sbjct: 766  EYQKTVENFNDHLSNSGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPS 825

Query: 837  KELAYLAFAPSNVEVEFDSEDGK--SQRDNIS---TETVDVGADGK-NDNLLVDFDSNIG 890
            KELAYLAFAPSNVEVEF+ E  K   Q   +S    ET D     K  D  L+D +   G
Sbjct: 826  KELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDG 885

Query: 891  ANGRDEKLLVDLDSNISDKIKEEEVKKI----NTLKPVTSTRVAKISPDQLENALEMGRQ 946
             NG       D+ ++ + K  E    ++    +T    + TRVAKIS DQLENALEMGRQ
Sbjct: 886  LNG-------DVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQ 938

Query: 947  QDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIER 1006
            QDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  +   R K+ER
Sbjct: 939  QDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVER 998

Query: 1007 FLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDR 1066
            FLSLL+NIGDHPK+IYDA D YF DE L MEEYG+V +T+++T FP+ILQ+QIQRVYYDR
Sbjct: 999  FLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDR 1058

Query: 1067 EKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNE 1126
            E+ +PFKSIEPLPF  V+YMDRYA+ +N  L+  K +   MK++L  MK RQ+ELLSR++
Sbjct: 1059 ERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDD 1118

Query: 1127 LGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDME 1186
             GL+RK++ +E+ +LL SD +    + +     +I  +  N+  ID EL  L+N+I  +E
Sbjct: 1119 SGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLE 1178

Query: 1187 LNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSE 1246
              IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD  +N IWRKYNDETI+EV + E
Sbjct: 1179 EKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEE 1238

Query: 1247 VFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
            VFNF EGNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1239 VFNFNEGNTATPYFLVYVKQGQEGDIEPLKRIL 1271

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1237 (50%), Positives = 833/1237 (67%), Gaps = 40/1237 (3%)

Query: 66   ELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILK 125
            + DDG  LLY ++    PLKTS+R+LDDIL +   +   +       L+        IL+
Sbjct: 52   DFDDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQ-----TTGILR 106

Query: 126  QPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---QK 182
            + M+ YS  R+++ P+++GS+ DQ+VIQ+K EY S +CP +NKI VF  V+++ +   Q 
Sbjct: 107  ESMLSYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQH 166

Query: 183  ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAAN 242
             ++ DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D+ D  TFD +  N
Sbjct: 167  VSSFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPN 226

Query: 243  LIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPT 302
            L+D+ IYVS+DTNKLILIEIF PEFDS EE   FT N I +RY       E     + P+
Sbjct: 227  LMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPS 286

Query: 303  GIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVET 362
              +C  TLFK+FKGPLTRKS  +P+K I+S N  L  H+NPEWL SKYGF +  E D ET
Sbjct: 287  QADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEET 346

Query: 363  GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRT 422
             + FTEY PPD+ DYV + + RKIRES  RKCL+L+F+G++  +              + 
Sbjct: 347  NERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKG 406

Query: 423  FNLLQTSFST-SFFKLLIQERGVGLPIENQSNYNIDY--HFINLSVSYHYSERDIIQMFE 479
             + LQTSFS+  +F LL + R   L   N+S+  +D   HF+NLSVS++Y++RDII+ +E
Sbjct: 407  LSCLQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYE 466

Query: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539
             +S +DP NIG Y+D+L +IAN KG+YQLIAYC K DI+GQE+LE A+  F ++     +
Sbjct: 467  SLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNI 526

Query: 540  SSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTRT 598
            + L ++ ++SIY+ E  NKS     H+ NL+NAL++LA Y KS KLKF+VD+EPY     
Sbjct: 527  AELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 586

Query: 599  AYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXX 658
            AY+ L           +TAYS+K+ND+PGLKLDCDRALYTIAI+++S+            
Sbjct: 587  AYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQ 646

Query: 659  XQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIA 718
               YY A+   Y  AL LLQVNENASDE IL++F++KWF+E++   D         TKI+
Sbjct: 647  FLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKIS 706

Query: 719  FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
             +RNS LISNFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I++Y
Sbjct: 707  IERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDY 766

Query: 779  TKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKE 838
             KTV++  ++L   G  RR+GGR  +  EVERSVQF+YQLR+LF  M++S  RCVTP KE
Sbjct: 767  QKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKE 826

Query: 839  LAYLAFAPSNVEVEFDSEDGK--------------SQRDNISTETVDVGADGKN--DNLL 882
            LAYLAFAPSN+EVEF+ E  K              + +++ +T+  D  + G    DN  
Sbjct: 827  LAYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTN 886

Query: 883  VDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALE 942
             D   N     ++E   V +       +  ++   +N+L     TRVAKIS DQLENALE
Sbjct: 887  RDTHRNPSNTEKNEPNNVQI-------VGGDDTTDLNSL-----TRVAKISSDQLENALE 934

Query: 943  MGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRN 1002
            MGRQQDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  +   R 
Sbjct: 935  MGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRT 994

Query: 1003 KIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRV 1062
            K+ERFLSLL+NIGDHPK+IYDA D YF DE L MEEYG+V +T+++T FP+ILQ+QIQRV
Sbjct: 995  KVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRV 1054

Query: 1063 YYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELL 1122
            YYDRE+F+PFKSIEPLPF  V+YMDRYA+ +N  L+  KN+   MK++L  MK RQ+ELL
Sbjct: 1055 YYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELL 1114

Query: 1123 SRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNI 1182
            SR+  GL+RK++ +E+ +LL S V++   +   +K  +I+ +  N+  ID EL +L+NNI
Sbjct: 1115 SRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNI 1174

Query: 1183 RDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEV 1242
             ++E  IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD   N +WRKYNDET++EV
Sbjct: 1175 NNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEV 1234

Query: 1243 PDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
             + EVFNF EGNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1235 QEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1216 bits (3146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1231 (50%), Positives = 849/1231 (68%), Gaps = 42/1231 (3%)

Query: 67   LDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQ 126
            +DDG  LLY  +    P KTS+R+LDDI S+   M  +NS+E+   + Y+ Q +N +L+ 
Sbjct: 33   IDDGKTLLYPGVHLNFPFKTSDRLLDDIRSD---MFFLNSEEH--DILYS-QLHNGVLRL 86

Query: 127  PMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANTL 186
            PM+EYS+ + T  P S+G ++DQ+ +++K+EY+S TCP  NKI VFMGVL+D   +  +L
Sbjct: 87   PMLEYSR-KKTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPESL 145

Query: 187  DDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANLIDH 246
            DD+ N+ I H+KITVKTR  LER ++ +G++ +HL+ +LH FD++D+      +  L+D 
Sbjct: 146  DDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIF-MTTESEQLVDS 204

Query: 247  AIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTGIEC 306
            A YVS DTN+L+ IEIF PEF ++E+  +F+   + +RY  +  + ++     +PT +EC
Sbjct: 205  ATYVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVEC 263

Query: 307  INTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVETGDEF 366
            +NTLFK+FKGPL R+SS D +K I++DN  L   ++P WL  KY F +V   D ETG+  
Sbjct: 264  LNTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELI 323

Query: 367  TEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRTFNLL 426
             E+EPPDLTDYV +   R  RES TRKCLELIF GK                  R+FNL 
Sbjct: 324  REFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RSFNLY 382

Query: 427  QTSFSTSF-FKLL-----IQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEV 480
            QT+FSTSF F LL      Q+  +  P +N      DYHFINLS S +YS++DII+ +E 
Sbjct: 383  QTNFSTSFWFHLLGDGRNFQDHNLQQPFDN------DYHFINLSASSYYSDKDIIKNYET 436

Query: 481  ISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALS 540
               +DP+N+G Y+D+L +IAN KG YQLIAYC K +IVG+E+L+ A+  F +D   T + 
Sbjct: 437  QISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVK 496

Query: 541  SLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAY 600
            S+ D +++SIY+ ELK  S+  ++  +L+NAL++LA +K+SKKLKF VDYEPY +T  AY
Sbjct: 497  SITDELLLSIYKNELKAASV--QKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAY 554

Query: 601  NMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXXQ 660
             +L           QTAY+I+V DAPGLK+DCDRALYT+A+A+RS+             Q
Sbjct: 555  QLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQ 614

Query: 661  EYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAFQ 720
            E+Y  D +SY  ALSLLQVNENA+D+ ILE+FQ+KW +E M + D         TK+  +
Sbjct: 615  EFYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIE 674

Query: 721  RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTK 780
            RNSKLI+NF++TG++D SCLPA NWPTGLNNIGNTCYLNSLLQYYF+ISPLRD ++NY K
Sbjct: 675  RNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQK 734

Query: 781  TVD---DIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKK 837
             ++   DIE+    +   RR+G R  +  EVERSVQFVYQLRDLF +M+++  R VTP K
Sbjct: 735  MLNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTK 794

Query: 838  ELAYLAFAPSNVEVEFDSE-------DGKSQRDNISTETVDVGADGKNDNLLVDFDSNIG 890
            ELAYLAFAPSN+EVEF++        +   +R N   + +D+ ADG ++       S++ 
Sbjct: 795  ELAYLAFAPSNIEVEFEAPTITTVAPEDLDERTN-KLDIIDLAADGIDNETEKGSKSSLL 853

Query: 891  ANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVT 950
                 +K     +  I    +EEE   +N      S RVAKIS DQLEN LE+GRQQDVT
Sbjct: 854  DVHNQQKPEEQTEDIIMGGTQEEEA--VNA-----SMRVAKISSDQLENTLELGRQQDVT 906

Query: 951  ECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSL 1010
            ECIGNVL QLESAS P SL++D EQ+DL+K  F  K KQ +IP++     R KIERF+SL
Sbjct: 907  ECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERFVSL 966

Query: 1011 LVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFI 1070
            LVNIGDHPK+IYDALDLYF D+LLQ++E GEV++T+++T  P ILQIQIQRVYYDRE+F+
Sbjct: 967  LVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRERFM 1026

Query: 1071 PFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLS 1130
            PFKSIEPLPF   +YMDRY + D+  ++  ++  + +K+EL  +K RQ +LLS+N+ GLS
Sbjct: 1027 PFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDTGLS 1086

Query: 1131 RKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNIS 1190
             K SL++TK+ L S+VLD + I V  K +L+  I++ + +ID EL++L+  I  +E+ I+
Sbjct: 1087 FKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEVQIA 1146

Query: 1191 NMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNF 1250
            N F EF  I Y+LFA FIHRGEASYGHYW YIKD ++N IWRKYNDE++TEVP SEVFNF
Sbjct: 1147 NQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNF 1206

Query: 1251 IEGNTATPYFLVYVKNENIDDIEPLKRIVSD 1281
             EGNTATPYFLVY+K  + D+IEPLKR++ +
Sbjct: 1207 TEGNTATPYFLVYIKEGHEDEIEPLKRVIKE 1237

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/1235 (49%), Positives = 836/1235 (67%), Gaps = 32/1235 (2%)

Query: 67   LDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQ 126
            +DDG  LLY ++    PLKTS+R+LDD+L +   +    +  + N +    Q  + IL++
Sbjct: 53   VDDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFL----NSTDPNVIEKGLQ-TSGILRE 107

Query: 127  PMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLID---STQKA 183
             M+ YS  R+++ P+++GS+ DQ+ IQ+K EY S++CP +NKI VF  V+++   S Q+ 
Sbjct: 108  SMLSYSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQI 167

Query: 184  NTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANL 243
            ++ DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D+ DL TFD +   L
Sbjct: 168  SSFDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKL 227

Query: 244  IDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTG 303
            +D+ IYVS+DTNKLILIEIF PEF+S EE   FT + I +RY     + E  + ++ P+ 
Sbjct: 228  MDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQ 287

Query: 304  IECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVETG 363
             +C  TLFK+FKGPLTRKS  +PIK I+S N +L  H+N EWL SKYGF    E D ET 
Sbjct: 288  PDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETN 347

Query: 364  DEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRTF 423
            D FTEY PPD+  YV +   RKIRES  +KCL+LIF+G++  +              +  
Sbjct: 348  DPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGL 407

Query: 424  NLLQTSFSTS-FFKLLIQERGVGLPIENQ---SNYNIDYHFINLSVSYHYSERDIIQMFE 479
            + LQTSFSTS +F LL + R   L   N+   S  + + HFINLSVS++Y++RDII+ +E
Sbjct: 408  SSLQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYE 467

Query: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539
             +S +DPDNIG Y+D+L +IAN KG+YQLIAYC K +I+GQE+LE A+ TF +D     +
Sbjct: 468  ALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNI 527

Query: 540  SSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTRT 598
            + L ++ ++SIY+ E  NKS     H+ N +NAL++LA Y KS KLKF+VD+EPY     
Sbjct: 528  AELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 587

Query: 599  AYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXX 658
            AY+ L           +TAYSIK+ND+PGLKLDCDRALYTIAI++RS+            
Sbjct: 588  AYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQ 647

Query: 659  XQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIA 718
              +YY  +   Y  AL LLQVNENASDE +L++F++KW++E++   D         T+I+
Sbjct: 648  FLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRIS 707

Query: 719  FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
             +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I+ Y
Sbjct: 708  IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEY 767

Query: 779  TKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKE 838
             KT+D+  ++L   G  RR+GGR  +  EVERS+QF+YQLR+LF  M++S  RCVTP KE
Sbjct: 768  QKTLDNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKE 827

Query: 839  LAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKN-------------DNLLVDF 885
            LAYLAFAPSNVEVEF+ E  K     + +    + AD K              D  L+D 
Sbjct: 828  LAYLAFAPSNVEVEFEVEGNK-----VGSNGAAISADSKGEVTQEAATTSEEKDPSLIDL 882

Query: 886  DSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTS-TRVAKISPDQLENALEMG 944
            +     N   +K + ++ +N +++  + E+     +  + S TRVAKI  DQLENALEMG
Sbjct: 883  EMEDKTNSDVDKDIENVKANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMG 942

Query: 945  RQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKI 1004
            RQQDVTECIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQSI+PL  +   R K+
Sbjct: 943  RQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKV 1002

Query: 1005 ERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYY 1064
            ERFLSLLVNIGDHPK+IYDA D YF DE L MEEYG+V++T+++T FP+ILQ+QIQRVYY
Sbjct: 1003 ERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYY 1062

Query: 1065 DREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSR 1124
            DRE+F+PFKSIEPLPF  V+YMDRY++ +N  L+  K +   MK+ L  MK RQ+ELL R
Sbjct: 1063 DRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDR 1122

Query: 1125 NELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRD 1184
            +E GL+RK++ +E+ +LL S+++     +      +I  +++N+++ID EL +L+N+I  
Sbjct: 1123 DESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINS 1182

Query: 1185 MELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPD 1244
            +E  IS+ F +F+   Y+LF+VFIHRGEASYGHYW YIKD     +WRKYNDETI+EV +
Sbjct: 1183 LEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQE 1242

Query: 1245 SEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
             EVFNF EGNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1243 EEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRIL 1277

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1242 (50%), Positives = 838/1242 (67%), Gaps = 47/1242 (3%)

Query: 66   ELDDGSKLLYQNLMNMS-PLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSIL 124
            ++D G+ LLY +L   + P+KTS RI+DDIL ++     IN          N  F N IL
Sbjct: 74   DIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSF---INGP--------NLSFKNGIL 122

Query: 125  KQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKAN 184
            ++ MI YSK R        GS+VDQ+ +Q+K+EY S+TCP +NK+EV  G+L++      
Sbjct: 123  QESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNIT 182

Query: 185  TLDDL-SNIIINHVKITVKTRTVLERTRRLMGLSKFHLV--KELHPFDQKDLLTFDKNAA 241
             +D++ S + I H+KITVKTR +LE +++  G++++HL+  ++LH FD++DL+TFD +  
Sbjct: 183  NVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNP 242

Query: 242  NLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIP 301
            +L+D+AIYVS DTN+LILIEIF+ EFDS+EER  F    I  RY  +  + +    E +P
Sbjct: 243  DLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVP 302

Query: 302  TGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVE 361
            TGI+C+NT+ K+ K PLTRK++ND I+ ++S+NPIL  H NPEWL+ KY F      D  
Sbjct: 303  TGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDET 362

Query: 362  TGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXX--XXXXXXX 419
            TG E  EYEPPDL  YV   + R +RE   R+CL+LIF+GK ++                
Sbjct: 363  TGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKS 422

Query: 420  XRTFNLLQTSFSTS-FFKLLIQERGVGLP-IENQSN---YNIDYHFINLSVSYHYSERDI 474
             R FNLL T+ ST+  ++LL   +   L    N S+    + ++HFINLS S +Y++RDI
Sbjct: 423  YRAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDI 482

Query: 475  IQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDL 534
            I+ +E +  +DP NIG Y+D+L +IAN KGSYQLIAYC K D+VGQE++  A+K FN+D 
Sbjct: 483  IKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDP 542

Query: 535  SVTALSSLEDSVIMSIYQAELKNKSLSQER-HVNLRNALQVLASYKKSKKLKFFVDYEPY 593
            +V  L S++DS+++SIY    KN+S+ +    VNL+NA+++ A  + S +LKF+VD+EPY
Sbjct: 543  NVVNLESIDDSLLLSIY----KNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPY 598

Query: 594  LNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXX 653
             N   AY  L           QTAYSIK  DAPGLK+DCDRALYTIAI RRS+       
Sbjct: 599  RNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLL 658

Query: 654  XXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXX 713
                  Q YY    + Y  AL +LQVNENA+DE IL+ FQ KWF E +   D        
Sbjct: 659  ENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCA 718

Query: 714  XTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRD 773
              K+  +RNSKLI+NFL  GVIDPSCLP ENWPTG+NNIGNTCYLNSLLQYYF+ISPLR+
Sbjct: 719  LMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLRE 778

Query: 774  EIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCV 833
             ++ Y+KT +D  +  +     RR+GGR     EVERS+QF+YQLRDLF  MIY++ RCV
Sbjct: 779  YVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCV 838

Query: 834  TPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLV---DFDSNIG 890
            TP++ELAYLAFAPSNVEVEF  E+G +     + E V    D K  + L+   + D ++G
Sbjct: 839  TPRRELAYLAFAPSNVEVEF--ENGVTD----AKEDVSHYNDDKTSDTLIKIGEGDEDLG 892

Query: 891  ANGRDEK------LLVDLD----SNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENA 940
               R E        + D D    +  +D I +E+    N +  + ST+VAKIS DQLENA
Sbjct: 893  EAERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENA 952

Query: 941  LEMGRQQDVTECIGNVLNQLESASIPLSLD-DDEEQNDLLKNCFLVKTKQSIIPLEKSKP 999
            LEMGRQQDVTECIGNVL QLES S PL ++ +D EQ+DL+K  F  + KQ IIPL     
Sbjct: 953  LEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGE 1012

Query: 1000 PRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQI 1059
             R K+ERFLSLLVN+GDHP++IYDALD+YF DE L M+EYGEV++T++IT+FP+ILQ+QI
Sbjct: 1013 TRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQI 1072

Query: 1060 QRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQK 1119
            QRVYYDRE+F+PFKSIEPLPF   +YMDRY +  + E+++T+ +   MK EL  +KKRQ+
Sbjct: 1073 QRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQ 1132

Query: 1120 ELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLF 1179
            ELLSRNE+GLSRKE+  ET   L S+ L   GI    +  L + ++    +ID EL+T++
Sbjct: 1133 ELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIY 1192

Query: 1180 NNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETI 1239
            N I  +E  IS+ F++F+ + Y+LFAVFIHRGEASYGHYW YIKD+ QN IWRKYNDET+
Sbjct: 1193 NQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETV 1252

Query: 1240 TEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSD 1281
            +EVPD EVFNF EGNTATPYFLVYVK  +  DIEPLKRI+ +
Sbjct: 1253 SEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEE 1294

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1248 (48%), Positives = 840/1248 (67%), Gaps = 31/1248 (2%)

Query: 46   ELSDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVIN 105
            E +D I  P+   G E G +  D+G  LLY +  ++ P KTSER+LD+I + +      N
Sbjct: 14   EPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYR---N 70

Query: 106  SKENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPN 165
            S  N + + Y+   ++ +LK P++EYS+ +    P SIG ++DQ+V+++++EY+S TCP 
Sbjct: 71   S--NGHDILYS-ALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPG 126

Query: 166  HNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKEL 225
             NK+ VFMGVL+  +      +DL+   I H+K+TVKTR  LE TR+  G+ ++H++ EL
Sbjct: 127  LNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSEL 186

Query: 226  HPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRY 285
            HP D++DL   +++  +L+D A+YVS DTNKL+ IEIF PEF S E+   F+P+ I +R+
Sbjct: 187  HPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRF 245

Query: 286  LHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEW 345
              +  +  +   E +P+  EC +TL K+FKGPL R+S +D +K I++DN  L   + P W
Sbjct: 246  AEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAW 305

Query: 346  LVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMI 405
            L  ++ F +   +  E  +   EY+PPDLTDYV+N   RK+RE  TRKCLEL+F GKM +
Sbjct: 306  LTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAV 365

Query: 406  NXXXXXXXXXXXXXXRTFNLLQTSFSTSFF-KLLIQERGVGLPIENQSNYNID--YHFIN 462
                           R+F+L Q S+S SFF  LL + RGV     +     ID  YHFIN
Sbjct: 366  -ALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVM----DYGTQEIDKNYHFIN 420

Query: 463  LSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQES 522
            LS  ++YS++DII+ +E  +++DP+NIG Y+D+L FIAN KGSYQLI YC K D+VG+E+
Sbjct: 421  LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA 480

Query: 523  LETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSK 582
            L++A+  F +D S T LS++ D +++ IY+ E  +   SQ++  +L+N+L+++A  KKS+
Sbjct: 481  LDSALSLFGIDASDTDLSTVPDDLLLGIYRKE--SSQASQQKRSSLKNSLRLIAKAKKSQ 538

Query: 583  KLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIA 642
             L+F+  YEPY NT  AY++L           QTAY++KV D+PGLK+DCDRA+YTIA++
Sbjct: 539  ILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVS 598

Query: 643  RRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMV 702
            RRS+              E+Y+AD  +Y  AL+LLQVNENASD+ ILEVFQ+KW +E + 
Sbjct: 599  RRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVS 658

Query: 703  AFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLL 762
            + D         TKI   RNS LI+ +LETG+ID SCLPA NWPTGLNNIGNTCYLNSLL
Sbjct: 659  SPDQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLL 718

Query: 763  QYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLF 822
            QYYF ISPLR  I+ Y KT+ +   ++      RR+GGR  +  EVERS+QFVYQLRDLF
Sbjct: 719  QYYFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLF 778

Query: 823  SEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLL 882
            ++M+++ +R VTP KELAYLAFAPSN+EVEF   +G     ++     +     K    +
Sbjct: 779  TDMVHTENRYVTPTKELAYLAFAPSNIEVEF---EGTPSSGSVGEAEDEEEGAIKETTEV 835

Query: 883  VDFDSNIGANGRDEKLLVDLDSNISDKIKEEEV------KKINTLKPV-TSTRVAKISPD 935
            +D  S    N   +  ++D   + S+ I E+ V      KK +  + + TSTRVAKIS D
Sbjct: 836  IDLTSV--PNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSD 893

Query: 936  QLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLE 995
            QLENALEMGRQQDVTECIGNVL QLESAS P  LD D EQ DL+K  F  K +Q + PL 
Sbjct: 894  QLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLN 953

Query: 996  KSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSIL 1055
                 R KIERF+SLLVN+GDHPK++YDALD YF +++LQ+E+ G+V ++++I E P++L
Sbjct: 954  DPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVL 1012

Query: 1056 QIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMK 1115
            QIQIQRVYYDRE+F+PFKSIEPLPF + +YMDRY + ++  ++  + +A  +KKEL  +K
Sbjct: 1013 QIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLK 1072

Query: 1116 KRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDREL 1175
            ++Q+ LL +N  G+S K SL+ETKR L SDVL+NN I+ P K   I  I++ LL+ID EL
Sbjct: 1073 EKQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEEL 1132

Query: 1176 TTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYN 1235
             ++++ I  +E  +S+ F +F+   Y+LFAVFIHRGEASYGHYW YIKD  +N IWRKYN
Sbjct: 1133 ASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYN 1192

Query: 1236 DETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSDCA 1283
            DE++TE P+SEVFNF EGNTATPYFLVYVKN     IEPL R+ + CA
Sbjct: 1193 DESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCA 1240

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1176 bits (3041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1253 (49%), Positives = 836/1253 (66%), Gaps = 45/1253 (3%)

Query: 43   TDVELSDEIQVPVSVIGNEMGLNE----LDDGSKLLYQNLMNMSPLKTSERILDDILSNI 98
            T+ E+ +E   P    G E  LN+     D G  LLY +  N+ P KTSER+LDDI   +
Sbjct: 11   TEYEVGNEGSAP----GLESNLNDGQPIKDTGKTLLYADAGNLFPFKTSERLLDDIKLEL 66

Query: 99   PLMKVINSKENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEY 158
                 I      + + Y+E  +  +L+ P++EYS+ + T    +IG +VDQ+V+++++EY
Sbjct: 67   AYKNSIE-----HDILYSE-LHKGVLRLPILEYSR-KPTDDVYNIGHLVDQVVLKTRYEY 119

Query: 159  KSVTCPNHNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSK 218
             S TCP  NKI VFMGVL++S+Q     DD++   + H+K+TVKTR  LERTR+  G+ +
Sbjct: 120  DSKTCPGLNKITVFMGVLLNSSQMPKIYDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQ 179

Query: 219  FHLVKELHPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTP 278
            +HL+ ELHPFD++DLL  D    +LID  +YVS DTNKLI IEIF PEF SQ +   F P
Sbjct: 180  YHLLPELHPFDKEDLLLTDAEDPHLIDSVMYVSSDTNKLICIEIFKPEF-SQADLTEFCP 238

Query: 279  NVINQRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILR 338
            + I +RY  +  +  +   + IP+  EC +TL K+FKGPL R+   D +K I++DN  L 
Sbjct: 239  DAIKKRYSSACDKYPDLDPDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLN 298

Query: 339  LHMNPEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELI 398
              ++P+WL  K+ F +    D +      E++PPDLT+YV +   R++RES TRKCLELI
Sbjct: 299  SQLDPKWLTEKFAFKLCQANDTDEAGSAMEFQPPDLTNYVDDVSVRELRESYTRKCLELI 358

Query: 399  FFGKMMINXXXXXXXXXXXXXXRTFNLLQTSFSTSFF-KLLIQERGVGLPIENQSNYNID 457
            F GKM  +              R+F L QTS S SFF  LL + RGV     +  +  ID
Sbjct: 359  FLGKMS-SSLMTKEDIAKDSRARSFQLYQTSNSLSFFFHLLNETRGVM----DYGSQEID 413

Query: 458  --YHFINLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKL 515
              Y+F+NLS  Y+Y+++DII+ +E  + +D +NIG Y+D+L +IAN KGSY LIAYC K 
Sbjct: 414  RNYNFMNLSSCYYYTDKDIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCRKQ 473

Query: 516  DIVGQESLETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVL 575
            D+VG+E+L++A+  F +D S T+L ++ D +++ +Y+ E    S   ++H  L+NAL++L
Sbjct: 474  DVVGKEALDSALSLFGIDPSDTSLMTIPDELLLGVYRKECSQGS--TQKHATLKNALRLL 531

Query: 576  ASYKKSKKLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRA 635
            A  K S  L+F+  YEPY N   AY++L           QTAY+IKV D+PGLK+DCDRA
Sbjct: 532  AKAKNSSTLQFYAAYEPYDNVHQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRA 591

Query: 636  LYTIAIARRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKK 695
            +YT+A+ +RS+             +E+Y+AD  +Y  ALSLLQVNENASD+ ILEVFQ+K
Sbjct: 592  IYTLAVTKRSMPLFNFLVEQCPVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRK 651

Query: 696  WFEEAMVAFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNT 755
            W  E +++ D         TKI   RNS LI+ +LETG ID  CLPA NWPTGLNNIGNT
Sbjct: 652  WNHETVLSPDQFLKSSSALTKIGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNT 711

Query: 756  CYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFV 815
            CYLNSLLQYYF ISPLR  I++Y KT+ +  +++   G  RR+GGR  +  EVERSVQFV
Sbjct: 712  CYLNSLLQYYFCISPLRQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFV 771

Query: 816  YQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDS----EDGKSQRDNISTETVD 871
            YQLRDLF++MI++ SR VTP+KELAYLAFAPSN+EVEF+     E  K   +N   E +D
Sbjct: 772  YQLRDLFTDMIHTESRFVTPRKELAYLAFAPSNIEVEFEGTPTVEPAKENSEN-DVEVID 830

Query: 872  VGADGKNDNLLVDFDSNIGANGRDEKLLVDL--DSNISDKIKEEEVKKINTLKPVTSTRV 929
            + A+G+      D D    A    + +   L  D+ ++D I  E +        V+STRV
Sbjct: 831  LTAEGEASE---DVDMLKPAESETQVVTTQLNEDTVMNDVIATEPM--------VSSTRV 879

Query: 930  AKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQ 989
            AKIS DQLENALEMGRQQDVTECIGNVL QLESAS P++LD D EQ DL+K  F  K KQ
Sbjct: 880  AKISTDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQ 939

Query: 990  SIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSIT 1049
             + PL+     R KIERF+SLLVN+GDHPKN+YDALD YF D++LQ+E+ G+V++TL+I 
Sbjct: 940  DLAPLKDPSKIRTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTLAIK 998

Query: 1050 EFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKK 1109
            E P +LQIQIQRVYYDREKF+PFKSIEPLPF + +YMDRY +  + E+   + +A   K 
Sbjct: 999  ELPVVLQIQIQRVYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKN 1058

Query: 1110 ELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLL 1169
            EL ++K RQK LL +N  G+S K SL+ET+R L S VL+ N I++  K S +  IE+ LL
Sbjct: 1059 ELESLKLRQKALLEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLL 1118

Query: 1170 EIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNS 1229
            +ID EL+ +++ I  ++  +S+ F  F+ + Y+LFAVFIHRGEASYGHYW YIKD  +N 
Sbjct: 1119 KIDNELSEIYSRITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNG 1178

Query: 1230 IWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSDC 1282
            IWRKYNDET+TE P++EVFNF EGNTATPYFLVYVKN +  +I+PL R++++C
Sbjct: 1179 IWRKYNDETVTEAPENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVIANC 1231

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1266 (48%), Positives = 835/1266 (65%), Gaps = 54/1266 (4%)

Query: 34   DSNVSRDVGTDVELSDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDD 93
            DSN +RD   D+E S +   P   +         DDG  LLY +L N SP+KTS+R++DD
Sbjct: 26   DSNNTRDTDVDMESSLKSVSPTDQLP--------DDGKHLLYTDLKNGSPMKTSDRLIDD 77

Query: 94   ILSNIPLMKVINSKENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSI-GSIVDQIVI 152
            IL ++ L    N +  C     +EQ +  ILK   I YSK R  +   SI GS++DQ++ 
Sbjct: 78   ILCDLSL----NGQSQC---LLSEQ-SQGILKLLPIIYSKQRQQLQNVSILGSLLDQVLF 129

Query: 153  QSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRR 212
            Q+KFEY SV+CP HNK++VF+GVL++ +    + DD+    + H+K+TVKTR+ LE  ++
Sbjct: 130  QTKFEYSSVSCPQHNKLQVFLGVLLNVSSSFESTDDVVRSPLFHLKVTVKTRSQLELYKK 189

Query: 213  LMGLSKFHLVKELHPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEE 272
              G+S+F  V  LH +D++DL TFD     LID+AIYVS DTNKL+LIEIF+PEF++ EE
Sbjct: 190  HAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAIYVSSDTNKLVLIEIFHPEFNTSEE 249

Query: 273  RGLFTPNVINQRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINS 332
               FT + I +RY+ + +  +  + EDIP   +C+NTL+K FK P+ +   + P++ I +
Sbjct: 250  IESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLNTLYKTFKNPINKTDPSAPLQTIKA 309

Query: 333  DNPILRLHMNPEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTR 392
             NPIL  HMN  WL  +YGF ++  ++ +      EYEPP+ T Y+ + + RK++E   R
Sbjct: 310  SNPILNSHMNANWLTERYGFTLLPGENEDDE---DEYEPPNFTTYIMDPKVRKMKECYIR 366

Query: 393  KCLELIFFGKMMINXXXXXXXXXXXXXXRTFNLLQ----TSFSTSFFKLLIQERGVGLPI 448
            KCL+LIF+ K+MI               ++F  L      + S   ++L  + +   L  
Sbjct: 367  KCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSGIAVQNTSKPLYQLFGESKNAFLN- 425

Query: 449  ENQSNYNID--YHFINLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSY 506
             N  NY  D  YHFI LS SYHY++RDII  +E  S +D  NIG Y+D++QFIAN KGSY
Sbjct: 426  SNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYSVIDKGNIGIYFDAIQFIANRKGSY 485

Query: 507  QLIAYCSKLDIVGQESLETAIKTFNLDLSVTALSSLEDSVIMSIYQAE-LKNKSLSQERH 565
            QL+AYC K +IVG E+LE A++ F LD +   ++ L+ S+++S+Y+ E + N++ S   H
Sbjct: 486  QLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKLDISLLLSMYKHEQISNQNTS---H 542

Query: 566  V-NLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVND 624
            + +L+NAL+VLA +K ++ +KF+VD+EPY     AYN L           QTAYSIKVND
Sbjct: 543  LSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYNELEVDESVDDDIIQTAYSIKVND 602

Query: 625  APGLKLDCDRALYTIAIARRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENAS 684
            +PGLK++C RALYTIAI +RS++            Q++Y  + +SY  AL+++QVNENAS
Sbjct: 603  SPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQDFYGPEKYSYEQALAIIQVNENAS 662

Query: 685  DENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAEN 744
            DE IL++FQKKW +E +V +D          K+  ++NSKLIS+FL TG+IDPSCLP EN
Sbjct: 663  DEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEKNSKLISHFLTTGLIDPSCLPVEN 722

Query: 745  WPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTN 804
            WP GLNNIGNTCYLNSLLQYYFAI+PLR+ I +Y  T +  E       I RR+GGR   
Sbjct: 723  WPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESFEATDTDAKINRRIGGRQVC 782

Query: 805  TIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDN 864
              EVERS+QF YQLRDLF+ MI+S+SRCV+P +ELAYLAF+PSN+EVEFD+  G +    
Sbjct: 783  ASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAYLAFSPSNIEVEFDAGSGIASESG 842

Query: 865  ISTETVDVGADGKNDNLLVDFDSNIGANGR----DEKLLVDLDSNISDKIKEEEVKKINT 920
             +        D    ++ ++ D  +   G     D  LL  +++++        V ++  
Sbjct: 843  GTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQLDDTGLLAPVEADVP-------VDQMKL 895

Query: 921  LKPV--TSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDL 978
             K V  +ST+VAKI  DQLENALE+GRQQDVTECIGNVL QLESAS P+ LD+D EQ DL
Sbjct: 896  AKEVINSSTKVAKIGSDQLENALELGRQQDVTECIGNVLYQLESASDPIKLDEDNEQYDL 955

Query: 979  LKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEE 1038
            +K+ F  KT+Q I+PL  S   R+K ERFLSLLVN+ DHPK+IYDALD YF +E L +EE
Sbjct: 956  IKHLFYGKTRQDIVPLSNSTDVRSKYERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEE 1015

Query: 1039 YGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELI 1098
            YG+VR+T++ITEFP+ILQIQIQRVYYDRE+F+PFKSIEP+PF + LYMDRYA  D+  ++
Sbjct: 1016 YGDVRRTVAITEFPTILQIQIQRVYYDRERFMPFKSIEPIPFNSTLYMDRYAATDDPVML 1075

Query: 1099 DTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPM-- 1156
              + +   +K  L   K RQ+ELLSRN++GLSRKE+  ET ++L SD L+     VP   
Sbjct: 1076 TKRRETSELKTRLRECKVRQQELLSRNDMGLSRKEAYTETMKMLQSDFLEQ----VPSVR 1131

Query: 1157 ---KTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEA 1213
               +T+++S +   +  ID EL  L+  I  +E  I + F  FQ + Y+LFAVFIHRGEA
Sbjct: 1132 GEDQTAVVSGLSDMVASIDEELVQLYTEIGQLETQIDHQFDSFQKVGYSLFAVFIHRGEA 1191

Query: 1214 SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIE 1273
            SYGHYW Y+KDF+ + IWRKYNDET++EVP+ EVFNF EGN ATPYFLV VK  +  DIE
Sbjct: 1192 SYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNFTEGNNATPYFLVLVKQTHEQDIE 1251

Query: 1274 PLKRIV 1279
            PL RI+
Sbjct: 1252 PLHRII 1257

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1241 (49%), Positives = 823/1241 (66%), Gaps = 38/1241 (3%)

Query: 48   SDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSK 107
            SDE  V  S   +E  L   DDG +LLY  +    P KT +R++DDI+ ++     IN  
Sbjct: 17   SDEQSVS-STTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAF---INDS 72

Query: 108  ENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPD-SIGSIVDQIVIQSKFEYKSVTCPNH 166
            +  +  +        ILK   + YSK R  + P   +G+ +DQI +Q+K+EY+S++CP+H
Sbjct: 73   DLSSEFK-------GILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDH 125

Query: 167  NKIEVFMGVLIDST-QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKEL 225
            N+I VF GVLIDS  +   + D ++   I H+K+TVKTRT LE  ++ +G+S +HL+ EL
Sbjct: 126  NRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITEL 185

Query: 226  HPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRY 285
            HPFD++DLLTFD++  NLID A YVS DTNKLILIEIF PEF S+EE   F    I  RY
Sbjct: 186  HPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRY 245

Query: 286  LHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSN-DPIKRINSDNPILRLHMNPE 344
                 + +  +++ IP+ ++C  TLF+VFKGPL RKS++ DPIK IN+ N  L  HM+ +
Sbjct: 246  QLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSK 305

Query: 345  WLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMM 404
            WLVSKYGF     ++ E  D+  EYEPPDL D+ ++ + RK+R+S TRKCL+L F+GK+ 
Sbjct: 306  WLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLS 365

Query: 405  INXXXXXXXXXXXXXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNID--YHFIN 462
                            R FN + T  ST+    +  +    L  ++ S   +D  YHFIN
Sbjct: 366  NKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFIN 425

Query: 463  LSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQES 522
            LS SY+Y++RDIIQ +E +  +D +N G Y+D+L +IAN KGSYQLI+YC K D+VGQE 
Sbjct: 426  LSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEV 485

Query: 523  LETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSK 582
            L+ +++   LD +   + SL DS++ SIY+ E        +R   L++A++V+    +SK
Sbjct: 486  LQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSK 545

Query: 583  KLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIA 642
            KL+FF+D+EPY N   AYN+L           QTAY+I++ND+PGLK+DCD+ALYTIAI 
Sbjct: 546  KLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIR 605

Query: 643  RRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMV 702
             RSI+              YY  D  S+  ALSLLQVNENA+DE ++++FQ++W ++ + 
Sbjct: 606  TRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILN 665

Query: 703  AFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLL 762
             +D         TKIA ++NSKLIS FLETGVID + L  ENWP GLNNIGNTCYLNSLL
Sbjct: 666  EYDQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLL 725

Query: 763  QYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLF 822
            QYYF+I+PLR+ I+NY  ++ + E  +      RR+GGR  +  EVERS+QF+YQLRDLF
Sbjct: 726  QYYFSIAPLREYILNYKGSISNYE--IDETSNKRRIGGREVSENEVERSIQFMYQLRDLF 783

Query: 823  SEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLL 882
            ++MIYS SRC+TPK ELAYLAFAPSN+EVEF + +       +   TVD+  D + D  L
Sbjct: 784  NDMIYSKSRCITPKHELAYLAFAPSNIEVEFAASE-------VERTTVDLPFDKEGDIDL 836

Query: 883  VDF-DSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENAL 941
            VD  + N+      +++  D+     DK+              TST+ AKIS DQLENAL
Sbjct: 837  VDLSNDNLNTTNNAQEVTSDISVATEDKVMTN-----------TSTKTAKISSDQLENAL 885

Query: 942  EMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPR 1001
            EMGRQQDVTECIGNVL Q+ESAS P+ LD+D EQ DL+K  F  KTKQ I+PL      R
Sbjct: 886  EMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTR 945

Query: 1002 NKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQR 1061
             K E F SLLVNI DHP++IYDAL+  F  E L+M+EYG+V++T+SIT FP ILQIQIQR
Sbjct: 946  TKYEGFSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQR 1005

Query: 1062 VYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKEL 1121
            VYYDRE+F+PFKSIEPLPF N +YMDRYA LDN+ L   KN+ + ++ +L  +K RQ EL
Sbjct: 1006 VYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVEL 1065

Query: 1122 LSRNELGLSRKESLIETKRLLMSDV-LDNNGIDVPMKTSLISQIEANLLEIDRELTTLFN 1180
            L+RNELGLSRKES +ET   L  +  + + G+ V  +  +I ++   +  ID EL+ +++
Sbjct: 1066 LNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYD 1125

Query: 1181 NIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETIT 1240
             I  +E  I + F EF+ I Y+LFAVFIHRGEASYGHYW YIKD +++ IWRKYNDET+T
Sbjct: 1126 EINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVT 1185

Query: 1241 EVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSD 1281
            EV + EVFNF EGNTATPYFLV+VK+    DIEPLKRI++D
Sbjct: 1186 EVNEEEVFNFTEGNTATPYFLVFVKDYYKGDIEPLKRIIAD 1226

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1263 (47%), Positives = 816/1263 (64%), Gaps = 71/1263 (5%)

Query: 55   VSVIGNEM------GLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKE 108
            V ++GN +      G+ E   G  +LY  +    P KTS+R+LDDI S +  +       
Sbjct: 11   VRLVGNGVVECESAGVRE--GGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV------- 61

Query: 109  NCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCP---- 164
                +R      N +LK PM++YSK R  +   SIG ++DQ+++Q+ +EY S+       
Sbjct: 62   -LEGVR-----GNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGG 115

Query: 165  --NHNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLV 222
               H+KI VFMG+L D   K  + DD+ N    H+++TVKTR  LER +R  G++++HLV
Sbjct: 116  GDKHSKINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLV 175

Query: 223  KELHPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVIN 282
             +LHP D++DL  F+ +   +ID A YVS  TN+L+ IEI  PEF + EE   FTP+ I 
Sbjct: 176  NDLHPADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIR 234

Query: 283  QRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMN 342
            +RYL    +  + + E++P   EC+NTLFKVFK PL+R+ S+D +K I+++N +L   ++
Sbjct: 235  KRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLD 294

Query: 343  PEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGK 402
            P WLV K+GF +  E   E G +  EY+PPD T+YV++   R +RE   RK LEL+F GK
Sbjct: 295  PNWLVDKFGFELC-EVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGK 353

Query: 403  MMINXXXXXXXXXXXXXXRTFNLLQTSFSTSF-FKLLIQERGVGLPIENQSNYNIDYHFI 461
              I               R+F L QT FS +F F+LL +        + Q  Y+ + HFI
Sbjct: 354  QSIRLLPKEVVAASSKL-RSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFI 412

Query: 462  NLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQE 521
            NLSV+Y+Y +RDII+ +E    +DP N G YYD L FIAN KGS+QL+ +  K +IVGQE
Sbjct: 413  NLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQE 472

Query: 522  SLETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKS 581
            +L +A++ F++D S T    + D +++S Y+ E K  +  Q  H +LRNAL++LA YK+S
Sbjct: 473  ALNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQ--HADLRNALRLLAKYKQS 530

Query: 582  KKLKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAI 641
            +KLKF+V+ EP+     AY++L           +TAY+IKV+DAPGLK+DCDRALYT+AI
Sbjct: 531  EKLKFYVELEPFQQESQAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAI 590

Query: 642  ARRSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAM 701
            A+RS+             Q++Y    +SYTSAL  LQVN NA+D+ ILE+F++KW EE +
Sbjct: 591  AKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPV 650

Query: 702  VAFDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSL 761
            ++ D          KIA +RNSKLI++FLETG+ID + L + NWPTGLNNIGNTCYLNSL
Sbjct: 651  ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710

Query: 762  LQYYFAISPLRDEIINYTKTVDDIENNLQLQG--ITRRVGGRVTNTIEVERSVQFVYQLR 819
            LQYYF ISPLRD I NY  T  D+  N+   G    RR+GGR  N  EVERSVQFVYQLR
Sbjct: 711  LQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLR 770

Query: 820  DLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRD----------NISTET 869
            DLF++M +S  RCVTP +ELAYL+F+PS   VEF+S      RD          N  TE 
Sbjct: 771  DLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEV 830

Query: 870  VDVGADGKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDK-------IKEEEVKKINTL- 921
             D+  +G          SN+      E ++ D + +  D+             +K N++ 
Sbjct: 831  FDISIEG----------SNVETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMS 880

Query: 922  ------KPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQ 975
                  +P+TST VAKISPDQLEN LE+GRQQDVTECIGNVL Q+ESAS+PL+ D+  EQ
Sbjct: 881  NIVEENEPITSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQ 940

Query: 976  NDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQ 1035
             DL+K  F  K KQ +IP+E  +  R K ERF+SLLVN+GDHPK+IYDALDLYF D+LL 
Sbjct: 941  YDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLA 1000

Query: 1036 M-EEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDN 1094
            + ++   VR+++++ E P+ILQIQIQRVYYDREK +PFKS EPLPFG  LYMDRY     
Sbjct: 1001 LGDDNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTE 1060

Query: 1095 KELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVL-DNNGID 1153
             EL+  K ++  + + L  +K+R+K++LS+N+ GL+ K+SL ETK  L S VL ++ G  
Sbjct: 1061 SELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKI 1120

Query: 1154 VPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEA 1213
               K +LI Q+++  LEID+EL+ L + I+DME +IS+ F +F +  YNLFAVFIHRGEA
Sbjct: 1121 RIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEA 1180

Query: 1214 SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIE 1273
            SYGHYW YIKD + + IWRKYNDE++TEVP+SEVF+F E NTATPYFLVY+K+ +  +IE
Sbjct: 1181 SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIE 1240

Query: 1274 PLK 1276
            PLK
Sbjct: 1241 PLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1225 (46%), Positives = 780/1225 (63%), Gaps = 58/1225 (4%)

Query: 67   LDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQ 126
            +DDG  LLY ++    P KT +RILDDI  +   +K               +F +S++KQ
Sbjct: 38   VDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLK---------------KFGSSVMKQ 82

Query: 127  PMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANTL 186
            PM++YS+ R  + P ++  ++DQ+ ++S+++Y S+TCP  N I V   +L+D     N  
Sbjct: 83   PMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTPNDF 142

Query: 187  DDLSNI--IINHVKITVKTRTVLERTRRLMGLSKFHLVK--ELHPFDQKDLLTFDKNAAN 242
            DD+        H+KITVK R+ LE   R +G++ +H+++   LHPFD++D+   ++    
Sbjct: 143  DDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCR 202

Query: 243  LIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPT 302
            L+D +I+VS DTNKLIL+EI  PEF+S E    +    I +RY ++  E +  + +DIP+
Sbjct: 203  LVDQSIFVSADTNKLILVEIIKPEFNS-ENLAEYRTAKIEERYKNACQEFDLLNPDDIPS 261

Query: 303  GIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNM---VLEKD 359
              EC+ TLF +FK PL RKS+N   K I+ D+  L   +N +WL + + F++    +E +
Sbjct: 262  QAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDN 321

Query: 360  VETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXX 419
            V++G+E   Y+PPDL DY+++ + R IRE+ TRK +E++  GK  +              
Sbjct: 322  VQSGEE---YKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTEKKTVA 378

Query: 420  XRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFE 479
                N   ++  T +F +L  +     P      Y+I+YHFINLSV++ Y ++DII+ +E
Sbjct: 379  KCFSNQHFSASHTWWFNILNHQHIEPFP------YDINYHFINLSVAFKYIDKDIIKNYE 432

Query: 480  VISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTAL 539
                +D +NI HY+D+LQ++ NAKGSYQLIAYC K D+VG E L  A++ F LD +    
Sbjct: 433  TQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDA 492

Query: 540  SSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTA 599
            S L+ + ++  Y + L   S +Q +  +LRNAL+VL  Y  S+K+ F V+YEPY N + A
Sbjct: 493  SLLDANTMIEYYNSHLLRSSDNQRK--DLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQA 550

Query: 600  YNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXX 659
            Y +L           QTAY+I + DAPGLK D DRA++TIA+ RRSI             
Sbjct: 551  YTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEF 610

Query: 660  QEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAF 719
             +YY     SY  AL++++++ NASD+ ILEVFQKKW    M   D+          I F
Sbjct: 611  AQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGF 670

Query: 720  QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY- 778
             RNSKLI++FL+TG++D SCLP   WP G+NN+GNTCYLNSLLQ++F I PLRD I+NY 
Sbjct: 671  TRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYD 730

Query: 779  ---TKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTP 835
                K +D  E + +     RR+GGR  +  E  RSVQFVY LRDLF++MI+++SRCVTP
Sbjct: 731  DDSAKLLDASEYHSR-----RRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTP 785

Query: 836  KKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRD 895
             KEL YLAFAPSNVEVEF  +D  +Q++ I   T DV  D  +    +       A+  D
Sbjct: 786  TKELVYLAFAPSNVEVEF-GDDTVAQKELIDL-TTDVVEDPTDTTRHL-------ASCDD 836

Query: 896  EKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVTECIGN 955
            + ++      + +     E           S +VAKIS DQLEN LE+GRQQDVTECIGN
Sbjct: 837  DIIMCQSPVALPEHKTSSEAGTQQY-----SVQVAKISADQLENTLEIGRQQDVTECIGN 891

Query: 956  VLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIG 1015
            VL QLE AS PLSL+DD EQNDL+K  F  + KQ +IP+      R K ERFLSLLVN G
Sbjct: 892  VLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTG 951

Query: 1016 DHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSI 1075
            DHPK+IYDALD YF ++ L +EEYG+V++T+SI+E P++LQIQIQRVYYDREKF+PFKSI
Sbjct: 952  DHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSI 1011

Query: 1076 EPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESL 1135
            EPLPFG  LYMDRY   ++ +L+    +   +K++L ++K+RQ++LLS+NE+GL+ K SL
Sbjct: 1012 EPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSL 1071

Query: 1136 IETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKE 1195
            IETK+ L S  L  + ID     S I+ I+  +  ID EL +LFN I D+E  IS  F E
Sbjct: 1072 IETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSE 1131

Query: 1196 FQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNT 1255
            F+ I Y+LFAVFIHRGEASYGHYW YIKD  +N IWRKYND+++TEVP SEVFNF EGNT
Sbjct: 1132 FKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNT 1191

Query: 1256 ATPYFLVYVK-NENIDDIEPLKRIV 1279
            ATPYFLVYV+  +  + IEPLKRI+
Sbjct: 1192 ATPYFLVYVREGQEQETIEPLKRIL 1216

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1053 bits (2724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1251 (46%), Positives = 822/1251 (65%), Gaps = 64/1251 (5%)

Query: 68   DDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQP 127
            DDG +LLY N+    PLKTS+R+LDDIL ++  +   +              N SIL   
Sbjct: 39   DDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGD--------------NKSILNSN 84

Query: 128  MIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLI--DSTQKA-- 183
             +EYSK R  +   ++G   DQ++IQ+K+EY S +CP HNKI V MG+LI  D  +KA  
Sbjct: 85   TLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEK 144

Query: 184  NTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANL 243
              + +++ I I HVKI+VK R++LE +++L+G+S+++ + +LH +D+ D  ++D   + L
Sbjct: 145  KQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKL 204

Query: 244  IDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTG 303
            +D A+Y ++DTNK++LIEI+ PEFD +++    +   I  R+  +  +  + + E+ PT 
Sbjct: 205  LDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQ 264

Query: 304  IECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVETG 363
            ++ INTLFK+FKGPL RKS + P K I +++P+L  +MNP  LV+ +GF    E ++  G
Sbjct: 265  LDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNE-NIPGG 323

Query: 364  DEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINX--XXXXXXXXXXXXXR 421
                EY  PDL +Y+ +   +K+R++ TRKCLELI +G ++I+                R
Sbjct: 324  ----EYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYR 379

Query: 422  TFNLLQTSFST-SFFKLL--IQERGVGLPIENQ---------------SNYNIDYHFINL 463
                +Q  FS  S+ +LL   + R + L   N+               S ++ID +F NL
Sbjct: 380  ILRTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNL 439

Query: 464  SVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESL 523
            SV  HY+ERDIIQ +E +  +D  NIG Y+DSL  +AN KGSYQL++YC K D++GQE+L
Sbjct: 440  SVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEAL 499

Query: 524  ETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKK 583
            + ++  F +D +   L SL++++++S+Y+ E K ++    R  +L+NAL++LA Y  S  
Sbjct: 500  QNSLAVFGIDYTKVTLESLDENLLLSVYKHEWK-ENPDNNRISDLKNALRLLAKYFTSDY 558

Query: 584  LKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIAR 643
            LKF+VDYEPY   + AY++L           QTAY+IK+NDAPGLK+DCDRALYTIA +R
Sbjct: 559  LKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSR 618

Query: 644  RSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVA 703
            RS+             Q YY A +  Y  +  +LQ+NEN ++ N+L VFQ+KW    +  
Sbjct: 619  RSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEE 678

Query: 704  FDHXXXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQ 763
             D         TKIA +RNS L+ NFLETG I+P+ LPAENWPTG+NNIGNTCYLNSLLQ
Sbjct: 679  PDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQ 738

Query: 764  YYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFS 823
            +YFAISPLR+ I+ Y KT+ D+ +N       RR+GGR     E+ERSVQF+YQLRDL++
Sbjct: 739  FYFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYN 798

Query: 824  EMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNI-----STETVDVGADGKN 878
            +MI+S  RCVTPK+ELAYLAFAPS+++VEF++   KS   NI     +T++  + + G+N
Sbjct: 799  DMIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPSTGEN 858

Query: 879  DNLLVDFDSNIGANGRDEKLLV--------DLDSNISD--KIKEEEVKKINTLKPVTSTR 928
                +D + +I    R+ + +         DL SN  D   +  ++  + N     T+ +
Sbjct: 859  ----IDHNMDIEQEERNNEEINSTNNIESNDLVSNNHDIEMLDTDKENEGNMEIEDTAIK 914

Query: 929  VAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTK 988
            VAKI P+QLENALE+GRQQDVTECIGNVL QLES+S P SL +D EQNDL+K  F  +T 
Sbjct: 915  VAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGETN 974

Query: 989  QSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSI 1048
            Q I PL+     R K+ERF+SLLVNI DHPK++YDALDLYF +E L MEEYGEV++ L+I
Sbjct: 975  QHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVKRELAI 1034

Query: 1049 TEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMK 1108
             +FP+ILQIQIQRVYYDRE+F+P+KSIEPLPF + +Y+DRYA+ D+ +L+  + +   +K
Sbjct: 1035 KKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREETAELK 1094

Query: 1109 KELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANL 1168
            ++L + K+RQKELLSRNELGLSR+++  ET   L S+VL N  I +     L +++E + 
Sbjct: 1095 RQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLLATKLEESA 1154

Query: 1169 LEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQN 1228
             ++  EL+ L+  I ++E  I++ F +F    Y LFAVFIHRGEASYGHYW YIKDF  N
Sbjct: 1155 SKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDF-VN 1213

Query: 1229 SIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279
            SIWRKYNDET+TEVP+ EV NF EGNTATPYF+V+VK  +  DIEPLKR++
Sbjct: 1214 SIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMI 1264

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/794 (44%), Positives = 493/794 (62%), Gaps = 27/794 (3%)

Query: 64  LNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSI 123
           L + DDG  +LY NL    P+KTS+R+LDD+   + L     S+E              +
Sbjct: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL-----SEEG-----------REV 60

Query: 124 LKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKA 183
           L+ PM+EY++ RA     S+G ++DQ+V+Q+ FEY S TC   N++ VFMGVL D  Q+ 
Sbjct: 61  LRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCA-QNRVHVFMGVLCDPGQRF 119

Query: 184 NTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANL 243
            + D+L N  I H+++TVK R  LER R+  G++++HLV ELHP+D+ D   F+     +
Sbjct: 120 ASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAV 179

Query: 244 IDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTG 303
           +D A YV+  TN+L+ IE+  PEF   +E   FT   I  RYL       +    DIP+ 
Sbjct: 180 VDSATYVASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQ 238

Query: 304 IECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMV-LEKDVET 362
            EC+NTLFKVFK PL+R+ + D +K I++DN +L   +   WLV+K+GF +  +E+D   
Sbjct: 239 AECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEED--- 295

Query: 363 GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXXXXXXXXXXXXRT 422
           G +  EY+PPD T++V N + R+ RES  RK LELIF GK  +               R+
Sbjct: 296 GQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKL-RS 354

Query: 423 FNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEVIS 482
           F L QT FS SF+  L+ E       +    Y+ +YHF++LS +Y+YS+RDII+ +E   
Sbjct: 355 FQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQI 414

Query: 483 KVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALSSL 542
            +DP N   YYD L F+AN+KGS QL+ Y  K ++VG E+L +A++ F+LD S T    L
Sbjct: 415 ALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQL 474

Query: 543 EDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAYNM 602
            D  ++  Y+   K+     ++H +LRNAL++LA YK+S KLKF+V+ EP+ N   AY +
Sbjct: 475 SDEFLLESYKEVCKDSG--PQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKL 532

Query: 603 LXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISXXXXXXXXXXXXQEY 662
           L           +TAYSIKV+DAPGLK+DC RALYT+A+A+RSI              ++
Sbjct: 533 LEIDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQF 592

Query: 663 YTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHXXXXXXXXTKIAFQRN 722
           Y     SY SAL  L VN NA+D+ ILE+FQ+KW  + +V+ +         TKI F+RN
Sbjct: 593 YHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERN 652

Query: 723 SKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTV 782
           SKLI++FLETG++D + LPA NWPTG+NNIGNTCYLNSLLQYYF ISPLR+ I+ Y  T 
Sbjct: 653 SKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTA 712

Query: 783 DDIENNLQLQG--ITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA 840
            ++ NN         RR+GGR  +  EVERSVQFVYQLR LF EM++S  R VTP +EL 
Sbjct: 713 SNLLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELV 772

Query: 841 YLAFAPSNVEVEFD 854
           YL+F+PS+ EVEF+
Sbjct: 773 YLSFSPSSTEVEFE 786

 Score =  382 bits (982), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/360 (56%), Positives = 263/360 (73%), Gaps = 2/360 (0%)

Query: 923  PVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNC 982
            P TST VAKIS DQLEN LE+GRQQDVTECIGNVL Q+ESAS+PLSLD++ EQ DL+K  
Sbjct: 1030 PETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQL 1089

Query: 983  FLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFN-DELLQMEEYGE 1041
            F  K KQ +IPLE     R KIERF+SLLVNIGDHPK+IYDALD YF  D L   E+ G+
Sbjct: 1090 FYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGK 1149

Query: 1042 VRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTK 1101
            VR+++++ E P +LQIQIQRVYYDREKF+PFKS EPLPFG  LYMDRY   DN EL   K
Sbjct: 1150 VRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKK 1209

Query: 1102 NKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMK-TSL 1160
             +A  +++EL  +++R++ LL++N+ G++   +L +T+R L +  L +    +  +  + 
Sbjct: 1210 QQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHAT 1269

Query: 1161 ISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWT 1220
             S ++A  + +D EL  L  +I  ++  I++ F  F S  Y+L AVFIHRGEASYGHYW 
Sbjct: 1270 TSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWV 1329

Query: 1221 YIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVS 1280
            YIKD Q   IWRKYNDE++TEVP+SEVF+F E NTATPYFLVYVK  +  DIEPLKR+++
Sbjct: 1330 YIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLLA 1389

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1197 (35%), Positives = 639/1197 (53%), Gaps = 128/1197 (10%)

Query: 119  FNNSILKQPMIEYSKLRATVHPDSIGSIVDQI-VIQSKFEYKSVTCPNHNKIEVFMGVLI 177
             N  IL+ P  +YSK R++     I ++ ++  +I  +FEY+S T    NKI  F  +L 
Sbjct: 135  LNKGILRLPTTDYSKFRSSFSEYKIINLSNKNNLINYRFEYESKTNHQDNKILEFFSIL- 193

Query: 178  DSTQKANTLDD------LSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQK 231
               + A+ LD        S     H+K+++KTR  LE +++   +  F+++ E +  D+ 
Sbjct: 194  HKPKDASNLDYESMAKFWSQNEFYHLKVSIKTRNQLELSKKHTPIQHFYVIDEFNEEDKL 253

Query: 232  DLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTP-NVIN--QRYLHS 288
            D + F+ +  NL+D+AI++S +TNK++L+EIF  EF+  ++  +     V+N  ++Y +S
Sbjct: 254  DFINFNPDNPNLLDYAIFISSNTNKVVLVEIFKSEFNLNDKLIILDDLQVLNNYEKYKNS 313

Query: 289  LAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVS 348
              + + P+  D+   +  +   F   +      SS D IK    D+  +++ +NP WL  
Sbjct: 314  NHKLKLPTQTDV---LLVLMYCFNKQQNFDNIHSSEDEIKL--KDSKAIKISLNPSWLTE 368

Query: 349  KYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQ---QTRKIRESVTRKCLELIFFGKMMI 405
            ++              +F E E     +  +N    +  K R  V  +CL  +F      
Sbjct: 369  RFSL------------KFQEDESLIFMNLRNNLNLIKKEKRRFDVFTRCLLELFVLIKSA 416

Query: 406  NXXXXXXXXXXXXXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSV 465
                           +  + +  + S SF+  ++ E    L   N + Y+    FINLS+
Sbjct: 417  PQKLVKCNSKDTNIIKVVDTISINSSLSFWSQILGEYKSILSQNNFNQYSKHAEFINLSI 476

Query: 466  SYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIA-YCSKLDIVGQESLE 524
               Y+E +I++ +E+++ ++PD IG Y+DSL+F++     Y+ +A Y +K +I+G E   
Sbjct: 477  LPTYTESEIVKNYEILTILNPDKIGVYFDSLKFVSQCLTQYENLADYVNKNEIIGNEEFN 536

Query: 525  TAIKTFNLD-LSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKK 583
             ++K F +D L  T  S   DSV+   Y    ++K+     H  LRN+++ L+  K S  
Sbjct: 537  QSLKIFKMDKLEFTNCS---DSVLWEKYLTYYEDKNFDY-NHAILRNSIKSLSIVKNSPI 592

Query: 584  LKFFVDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIAR 643
            LKF   YEPY N   A+  L             +Y+ K+ND    K   D+AL TIAI R
Sbjct: 593  LKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVSYTTKINDMKDKKQHLDKALLTIAIDR 652

Query: 644  RSISXXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMV- 702
            + +S               Y +    Y +AL  +  +E  SD  ++  F+K+W+   +  
Sbjct: 653  KDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAIDSSELNSDNELILSFKKRWYRIDVNN 712

Query: 703  -AFDHXXXXXXXXTK----IAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCY 757
              F           K    I+  RNS L++N++E G+++P  LP+++WP GLNNIGNTCY
Sbjct: 713  DTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCY 772

Query: 758  LNSLLQYYFAISPLRDEIINYTKTVDDIE-NNLQLQGI-TRRVGGRVTNTIEVERSVQFV 815
            LNSLLQYYFAISPLR+ +IN+    +DIE +  +++ +  RRVGGR  +  E  RS+QFV
Sbjct: 773  LNSLLQYYFAISPLREYLINF----NDIELDGREMKNLEKRRVGGRNLSIAEFHRSIQFV 828

Query: 816  YQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGAD 875
            YQLRDL+ EM++S SR V+P+ +LAYLAFAPS+  +EF        RD I        A 
Sbjct: 829  YQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPIEF--------RDGIQ------NAI 874

Query: 876  GKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKE---------------EEVKKINT 920
            GKND     + S+    G +   +  L+SN++                    + +  I T
Sbjct: 875  GKND-----YYSDKTNGGSESSSIKGLNSNLNSDSDADSSLDSDSESSLLTFDNLPIIKT 929

Query: 921  LKPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLK 980
                  T + KIS  QLE  LEMG QQDVTECI NVL Q+E+AS P+S+D+D EQ DL+K
Sbjct: 930  STTNLPTLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEAASNPISIDEDNEQVDLVK 989

Query: 981  NCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYG 1040
              F  KT+Q I P  +      K ERFLSLLV++ D P++IYDALD YF DE+  MEEYG
Sbjct: 990  QLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDMEEYG 1049

Query: 1041 EVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDT 1100
            +V+K+L+I+ FP+ILQ+QIQRVYYD EK +PFK +EPL F   LY+DRYA   +++L + 
Sbjct: 1050 KVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDIDEKLAEK 1109

Query: 1101 KNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSL 1160
            K +   +KK L  +   +KEL  +N+                                  
Sbjct: 1110 KIEVASLKKRLKGLITIKKELEKKND---------------------------------- 1135

Query: 1161 ISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWT 1220
                       + E+ T+   I D+E  I   F EF    Y+LFAVFIHRG+A++GHYW 
Sbjct: 1136 -----------NVEIRTISKEINDVETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHYWI 1184

Query: 1221 YIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKR 1277
            YIKDF+ +  WRKYND  +TE+   EVFNF EGN++TPYFLVY+KN +  D+EPLKR
Sbjct: 1185 YIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1235 (33%), Positives = 644/1235 (52%), Gaps = 101/1235 (8%)

Query: 67   LDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILKQ 126
            +DDG  LLYQN+      KTS+RILDDIL++I  M + + K +      +  F + +L  
Sbjct: 68   IDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSD------DIDFKDGVLNL 121

Query: 127  PMIEYSKLRATVHPDSIGSI-VDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANT 185
            P I+YS  R  + P  I     +  V+  K ++KSVT P +N I    G+L+    + + 
Sbjct: 122  PTIKYSLWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRSE 181

Query: 186  LDDLSNII----INHVKITVKTRTVLERTRRLMGLSKFHLVKE---LHPFDQKDLLTFDK 238
            L+     I    +  ++ITVKTR  LE  ++ + L+ + L+ +   LH  D+ D   F+K
Sbjct: 182  LNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNK 241

Query: 239  NAANLIDHAIYVSEDTNKLILIEIFNPEFDSQE-ERGLFTPNVINQR-YLHSLAEGEEPS 296
            ++ +L+D +IY+S DTNK+ILIEIF P F+  E +  L + +V+N+   L +L E  +P 
Sbjct: 242  DSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPD 301

Query: 297  TED--IPTGIECINTLFKV----FKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKY 350
              D  +   I+ I  L        KG   R+        + SD+  L  +++ +WL   +
Sbjct: 302  YNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENF 361

Query: 351  GFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINXXXX 410
                V E+  +     T  E   L+    N + +   + +TR  +EL++ GK++ +    
Sbjct: 362  DIK-VKEQKRKDHVSITLDEALKLSFDDPNPKNQAKFDKITRYAMELMYLGKVLQSFYSN 420

Query: 411  XXXXXXXXXXRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYS 470
                        F  ++   +TSF+  ++ E       +  S   +D HFINL +  + S
Sbjct: 421  EEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHFINLCIDSNVS 480

Query: 471  ERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLI-AYCSKLDIVGQESLETAIKT 529
            E+DII  +E+  + DPDN   Y++SL++++     Y ++  YC +  I+ + +   A++ 
Sbjct: 481  EKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEI 540

Query: 530  FNLDLSVTALSSLED-SVIMSIYQAELK-NKSLSQERHVNLRNALQVLASYKKSKKLKFF 587
            F    S    +++E  S I   Y   ++ N +   +  V+L ++   LA+ KKS  L + 
Sbjct: 541  FKY--SEEYFNAIEHVSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYI 598

Query: 588  VDYEPYLNTRTAYNMLXXXXXXXXXXXQTAYSIKVNDAPGLKLDCDRALYTIAIARRSIS 647
              YEP+ +  TAY  L             AY++++ + P  K+  DRAL+ IAI R  +S
Sbjct: 599  TKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLS 658

Query: 648  XXXXXXXXXXXXQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHX 707
                         E  +    +   A  ++ + + +S+ +I+  F K W E       + 
Sbjct: 659  LLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNF 718

Query: 708  XXXXXXXTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFA 767
                    +++  R S L+ +F E G ++P  + +E WPTG+NNIGNTCYLNSLLQYYF+
Sbjct: 719  ILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFS 778

Query: 768  ISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIY 827
            I+  R+ I NY     D+ N+   +   RRVGGR     E+ RSVQF+YQ++DLF  M++
Sbjct: 779  ITLFREFIENYQSIESDLLNS-NAEMSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVH 837

Query: 828  SHSRCVTPKKELAYLAFAPSNVEVEF--DSEDGKSQRDNISTETVDVGADGKNDNLLVDF 885
            + SR VTP  +LAYLAFAP+N E++F   SE   S+   ++T          + ++ +  
Sbjct: 838  TKSRKVTPSNQLAYLAFAPNNAEIKFKHKSELESSEEHQLTT----------SHSIALSS 887

Query: 886  DSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENALEMGR 945
             ++I  +  D +     D +IS          +N+    ++  VA ++ D LE  LE+G 
Sbjct: 888  ATSISHSDIDTQ-----DHDIS----------LNS-TSYSNRLVAMVTRDDLETTLEIGN 931

Query: 946  QQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIE 1005
            QQDVTECI  VL Q+E+ S+PL LD D EQ DL+K  F  +T Q I P++K      K E
Sbjct: 932  QQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGETIQEICPIKKFIKGHEKRE 991

Query: 1006 RFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYD 1065
             + SLLVNI D P ++Y+ LD YF DE + MEEYGEV+KTLSIT+ P+IL IQIQRVYYD
Sbjct: 992  LYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITKLPTILNIQIQRVYYD 1051

Query: 1066 REKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRN 1125
            +EK +P+K    LPF N +++DRY + + KE  D   KAR+  K LA +K R+       
Sbjct: 1052 KEKLVPYKCGTALPFKNEIFLDRYIKGNKKE-NDVLEKARLELK-LAKVKYRE------- 1102

Query: 1126 ELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDM 1185
                                              L+S+  +    I   + T ++ I ++
Sbjct: 1103 ----------------------------------LVSEYNSVNKSISDRIITTYDRIEEL 1128

Query: 1186 ELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDS 1245
               I     +   I+Y+LFAVFIHRG+AS+GHYW YI+DF +N IWRKYND  +T   + 
Sbjct: 1129 NAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIRDF-ENGIWRKYNDHQVTGAHED 1187

Query: 1246 EVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVS 1280
            E+F  ++G+ +TPYFL YV +     ++PL R V+
Sbjct: 1188 EIFKCVDGDISTPYFLAYVDSSKKSIVKPLVRDVT 1222

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 26/33 (78%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P GL N+GNTCY+NS LQ  + I PLRDE++NY
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNY 91

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY ++I+D    + W ++ND+ ++ +   ++ +   G  +
Sbjct: 377  SCVYNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGES 436

Query: 1257 -TPYFLVY 1263
             +   L+Y
Sbjct: 437  DSALILIY 444

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 51/113 (45%), Gaps = 26/113 (23%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNT 805
           P GL N+GNTCY+NS LQ  + I PLR+EI+N+    ++            R G      
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN------------RSG------ 146

Query: 806 IEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA-----YLAFAPSNVEVEF 853
              E+ +Q V +L+  F ++        TP   LA     Y  FA  + E  F
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGF 196

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY ++I+D    + W ++ND+ ++ +   ++ +   G  +
Sbjct: 423  SCVYNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGES 482

Query: 1257 -TPYFLVY 1263
             +   L+Y
Sbjct: 483  DSALILIY 490

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKT 781
           P GL N+GNTCYLN+ LQ  F I PLR+ I+NY ++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPY 1259
            YNL  +  H+G  S  GHY  +I+D +   IW K+ND+ +T V   ++     G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1260 FLVYVKN 1266
             ++  K 
Sbjct: 494  LILLYKG 500

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%)

Query: 727 SNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           S F+E    +     A + P G  N+GNTCYLN+ LQ  + I PLRD I++Y
Sbjct: 89  SQFIEDLAPEQQFQHANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA-TP 1258
            Y L  V  H+G  S  GHY ++I+D      W  +ND+ ++ VP  ++     G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1259 YFLVY 1263
              L+Y
Sbjct: 485  LILIY 489

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 5/56 (8%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKT-----VDDIENNLQLQGITR 796
           P GL N+GNTCY+N+ LQ  + I+PLR+ I+N+ K       DD  + L +Q + R
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFPADDESHFLLVQELKR 158

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  Y+L  V  H+G  S  GHY  +I+D    + W K+ND+ ++ +   ++ +   G  +
Sbjct: 420  SCVYDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGES 479

Query: 1257 -TPYFLVY 1263
             +   LVY
Sbjct: 480  DSALILVY 487

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%)

Query: 727 SNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIE 786
           + FLE        +  +  P GL N+GNTCY N+ LQ  + I PLR++++ Y +   D+ 
Sbjct: 86  TKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLH 145

Query: 787 NNLQLQ 792
             L +Q
Sbjct: 146 GQLVIQ 151

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA-TP 1258
            YNL  V  H+G  S  GHY  +++D    + W KYND+ +  V   +V     G  + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1259 YFLVY 1263
              L+Y
Sbjct: 475  LILIY 479

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN +     LNIS++F +  S KY L ++ +H GE+   GHY T  K   ++  W  Y+
Sbjct: 563  LFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCK--HKSYGWLIYD 620

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  V D  V   +  E  +AT Y L Y
Sbjct: 621  DETVQAVSDELVSRILNNEQRSATAYLLFY 650

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEII 776
           G  N G TCY NS+LQ  F I   RD II
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGII 135

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 727 SNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           S+F+E    D       + P G  N+GNTCY+NS LQ  F +  L+D I+NY
Sbjct: 89  SSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNY 140

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  Y+L  +  H+G  S  GHY ++I+D      W K+ND+ ++E    ++     G  +
Sbjct: 433  SCVYDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGES 492

Query: 1257 -TPYFLVY 1263
             +   L+Y
Sbjct: 493  DSALILIY 500

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%)

Query: 724 KLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           K  ++F+E    D      ++ P GL N+GNTCY+N+ LQ  F +  +RD I+NY
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPY 1259
            YNL  +  H+G  S  GHY  +I+D    + W K+ND+ ++ V   ++     G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1260 FLVYVKN 1266
             ++  K 
Sbjct: 484  LILMYKG 490

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN IR  + L++S+ F    S +Y L  V IH G    +GHY    K+  +   W  Y+
Sbjct: 580  LFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKN--EKFGWLLYD 637

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  V +  V  F    G+  T Y L Y
Sbjct: 638  DETVESVSEETVLKFTGHSGDQTTAYVLFY 667

 Score = 35.8 bits (81), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTV 782
           G  N GNTCY NS+LQ  + I   R  ++ Y + +
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERI 171

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P G  N+GNTCYLNS LQ  + I PLR+ I++Y
Sbjct: 107 PIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPY 1259
            Y L  V  H+G  S  GHY ++I+D      W K+ND+ ++ V D E    + G   +  
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVS-VVDKEKIESLSGGGESDS 489

Query: 1260 FLVYV 1264
             L+ +
Sbjct: 490  ALILI 494

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P G+ N+GNTCY+N+ LQ  F I PLR++++ +
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA-TP 1258
            Y+L  V  H+G  S  GHY  +I+D   +  W +++D+ +T +   ++ +   G  + + 
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRD-DADEKWYRFDDDKVTAIEKEKIESLAGGGESDSA 473

Query: 1259 YFLVY 1263
              L+Y
Sbjct: 474  LILIY 478

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 1194 KEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE 1252
            K+   +KY L +V +H G + S GHY  + K  Q + +W  Y+DE I ++ D EV    E
Sbjct: 666  KKILPVKYQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEVLR--E 721

Query: 1253 GNTATPYFLVYVK 1265
             N    Y+LVY +
Sbjct: 722  TNA---YYLVYSR 731

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 728 NFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           NF+E    +         P G  N+GNTCYLN+ LQ  + ++ LRD I+NY
Sbjct: 90  NFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY  +I+D    + W K+ND+ ++ V   ++ +   G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1257 TPYFLVYVKN 1266
                ++  K 
Sbjct: 487  DSALILMYKG 496

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 728 NFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIEN 787
           NF+E    +         P G  N+GNTCYLN+ LQ  + +  LRD I+NY  + +   +
Sbjct: 90  NFIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNS 149

Query: 788 NLQ 790
            +Q
Sbjct: 150 GVQ 152

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY  +I+D    + W K+ND+ ++ V   ++ +   G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1257 TPYFLVYVKN 1266
                ++  K 
Sbjct: 487  DSALILMYKG 496

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%)

Query: 724 KLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           K  S+F+E    D         P G  N+GNTCYLN+ LQ  F +  LR+ I+NY
Sbjct: 85  KTASHFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGN 1254
            S  YNL  V  H+G  S  GHY  +I+D    ++W K+ND+ ++ V    V     G 
Sbjct: 427  SCVYNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERVEALAGGG 484

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENN 788
           P G  N+GNTCYLN+ LQ  + I  LRD ++N+  ++++ +N 
Sbjct: 106 PIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNG 148

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGN 1254
            Y+L  +  H+G  S  GHY  +I+D    +IW K+ND+ ++ +   ++ +   G 
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGGG 484

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P G+ N+GNTCY+N+ LQ  + I PLR++I+ +
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  Y+L  V  H+G  S  GHY  +++D   +  W K+ND+ +T +   ++ +   G  +
Sbjct: 374  SCVYDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGES 433

Query: 1257 -TPYFLVY 1263
             +   L+Y
Sbjct: 434  DSALILIY 441

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 728 NFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIEN 787
           NF+E    +         P G  N+GNTCYLN+ LQ  + ++ LR+ I+NY  +     N
Sbjct: 90  NFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNN 149

Query: 788 NLQ 790
            +Q
Sbjct: 150 GVQ 152

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY  +I+D    + W K+ND+ ++ V   ++ +   G  +
Sbjct: 427  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGES 486

Query: 1257 TPYFLVYVKN 1266
                ++  K 
Sbjct: 487  DSALILMYKG 496

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 82/208 (39%), Gaps = 51/208 (24%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTI 806
           TGL N+GNTCY+NS+LQ  F  S  RD  +                      GG+    +
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFL----------------------GGKYHRYL 625

Query: 807 EVERSVQFVYQLRDLFSEMIYSHSRC-VTPKKELAYLAFAPSNVEVEFDSEDGK------ 859
             +RS   + +   L    +Y +  C V P   L        +  +  D +D +      
Sbjct: 626 NPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFL 685

Query: 860 --SQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKK 917
             +  D +S E   V  D  N  LL D          DEKLLV  D+   DK  +E +K 
Sbjct: 686 LDTLHDELS-EPTKVANDYPN-LLLHD----------DEKLLV--DNKEYDKWFDEGLKN 731

Query: 918 INTLKPVTSTRVAKISPDQLENALEMGR 945
            N L P+       I   Q+EN+L+  R
Sbjct: 732 -NGLSPIDD-----IFQGQMENSLKCQR 753

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 728 NFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           NF+E    +         P G  N+GNTCYLN+ LQ  + +  +RD I+NY
Sbjct: 90  NFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  V  H+G  S  GHY  +I+D    + W K+ND+ +T V   ++ +   G  +
Sbjct: 428  SCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGES 487

Query: 1257 TPYFLVYVKN 1266
                ++  K 
Sbjct: 488  DSALILMYKG 497

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            YNL  V +H G+ S GHY+T IK   ++  W +++DE +  V   +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1249 -----------NFIEGNTATPYFLVYVKNENIDDI 1272
                       N+I     + Y LVY++ E  +D+
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL 542

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 15/25 (60%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLR 772
           G  N G TCYLNSLLQ YF     R
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFR 230

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1003 KIERFLSLLVNIGDHPKNIYDALDLYFNDELLQME------EYG--EVRKTLSITEFPSI 1054
            ++E F  L +N+ +  KN+ ++ D Y   EL+  E      +YG  + +K +    FP +
Sbjct: 334  RVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGVIFESFPPV 392

Query: 1055 LQIQIQRVYYD 1065
            L +Q++R  YD
Sbjct: 393  LHLQLKRFEYD 403

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            YNL  V +H G+ S GHY+T IK   ++  W +++DE +  V   +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1249 -----------NFIEGNTATPYFLVYVKNENIDDI 1272
                       N+I     + Y LVY++ E  +D+
Sbjct: 508  KVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL 542

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 15/25 (60%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLR 772
           G  N G TCYLNSLLQ YF     R
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFR 230

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1003 KIERFLSLLVNIGDHPKNIYDALDLYFNDELLQME------EYG--EVRKTLSITEFPSI 1054
            ++E F  L +N+ +  KN+ ++ D Y   EL+  E      +YG  + +K +    FP +
Sbjct: 334  RVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGVIFESFPPV 392

Query: 1055 LQIQIQRVYYD 1065
            L +Q++R  YD
Sbjct: 393  LHLQLKRFEYD 403

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 1187 LNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDS 1245
            L +S+ F    S +Y L +  IH G+   YGHY +  K   +   W  ++DET+  V + 
Sbjct: 545  LTVSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCK--TETFGWLLFDDETVEAVDEQ 602

Query: 1246 EVFNFIEGNTATPYFLVYVKNENIDDIE 1273
             V +F   N+ T Y L Y +    D+++
Sbjct: 603  TVLSFTGENSDTAYVLFYNEVSEYDEVK 630

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITR 796
           G  N GNTCY NS+LQ +F  S  R  ++++  +  D E    L+   R
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDGERARTLETFGR 176

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            YNL  V +H G+ S GHY+T IK   ++  W +++DE +  V   +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1249 -----------NFIEGNTATPYFLVYVKNENIDDI 1272
                       N+I     + Y LVY++ E   D+
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 15/25 (60%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLR 772
           G  N G TCYLNSLLQ YF     R
Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYFR 230

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 1178 LFNNI-RDMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   + L++S+ F    S KY L  V IH G    +GHY    K+  +   W  Y+
Sbjct: 569  LFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKN--EKFGWLLYD 626

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  + +  V  F    G+  T Y L Y
Sbjct: 627  DETVESIREETVLKFTGHPGDQTTAYVLFY 656

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTV 782
           G  N GNTCY NS+LQ  + IS  R  ++ Y + V
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRYPERV 161

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 1178 LFNNI-RDMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   + L++S+ F    S KY L  V IH G    +GHY    K+  +   W  Y+
Sbjct: 575  LFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKN--EKFGWLLYD 632

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  + +  V  F    G+  T Y L Y
Sbjct: 633  DETVESIREETVLQFTGHPGDQTTAYVLFY 662

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + I   R  I+ Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 719 FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           + +N   +SN+     + PS     +  TGL N+GNTCY+NS LQ    I  LRD  + Y
Sbjct: 270 YNKNYHWLSNYFMYNQLTPS-----SGITGLYNLGNTCYMNSALQCLVHIPELRDYFL-Y 323

Query: 779 TKTVDDI--ENNLQLQG-ITRRVGGRVTN 804
               D+I   N L  QG + R   G V N
Sbjct: 324 NCFEDEINCNNPLGYQGYVARAFSGLVQN 352

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            YNL  V +H G+ S GHY+T IK   ++  W +++DE + +V  ++VF    G  A P
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFEENYGLDALP 495

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 71/153 (46%), Gaps = 23/153 (15%)

Query: 928  RVAKISPDQLE-------NALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLK 980
            +V+K   D LE       ++ E   Q DV E    ++++LE+     S++       +L 
Sbjct: 257  QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSVEG------MLN 310

Query: 981  NCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELL------ 1034
              F+ K K  I  ++      +++E F  L +N+ +  K + ++ D Y   ELL      
Sbjct: 311  EIFVGKMKSYIKCIDVDYE-SSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGENQY 368

Query: 1035 QMEEYG--EVRKTLSITEFPSILQIQIQRVYYD 1065
            Q ++YG  +  K +    FP +L +Q++R  YD
Sbjct: 369  QAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 15/26 (57%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLR 772
            G  N G TCYLNSLLQ YF     R
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFR 228

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P GL N+GNTCY+NS LQ  + +  LRD ++ Y
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKY 140

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  Y+L  V  H+G  S  GHY ++I+D +  + W K+ND+ ++ V   ++     G  +
Sbjct: 424  SCVYDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGES 483

Query: 1257 -TPYFLVY 1263
             +   L+Y
Sbjct: 484  DSALILIY 491

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN ++  ++L++++ F    + KY L  V IH G +  +GHY +  K+ +    W  ++
Sbjct: 564  LFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGSPQHGHYVSLCKNDKFG--WLLFD 621

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  V +  V  F     N AT Y L Y
Sbjct: 622  DETVESVTEKTVLEFTGDSSNQATAYVLFY 651

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + ++ LR  ++ Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 746 PTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           P GL N+GNTCYLN+ LQ  F    L+D I+ Y
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 1201 YNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPY 1259
            Y+L  V  H+G  S  GHY  +I+D    + W K+ND+ ++ +   ++     G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1260 FLVYVKN 1266
             ++  K 
Sbjct: 486  LILLYKG 492

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 28/101 (27%)

Query: 1197 QSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF-------- 1248
            +S+ YNL  V +H G+ S GHY+  IK    +  W +++D+ + +V   +VF        
Sbjct: 432  ESMMYNLHGVLVHTGDISTGHYYAMIKPGLDDK-WYRFDDDKVWQVTKKQVFEQNFGFDR 490

Query: 1249 ---------------NFIEGNTATPYFLVYVKNENIDDIEP 1274
                           N++     + Y LVY+K    +D+EP
Sbjct: 491  LPEYELRSLSKEQYQNYLIARQTSAYMLVYIK----EDMEP 527

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 16/26 (61%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLR 772
            GL N G TCYLNSLLQ Y+     R
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFR 224

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + +V    E N   
Sbjct: 643  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDVLR--ESNA-- 696

Query: 1258 PYFLVYVK 1265
             Y+LVY +
Sbjct: 697  -YYLVYTR 703

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ +  V   +      
Sbjct: 636  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKITERNVLKEVNA---- 689

Query: 1258 PYFLVYVK 1265
             Y+LVY +
Sbjct: 690  -YYLVYTR 696

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            YNL  V +H G+ S GHY+T IK   ++  W +++DE +  V   +VF            
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1249 -----------NFIEGNTATPYFLVYVKNENIDDI 1272
                       N+I     + Y LVY++ +   D+
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL 541

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 15/26 (57%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLR 772
            G  N G TCYLNSLLQ YF     R
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFR 230

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 1002 NKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQME------EYG--EVRKTLSITEFPS 1053
            +++E F  L +N+ +  KN+ ++ D Y   EL+  E      +YG  + +K +    FP 
Sbjct: 333  SRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGVIFESFPP 391

Query: 1054 ILQIQIQRVYYD 1065
            +L +Q++R  YD
Sbjct: 392  VLHLQLKRFEYD 403

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 28/101 (27%)

Query: 1197 QSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF--NF---- 1250
            +S KY L  V +H G+ S GHY+  IK   Q+  W +++DE + +V   +VF  NF    
Sbjct: 440  ESCKYTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNK 498

Query: 1251 -----IEGNT------------ATPYFLVYVKNENIDDIEP 1274
                 I G T             + Y LVY++    +D EP
Sbjct: 499  LPEEEIRGMTREQYQNYLITRHTSAYMLVYIR----EDKEP 535

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 15/26 (57%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLR 772
            G  N G TCYLNSLLQ YF     R
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFR 232

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 721 RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN--Y 778
           +N   +SN+     + PS         GLNN+GNTCY+NS LQ    I  LRD  +   +
Sbjct: 321 KNYHWLSNYFHYNALTPS-----RGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVF 375

Query: 779 TKTVDDIENNLQLQGITRR 797
            K + +++N L  QG   R
Sbjct: 376 EKEI-NLDNPLGYQGHVAR 393

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 15/106 (14%)

Query: 1178 LFNNI-RDMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   + L++S+ F      KY L  V IH G    +GHY    ++  +   W  Y+
Sbjct: 577  LFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSGPQHGHYVCICRN--EKFGWLLYD 634

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVYV---------KNENID 1270
            DET+  + +  V  F    G+  T Y L Y          +NENID
Sbjct: 635  DETVESIKEETVLQFTGHPGDQTTAYVLFYKETQADKTENQNENID 680

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTV 782
           G  N GNTCY NS+LQ  + I   R  ++ Y + V
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERV 169

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN +   + LN+++ F       Y L  V IH G +  +GHY +  K+ +    W  ++
Sbjct: 668  LFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKNDKFG--WLLFD 725

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  V +S V  F     N AT Y L Y
Sbjct: 726  DETVESVSESTVLEFTGDPNNQATAYVLFY 755

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVD----DIEN----NLQLQGITRRV 798
           G  N GNTCY NS+LQ  + +   R  ++ Y+  +     +IEN     L ++G+  R+
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHLPHNYANIENRRIRKLDMKGLKPRI 231

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS+LQ  FA +  RD  ++
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRDLFVS 638

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 1187 LNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDS 1245
            L +++ +K   +IKY L  + IH G+    GHY    K   +   W  Y+DET+  V + 
Sbjct: 551  LEVNSNYKCTDTIKYELSGIVIHVGDGPQMGHYVALCK--TEKYGWLFYDDETVESVSEE 608

Query: 1246 EVFNFI--EGNTATPYFLVYVK 1265
             V  FI  E   +T Y L Y K
Sbjct: 609  TVLKFIGDEKTQSTAYVLFYKK 630

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + +   R  I+ Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            I Y+L AV IH G  +YGHY +Y K   Q   W + +DE++ EV + EV 
Sbjct: 420  IIYDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + +V    E N   
Sbjct: 667  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKISERDVLK--EPNA-- 720

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 721  -YYLLYTR 727

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII 776
           TGL N+GNTCY++S+LQ  FA + LRD  I
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRDLFI 654

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEI-INYTKTVDDIENNLQLQG 793
           GLNN+GNTCY+NS LQ    I P+RD       K   +++N L  QG
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQG 445

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 3/48 (6%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN--YTKTVD-DIENNLQL 791
           TGL N+GNTCY+NS+LQ  FA +  R+  ++  Y K +D DI  N +L
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHDIPTNQRL 800

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + E+    E N   
Sbjct: 753  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEREMLK--EPNA-- 806

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 807  -YYLLYTR 813

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + +SPLR+ I+ +
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 1194 KEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE 1252
            K+   +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + EV    E
Sbjct: 655  KKMLPVKYELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREVLK--E 710

Query: 1253 GNTATPYFLVYVK 1265
             N    Y+++Y +
Sbjct: 711  RNA---YYVLYTR 720

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + +V    E N   
Sbjct: 642  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISERDVLK--ETNA-- 695

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 696  -YYLLYTR 702

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N+GNTCY+NS+LQ  FA    RD
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRD 582

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 4/80 (5%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDI--ENNLQLQGITRRVGGRVTN 804
           TGL+N+GN+CY+NS LQ    I  L+D  + Y    +D+  +N L  +G+  +    +  
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFL-YGGYEEDVNTQNPLGYKGLVAQAFAALIK 392

Query: 805 TIEVERSVQ-FVYQLRDLFS 823
           ++  ERS   F +  R+  S
Sbjct: 393 SLFDERSSSAFAFSPREFKS 412

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1200 KYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            KYNL  V +H G+ S GHY+  IK   +++ W +++D+ +  V   +VF
Sbjct: 426  KYNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVF 473

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 16/21 (76%), Gaps = 1/21 (4%)

Query: 748 GLNNIGNTCYLNSLLQ-YYFA 767
           GL N G TCYLNSLLQ YYF 
Sbjct: 191 GLKNQGATCYLNSLLQSYYFT 211

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 720 QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYT 779
           + N    SN+     ++P+     +  TGL N+GNTCY+NS LQ    I  LRD  + Y 
Sbjct: 342 EGNHHWPSNYFAYNKLEPA-----SGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL-YD 395

Query: 780 KTVDDI--ENNLQLQGITRRV 798
              D+I  EN L   G   R 
Sbjct: 396 GYEDEINEENPLGYHGYVARA 416

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 1182 IRDMELNISNMFKE-FQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETIT 1240
            I D++L+   ++K+  + + Y+L+AV  H G    GHY  Y+K+F  N  W  ++D  +T
Sbjct: 1032 ITDLDLSRYVVYKDDPRGLIYDLYAVDNHYGGLGGGHYTAYVKNFADNK-WYYFDDSRVT 1090

Query: 1241 E-VPDSEVFNFIEGNTATPYFLVYVK 1265
            E  P++ +         + Y L Y++
Sbjct: 1091 ETAPENSI-------AGSAYLLFYIR 1109

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 740 LPAENWPT---GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQ--GI 794
           LP  +  T   GL N GNTCY NS+LQ  F +S LR  I+ Y    D      +L   G+
Sbjct: 123 LPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMYPIRKDPASRKPKLDVVGL 182

Query: 795 TRRV 798
             RV
Sbjct: 183 KPRV 186

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   ++L +           Y L  + IH G    +GHY    K       W  Y+
Sbjct: 613  LFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICK--HDMFGWLLYD 670

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  + +  VF F+  E +  T Y L +
Sbjct: 671  DETVESIDEETVFKFVGDEKDMTTAYVLFF 700

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS+LQ  FA    RD  I+
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N+GNTCY+NS+LQ  FA    RD
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRD 634

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + +V    E N   
Sbjct: 655  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGNWATYDDEYINKISERDVLK--EPNA-- 708

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 709  -YYLLYTR 715

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I    EL++ + F    S KY L  + IH G    +GHY    K   +   W  Y+
Sbjct: 572  LFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGAGPQHGHYVAMCK--TEKFGWLLYD 629

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            DET+  V + +V   +    + AT Y L Y
Sbjct: 630  DETVEAVLEKDVLRHVGDSNDLATAYILFY 659

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  +  S LRD +I Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + ++          
Sbjct: 393  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKISEKQML-----KEPG 445

Query: 1258 PYFLVYVK 1265
             Y+LVY +
Sbjct: 446  AYYLVYTR 453

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 1178 LFNNI-RDMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   +ELN+S+ F    S KY L  + +H G +   GHY    K  +    W  ++
Sbjct: 648  LFNKIVYPLELNVSSSFTSSISKKYKLQGIVVHMGSSPQQGHYVAICKTDKYG--WLLFD 705

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY--VKNEN 1268
            DET + + + EV +FI  E +  T Y L Y  VK+EN
Sbjct: 706  DETASWINEEEVLSFIGDEKSQNTAYVLFYEEVKDEN 742

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            YNL  V +H G+ S GHY+  IK    +  W +++DE +  V   +VF+
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFD 543

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENN-----LQLQGITRRVGGRV 802
           G  N G TCYLNSLLQ YF     RD ++    T D+  N+     LQ      +V    
Sbjct: 260 GFRNQGATCYLNSLLQSYFFTKYFRD-LVYQIPTADENPNDSVALALQRAFYQLQVSNYP 318

Query: 803 TNTIEVERSVQF 814
            +T+E+ RS  +
Sbjct: 319 LDTLELTRSFGW 330

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + +  Q +  W  Y+DE I ++  SE+    E N   
Sbjct: 689  VKYELLSVVVHEGRSLSSGHYIAHCR--QPDGSWATYDDEYINKI--SELNVLKEANA-- 742

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 743  -YYLLYTR 749

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 720 QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII--N 777
           + N   +SN      ++P+     +  TGL N+GNTCY+NS LQ    +  LRD  +   
Sbjct: 339 EGNHHWVSNHFVYNKLEPA-----SGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNG 393

Query: 778 YTKTVDDIENNLQLQGITRRV 798
           Y K +++ EN L   G   R 
Sbjct: 394 YEKEINE-ENPLGYHGYVARA 413

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 9/66 (13%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITE-VPDSEVFNFIEGNTATPY 1259
            Y+L+AV  H G    GHY  Y+K+F  N  W  ++D  +TE VP++ V         + Y
Sbjct: 1051 YDLYAVDNHYGGLGGGHYTAYVKNFMDNK-WYYFDDSRVTETVPENSV-------AGSAY 1102

Query: 1260 FLVYVK 1265
             L Y++
Sbjct: 1103 LLFYIR 1108

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 44/96 (45%), Gaps = 24/96 (25%)

Query: 1195 EFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF--NF-- 1250
            E +S  Y L  V +H G+ S GHY+T IK       W +++DE + +V   +VF  NF  
Sbjct: 442  ETESHIYKLHGVLVHTGDISTGHYYTMIKP-DLGDQWYRFDDERVWKVDRKQVFDENFGL 500

Query: 1251 -------IEGNT------------ATPYFLVYVKNE 1267
                   + G T             + Y LVYVK+E
Sbjct: 501  DKLPDSELRGMTKEEYQSYLITRHTSAYMLVYVKDE 536

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEI----INYTKTVDDIENNLQLQGITRRVGGRV 802
            G  N G TCYLNSLLQ YF     R  +     +  K  D +   LQ      +V    
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDEEKPNDSVPLALQRAFYQLQVSNLP 268

Query: 803 TNTIEVERSVQFVYQLRDLFSE 824
            +T+E+ RS  F +   D F++
Sbjct: 269 LDTLELTRS--FGWDSADAFTQ 288

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVD 783
           GL N GNTCY NS+LQ  + ++  R+ I+  T ++D
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSID 167

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            YNL  V +H G+ S GHY+  IK   ++  W +++DE + +V   +VF
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ-WYRFDDEKVWKVTKKQVF 484

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 25/99 (25%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V  ++VF            
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1249 -----------NFIEGNTATPYFLVYVK-NENIDDIEPL 1275
                       N++     + Y LVY++ ++  D ++P+
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADLLQPV 528

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENN-----LQLQGITRRVGGR 801
            G  N G TCYLNSLLQ YF     R  ++    T +D  NN     LQ      +V   
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFR-RLVYQIPTENDSPNNSVPLALQRAFYQLQVSDE 251

Query: 802 VTNTIEVERSVQFVYQLRDLFSE 824
             +T+E+ RS  F +   D F++
Sbjct: 252 PLDTLELTRS--FGWDSGDAFTQ 272

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + I  LRD +I Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 8/79 (10%)

Query: 722 NSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYT 779
           N    SN+     ++P      +  TGL N+GNTCY+NS LQ    I  LRD  +   Y 
Sbjct: 344 NCHWASNYFAYNKLEPG-----SGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYE 398

Query: 780 KTVDDIENNLQLQGITRRV 798
             +++ EN L   G   R 
Sbjct: 399 SEINE-ENPLGYHGYVARA 416

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 9/66 (13%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITE-VPDSEVFNFIEGNTATPY 1259
            Y+L+AV  H G    GHY  Y+K+F  +S W  ++D  +TE VP++ +       + + Y
Sbjct: 1054 YDLYAVDNHYGGLGGGHYTAYVKNF-ADSKWYYFDDSRVTETVPENSI-------SGSAY 1105

Query: 1260 FLVYVK 1265
             L Y++
Sbjct: 1106 LLFYIR 1111

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I ++ + ++          
Sbjct: 625  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEKQML-----KEPG 677

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 678  AYYLIYTR 685

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + + GHY  + K  Q +  W  Y+DE I ++ + ++          
Sbjct: 646  VKYQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPG 698

Query: 1258 PYFLVYVK 1265
             Y+LVY +
Sbjct: 699  AYYLVYTR 706

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 1184 DMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVP 1243
            D E++ SN      S  Y+L  V +H G+ S GHY+T IK   ++  W +++D+ +  V 
Sbjct: 430  DPEISSSNA----DSYIYDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVT 484

Query: 1244 DSEVF-----------------------NFIEGNTATPYFLVYVKNENIDDI 1272
             ++VF                       N++     + Y LVYV+ +  D I
Sbjct: 485  KNQVFEENFGHVRLPDEKLRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI 536

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENN-----LQLQGITRRVGGRV 802
           G  N G TCYLNSLLQ YF     R +++    T  +  NN     LQ      +     
Sbjct: 207 GFKNQGATCYLNSLLQSYFFTKYFR-KLVYQIPTDKESPNNSVPLALQRAFFQLQKSNEP 265

Query: 803 TNTIEVERSVQFVYQLRDLFSE 824
            +T+E+ RS  F +   D F++
Sbjct: 266 LDTLELTRS--FGWDTGDAFTQ 285

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 84/203 (41%), Gaps = 40/203 (19%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD--EIINYTKTVDDIENNLQLQGITRRVGGRVTN 804
           TGL N+G TCY+NS+LQ  FA +  RD  E  NY +       N +L+       G+++ 
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF-----NPELEDT-----GKLSK 648

Query: 805 TIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDN 864
           +  V            L  +M  +    V P   L    F   +  +  D +D +     
Sbjct: 649 SFSV------------LIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQE---- 692

Query: 865 ISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKI--NTLK 922
               T+D   D  ++   V        N   E LL D +++   K+++EE K+   N+L 
Sbjct: 693 FLMLTIDRLHDELSNQTEV-------LNAHPELLLYDAETS---KVQKEEYKQWFENSLI 742

Query: 923 PVTSTRVAKISPDQLENALEMGR 945
               + + KI   QLEN L   +
Sbjct: 743 NTKFSPIDKIFQGQLENGLHCKK 765

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 1176 TTLFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRK 1233
            + LFN I   + L + + F       Y L  V +H G + ++GHY +  K   +   W  
Sbjct: 557  SKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHYVSICK--HEKYGWLM 614

Query: 1234 YNDETITEVPDSEVFNFI--EGNTATPYFLVY 1263
            Y+DETI  +P+  V + +    N  T Y L Y
Sbjct: 615  YDDETIESIPEEAVTSHVGEPNNPITAYVLFY 646

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVP 1243
            Y L  +  HRG  + GHY TY K    + +W ++ND  + +VP
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVVMKVP 463

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL NIG TCY+NS+LQ  FA    RD
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRD 582

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 29/109 (26%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKD--------FQQNSIWRKYNDETITE------VPDSE 1246
            YNL  V +H GE S GHY+  IK         F  + +WR   ++   E      +PD +
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDDK 498

Query: 1247 VF--------NFIEGNTATPYFLVYVKN-------ENIDDIEPLKRIVS 1280
            +         N++     + Y LVY++        E++ D +  + IV+
Sbjct: 499  LRSLTREQYQNYLIARQTSAYMLVYIREDMEKNVLEDVSDTDVPQHIVT 547

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITR-----RVGGRV 802
           GL N G TCYLNSLLQ YF     R +I+    + ++  N+  L  + R     +     
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFR-KIVYKIPSENESPNDSVLLALQRSFYLLQKSNET 261

Query: 803 TNTIEVERSVQFVYQLRDLFSE 824
            +T+E+ RS  F +   D F++
Sbjct: 262 LDTLELTRS--FGWDTGDAFTQ 281

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 87/209 (41%), Gaps = 51/209 (24%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTI 806
           TGL N+GNTCY+N +LQ  FA + L+               NL + G  R    +  +  
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELK---------------NLFISGKYREYQMKPNDNK 692

Query: 807 EVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKS------ 860
           E   S  F     +LF++M  +    V P   L    F   ++ +  D +D +       
Sbjct: 693 ESAISNTFA----NLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFIL 748

Query: 861 --QRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKI 918
               D +S + V+V  D  N   L+ +D        D+K++VD      +K K+   K +
Sbjct: 749 NRLHDELSNQ-VNVINDYPN---LLLYD--------DDKMMVD-----KEKYKKWFDKTV 791

Query: 919 --NTLKPVTSTRVAKISPDQLENALEMGR 945
             N L PV       +   Q+ENAL+  R
Sbjct: 792 VANGLSPVDG-----VFQGQMENALQCQR 815

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 82/205 (40%), Gaps = 44/205 (21%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTI 806
           TGL N+G+TCY+NS+LQ  FA    RD  ++  K  D I      +G   R         
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-PKYHDYIS-----KGYIHRA-------- 658

Query: 807 EVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKS----QR 862
           ++ RS         LF +M  +    V P   L        + ++  D +D +       
Sbjct: 659 QISRSFHM------LFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLL 712

Query: 863 DNISTETVDVGADGKND--NLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKINT 920
           D +  E  D      ND   LL+  D N+  +G++            DK  E+ + K N 
Sbjct: 713 DQLHDELSD-PEQVANDYPQLLLHDDDNLQVDGKE-----------YDKWFEDSISK-NG 759

Query: 921 LKPVTSTRVAKISPDQLENALEMGR 945
           L P+ S     I   Q+EN L+  R
Sbjct: 760 LSPIDS-----IFQGQMENCLQCQR 779

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + K  Q +  W  Y+DE I  + + +V    E N   
Sbjct: 672  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINIISERDVLK--EPNA-- 725

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 726  -YYLLYTR 732

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS++Q  FA    R+  I+
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS 721

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQG 793
           TGL N+GNTCY+NS LQ    I  LRD  +   +T  ++  +N L  QG
Sbjct: 302 TGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINS-DNPLGYQG 349

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEV-PDSEVFNFIEGNTATPY 1259
            Y+L AV  H G    GHY  Y+K    N  W  ++D  +TE  P+S +         + Y
Sbjct: 959  YDLIAVDNHFGGLGGGHYTAYVK---TNDKWFYFDDSRVTETKPESSI-------AGSAY 1008

Query: 1260 FLVYVK 1265
             L Y++
Sbjct: 1009 LLFYLR 1014

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 728 NFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           +F+E    D      ++ P G  N+GNTCY+N+ LQ  +    +R  I++Y
Sbjct: 92  HFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDY 142

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 1198 SIKYNLFAVFIHRGEAS-YGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTA 1256
            S  YNL  +  H+G  S  GHY  +++D    + W K+ND+ +T V   ++     G  +
Sbjct: 430  SCVYNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGES 489

Query: 1257 TPYFLVYVKN 1266
                ++  K 
Sbjct: 490  DSALILMYKG 499

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQGITRRV 798
           TGL N+GNTCY+NS LQ    I  LRD  +   Y   +++ EN L   G   R 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINE-ENPLGYHGYVARA 416

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 10/86 (11%)

Query: 1182 IRDMELNISNMFKE-FQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETIT 1240
            I D++L+ + ++K+  +   Y+L+AV  H G    GHY  Y+K+F  N  W  ++D  +T
Sbjct: 1028 ITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFANNK-WYYFDDSRVT 1086

Query: 1241 E-VPDSEVFNFIEGNTATPYFLVYVK 1265
            E VP++ +         + Y L Y++
Sbjct: 1087 ETVPENSI-------AGSAYLLFYIR 1105

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YER098W (UBP9) and
            YBL067C (UBP13)
          Length = 740

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 5/100 (5%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   + L + + F       Y L  + IH G    +GHY    K   +   W  Y+
Sbjct: 568  LFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYVAICK--HELFGWLLYD 625

Query: 1236 DETITEVPDSEVFNFI-EGNTATPYFLVYVKNENIDDIEP 1274
            DET+  V +  V  FI + N  T  ++++ K++  DD  P
Sbjct: 626  DETVESVGEDAVLRFIGDVNDMTTAYVLFYKSKREDDDTP 665

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIE 786
           GL N GNTCY NS+LQ  + +  LR  ++ Y    +  E
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRAEPTE 138

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENN 788
           TGL N+GNTCY+NS++Q  FA    R   I  NY   ++ + +N
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1199 IKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTAT 1257
            +KY L +V +H G + S GHY  + +  Q +  W  Y+DE I ++ +  V    E N   
Sbjct: 605  VKYQLISVVVHEGRSLSSGHYIAHCR--QPDGSWAIYDDEYINKISERNVLK--EPNA-- 658

Query: 1258 PYFLVYVK 1265
             Y+L+Y +
Sbjct: 659  -YYLIYTR 665

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQG 793
           GL+N+GNTCY+NS LQ    I   +D  +   Y K V +IEN L  +G
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEV-NIENPLGHKG 393

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTK 780
           G  N GNTCY NS+LQ  + +S LR+ I+ + K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           +GL N+GNTCY+NS+LQ  FA +  R+
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 1181 NIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETIT 1240
            N R+    +  + K    + Y+L +V +H G  +YGHY  + K       W + +DET+ 
Sbjct: 604  NCRNFFPPVPKVSKPATPLTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVG 660

Query: 1241 EVPDSEVFN 1249
             V ++EV +
Sbjct: 661  IVTEAEVLS 669

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.7 bits (91), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V   +VF+
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFD 488

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 6/82 (7%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEI----INYTKTVDDIENNLQLQGITRRVGGRV 802
            G  N G TCYLNSLLQ YF     R  +     N     D +   LQ      +V    
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPNDSVPLALQRAFYQLQVSKFP 263

Query: 803 TNTIEVERSVQFVYQLRDLFSE 824
            +T+E+ RS  F +   D F++
Sbjct: 264 LDTLELTRS--FGWDTADAFTQ 283

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 9/63 (14%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYF 1260
            Y+L ++ +H G   YGHY +Y +   Q   W + +DE++ +V + EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISYRRFEDQ---WWRISDESVLKVDEDEVF------SASGIF 478

Query: 1261 LVY 1263
            +V+
Sbjct: 479  IVF 481

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   + L +++ F    S KY L  V +H G    +GHY +  K    N  W  ++
Sbjct: 571  LFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCK--TDNFGWLFFD 628

Query: 1236 DETITEVPDSEVFNF--IEGNTATPYFLVYVKNENIDD 1271
            DET+  + + +V NF      + T Y L Y + +  DD
Sbjct: 629  DETVETLDEPQVLNFTGDTTTSTTAYVLFYKETDEGDD 666

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDD 784
           G  N GNTCY NS+LQ  F ++  R+ I+ + +   D
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFPERAPD 151

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 639

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 1174 ELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYI-KDFQQN---- 1228
            +LT   N +    L ++ + K   ++KY LF V  H G    GHY + + KD + N    
Sbjct: 971  DLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIG 1030

Query: 1229 -SIWRKYNDETI 1239
             S W  ++DE +
Sbjct: 1031 RSKWYYFDDEVV 1042

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 1198 SIKYNLFAVFIHRGEASYGHYWT---YIKDFQQNSIWRKYNDETITEVPDSEVFNFIEG- 1253
            S KY L AV  H G +  G ++T   Y KD ++   W   +D  ITE+ D++V N  +  
Sbjct: 1009 SRKYKLRAVVYHHGSSPDGGHYTADIYNKDLKK---WFMIDDVNITELEDADVVNGGDNG 1065

Query: 1254 -NTATPYFLVYVK 1265
             +T T Y L+Y K
Sbjct: 1066 LDTRTAYILMYEK 1078

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 26/96 (27%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN----------- 1249
            Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V   + F+           
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFDENFGFDRLPDD 498

Query: 1250 -------------FIEGNTATPYFLVYVKNENIDDI 1272
                         FI  +T+  Y LVY++ +  D+I
Sbjct: 499  KIRTMTREQYQEYFIARHTSA-YMLVYIQEDKKDEI 533

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIE 807
           G  N GNTCY NS+LQ  + +S LR+ I+ + +    IE+N   +   +    R+     
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPEK--PIESNQSRKHDMKGNKPRIFTEAS 199

Query: 808 VERSV 812
            E+SV
Sbjct: 200 FEKSV 204

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQGITRR 797
           GL+N+GNTCY+NS LQ    I  +RD  +   + K + ++ N L  QG   R
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEI-NVNNPLGFQGHMAR 372

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 30/107 (28%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQGITRRVGGRVTN 804
           TGL N+GNTCY+NS LQ    I   R+  +   Y K + + +N L  QG           
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKEL-NTDNPLGYQG----------- 368

Query: 805 TIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEV 851
                        + + FSE+I    RC+   K + + A+AP++ + 
Sbjct: 369 ------------HVAEAFSELI----RCLFGDKLVQFSAYAPNHFKA 399

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N  NTCY+NS++Q  F  +P RD
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRD 318

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            YNL  V +H G+ S GHY+T I+    +  W +++D+ +  V   + F+
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIRPGVSDE-WYRFDDDKVWRVTKKQAFD 488

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENN----LQLQGITRRVGGRV 802
            G  N G TCYLNSLLQ YF     R  +      +D   N+    LQ      +V    
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIPTDMDSPNNSVPLALQRAFYQLQVSNEP 262

Query: 803 TNTIEVERSVQFVYQLRDLFSE 824
            +T+E+ RS  F +   D F++
Sbjct: 263 LDTLELTRS--FGWDNGDAFTQ 282

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 1174 ELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYI-KDFQQN---- 1228
            +LT   N +    L ++ + K   ++KY LF V  H G    GHY + + KD + N    
Sbjct: 962  DLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIG 1021

Query: 1229 -SIWRKYNDETI 1239
             S W  ++DE +
Sbjct: 1022 RSKWYYFDDEVV 1033

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 1179 FNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDET 1238
            + +IR+ E +I N  K+   I Y L  +  H+G  + GHY  + K       W K+ND  
Sbjct: 391  YCSIRESEKHIGN--KKVPDIIYELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSM 446

Query: 1239 ITEVPDSEVF 1248
            ++ +   EV 
Sbjct: 447  VSSISQEEVL 456

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 10/92 (10%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEAS-YGHYWT--YIKDFQQNSIWRK 1233
            LFN I   + LN S+ F    S  Y L  V +H G    +GHY +  + + F     W  
Sbjct: 587  LFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGNGPHHGHYVSLCHTELFG----WLL 642

Query: 1234 YNDETITEVPDSEVFNFIEGNTA--TPYFLVY 1263
            ++DET+  V +S V +F+  + +  T Y L Y
Sbjct: 643  FDDETVESVDESYVLDFVGSHESPTTAYVLFY 674

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIE 786
           G  N GNTCY NS+LQ  + +   R  ++ Y +  ++ E
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQE 200

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRD 773
           G+ N+GNTCY+NS+LQ  F  +  RD
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRD 239

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1198 SIKYNLFAVFIHRGEASY-GHYWTYIKD-FQQNSIWRKYNDETITEVPDSEVFNFIEGNT 1255
            S KY L AV  H+G + + GHY  +IK   +    W  YNDE I    D   F  IE N 
Sbjct: 702  SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIEKNG 761

Query: 1256 ATPYF 1260
               +F
Sbjct: 762  YMFFF 766

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + ++  R EI+ Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 741 PAENWPTGLNNIGNTCYLNSLLQYYFA 767
           P  N+  GL N+GN+CYLNS+LQ  FA
Sbjct: 313 PNGNFGCGLINLGNSCYLNSILQALFA 339

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + K       W + +DE++T V ++EV +
Sbjct: 685  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDESVTIVDEAEVLS 732

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           TGL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFIS 631

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 747  TGLNNIGNTCYLNSLLQYYFAISPLRD 773
            TGL N+ NTCY+NS+LQ  F+ S  R+
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + K      +W + +DET+  V ++EV +
Sbjct: 720  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGVWWRISDETVYIVDEAEVLS 767

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 740 LPA-ENWPTGLNNIGNTCYLNSLLQYYF--AISPLRDEII-NYTKTVDDIENNLQLQGIT 795
           LPA + +  GLNN+GN+CY+NS+LQ  F  A+     E++ ++ + V     NL+ Q I 
Sbjct: 305 LPASKEYGCGLNNLGNSCYMNSVLQVLFNGAVPDWSLEVLGDFPRDVVYPSTNLKCQLIK 364

Query: 796 RR 797
            R
Sbjct: 365 LR 366

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV +
Sbjct: 706  LTYSLRSVIVHYGTHNYGHYIAFRK---HRGFWWRISDETVYIVDEAEVLS 753

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 24/90 (26%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF------------ 1248
            YNL  V +H G+ S GHY+  IK    +  W +++D+ + +V  ++ F            
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-WFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1249 -----------NFIEGNTATPYFLVYVKNE 1267
                       N++     + Y LVY++ +
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIRED 527

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            Y L  V +H G+ S GHY+  I+     S W +++D+ + +  D +VF    G    P
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDAHGS-WYRFDDDRVIKATDKQVFEENFGKAKLP 487

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
            Anc_3.270 YBR058C
          Length = 785

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 12/82 (14%)

Query: 1170 EIDRELTTLFNNIRD-MEL---------NISNMFKEFQSIKYNLFAVFIHRGEASY-GHY 1218
            +++R +  +FNN+ D  EL         N  + +     + Y L AV  H+G++++ GHY
Sbjct: 680  DVNRSVEWVFNNMDDDGELPKEEPTTKNNNKDNYGNLNHVPYKLTAVVCHKGQSAHSGHY 739

Query: 1219 WTYIKDFQQNSI-WRKYNDETI 1239
              +I+      + W  YNDE I
Sbjct: 740  VAFIRKIVDGKLSWVLYNDEKI 761

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 742 AENWPTGLNNIGNTCYLNSLLQYYF 766
            +++  GL N+GN+CYLNS+LQ ++
Sbjct: 321 GDDFGVGLINLGNSCYLNSILQCFY 345

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRD 773
           GL+N+GNTCY+NS LQ    I  LRD
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRD 349

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 8/85 (9%)

Query: 722 NSKLISNFLETGV--IDPS---CLP---AENWPTGLNNIGNTCYLNSLLQYYFAISPLRD 773
           N + I  FL+  +  I PS    LP     N   G  N GNTCY NS+LQ  F +   R 
Sbjct: 89  NHQAIEEFLDIDIKRITPSISEVLPYGDGSNKIFGYENFGNTCYCNSILQCLFFLDDFRI 148

Query: 774 EIINYTKTVDDIENNLQLQGITRRV 798
           +I+ + +        L+  G T R+
Sbjct: 149 DILKHPRKESIDGRKLKYSGNTPRI 173

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y L +V +H G  +YGHY  Y K F+   +W + +DE++  V ++EV +
Sbjct: 687  LTYALRSVIVHYGTHNYGHYIAYRK-FR--GVWWRISDESVYVVDEAEVLS 734

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 721 RNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII--NY 778
           +N    SN+     + PS     N   GL N+GNTCY+NS LQ    I   +D  +   Y
Sbjct: 328 KNQHWASNYYIYNQMTPS-----NGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAY 382

Query: 779 TKTVDDIENNLQLQGITRRVGGRVTNTIEVER 810
            K + +++N L  +G      G +  ++  +R
Sbjct: 383 EKEI-NVDNPLGHKGHIAWAFGTLIQSLFGKR 413

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 720 QRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII--N 777
           Q++S   SNFL    +  S  P      GL N+GNTCY+NS LQ    I   RD  +   
Sbjct: 308 QKSSHWPSNFLIYNNLQSS--PGT---IGLTNLGNTCYMNSALQCITHIPIFRDYFLYGT 362

Query: 778 YTKTVDDIENNLQLQGITRRV 798
           + K V++  N L  QG   R 
Sbjct: 363 FQKEVNE-GNPLGYQGYMARA 382

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y L +V +H G  +YGHY  + K F+   +W + +DET+  V ++EV +
Sbjct: 676  LTYALRSVIVHYGSHNYGHYIAFRK-FR--GLWWRISDETVYVVDEAEVLS 723

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDI--ENNLQLQG 793
           GL+N+GN+CY+NS LQ    I  LRD  + Y     DI   N L  QG
Sbjct: 299 GLSNLGNSCYMNSALQCLVHIPELRDYFL-YGGFEQDINTSNPLGYQG 345

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            I Y L  +  HRG  + GHY  + K       W K+ND  +T +   EV 
Sbjct: 409  IIYELIGIVSHRGTVNEGHYIAFCKI--SGGQWFKFNDSVVTSIAQGEVL 456

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777
           GL N GNTCY+NS++Q  F    LRD  I+
Sbjct: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y L +V +H G  +YGHY  + K F+   +W + +DET+  V ++EV +
Sbjct: 677  LTYALRSVIVHYGTHNYGHYIAFRK-FR--GLWWRISDETVYVVDEAEVLS 724

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIIN--YTKTVDDIENNLQLQGITRRVGGRVTNT 805
           GL N+GN+CYLN ++Q   +        +N  Y K + ++++ L  +G+  R   R+ NT
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHI-NLKSKLGSKGVLARNFARLINT 667

Query: 806 IEVERSVQ 813
           +  E S Q
Sbjct: 668 MYTEGSEQ 675

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 64/164 (39%), Gaps = 24/164 (14%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTIE 807
           GL N+G+TC++NS+LQ    I+ LRD  + Y     ++     L       GGRV     
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFL-YNGFAAELNTRNSLG-----YGGRVAGA-- 403

Query: 808 VERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPS-NVEVEFDSED------GKS 860
                 F   ++ LF + I                 F P+    V+ DS +      G  
Sbjct: 404 ------FAEVVQALFGDKIAQFPTYAASNFRATIGYFRPALGPYVQQDSHEVVAFLLGAL 457

Query: 861 QRD-NISTETVDVGADGKNDNLLVDFDSNIGA--NGRDEKLLVD 901
             D N + E   VG  G++  +     ++ G    GR E+L  D
Sbjct: 458 HEDLNRAPEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAAD 501

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 69/157 (43%), Gaps = 30/157 (19%)

Query: 733 GVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPL---------RDEIINYTKTVD 783
           G +D   L    +  GL N GNTC++NS++Q   + + L         + E I+ T+ + 
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDEIAKKEEIDETELLQ 137

Query: 784 DIE--NNLQLQGITRRVGG------------RVTNTIEVERS---VQFVYQLRDLFSEM- 825
           D E   +++   I R+V G            ++ N +  E     V F   LR++ +++ 
Sbjct: 138 DEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKTPDVTFSLALREMLNKLN 197

Query: 826 --IYSHSRCVTPKKELAYLAFAPS-NVEVEFDSEDGK 859
              Y    C    K L  +  +P+ N+ + +D ED +
Sbjct: 198 TKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQ 234

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            + Y L +V +H G  +YGHY  + K       W + +DET+  V ++EV      +T+  
Sbjct: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVL-----STSGV 707

Query: 1259 YFLVY 1263
            + L Y
Sbjct: 708  FMLFY 712

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            + Y L +V +H G  +YGHY  + K       W + +DET+  V ++EV      +T + 
Sbjct: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721

Query: 1259 YFLVY 1263
            + L Y
Sbjct: 722  FMLFY 726

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            I Y+L  V  H+G    GHY T  K   ++  W K+ND  +T V + +V           
Sbjct: 387  IAYDLLNVVSHQGTVDQGHYTTVSKT--EDGQWFKFNDSVVTSVTEEQVLE------QQA 438

Query: 1259 YFLVYV 1264
            Y L Y+
Sbjct: 439  YLLFYI 444

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + +S +R+ I+ +
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 744 NWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN--YTKTVDDIENNLQLQGITRRVGGR 801
           N+  GL N+GN+CY+N +LQ     + L    +N  Y K + +I + L  +G+  R   R
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHI-NINSKLGSKGVLARYFAR 638

Query: 802 VTNTIE 807
           + + + 
Sbjct: 639 LAHIMH 644

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRD 773
           GL+N+GNTCY+NS LQ    I  LRD
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRD 315

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV 
Sbjct: 683  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 729

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 1178 LFNNIR-DMELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYN 1235
            LFN I   ++L++ + F    S KY L  + +H G    +GHY +  K+   N  W  ++
Sbjct: 591  LFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGGPQHGHYVSLCKN--DNFGWLLFD 648

Query: 1236 DETITEVPDSEVFNFI--EGNTATPYFLVY---VKNENID 1270
            DET+  V +S V  FI    +  T Y L Y    ++EN D
Sbjct: 649  DETVEAVHESTVSKFIGDRDSLTTAYVLFYKEIAQSENQD 688

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV 
Sbjct: 680  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 726

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + K F+    W + +DET+  V ++EV +
Sbjct: 642  LTYSLRSVIVHYGTHNYGHYIAFRK-FR--GCWWRISDETVYIVDEAEVLS 689

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 719 FQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLR----DE 774
           F+ N+         G ID   L    +  GL N GNTC++NS+LQ   +   L     D 
Sbjct: 63  FKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFLDDS 122

Query: 775 IINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVT 834
           II   K   + E  +Q +             ++V  SV F  +L D  +   Y       
Sbjct: 123 II---KKFQEQEEKIQNEEDPNEKEEEEEKDVDVRFSVAF-KELLDKLNSKYYRDKPYFR 178

Query: 835 PKKELAYLAFAPS-NVEVEFDSEDGKSQRDNISTE 868
             K L  ++ AP+ N+ + +D ED +    NI +E
Sbjct: 179 TNKLLKTMSNAPNKNMLLGYDQEDAQEFFQNILSE 213

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV 
Sbjct: 681  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 727

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 735 IDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEII-NYTKTVDDIENNLQ 790
           +D   L    +  GL N GNTC++NS+LQ   +   L D +  N  KT +DIE + Q
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYEDIERSEQ 145

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            + Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV 
Sbjct: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 725

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + K F+   +W + +DET   V ++EV +
Sbjct: 672  LTYSLRSVIVHYGTHNYGHYIAFRK-FR--GVWWRISDETAYIVDEAEVLS 719

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 10/96 (10%)

Query: 1174 ELTTLFNNIRD--MELNISNMFKEFQSIKYN--LFAVFIHRGEASYGHYWTYIKDFQQNS 1229
            +LTT + N  D  + LN+S +    Q   +N  L+ V  H G    GHY  Y+    +N 
Sbjct: 891  DLTTFWANDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNG 950

Query: 1230 IWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVK 1265
             W  ++D +   + +S     +E  T++ Y L Y +
Sbjct: 951  -WYYFDDTSCRPIKNS-----MEPITSSAYVLFYKR 980

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N+ NTCY+NS+LQ  F+ +  R+
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 1200 KYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE--GNTAT 1257
            +Y L  V  H G +S G ++T     ++++ W + +D  ITE+ D +V    E   ++ T
Sbjct: 840  RYKLTGVIYHHGVSSDGGHYTADVYHKEHNKWYRIDDVNITELEDDDVLKGGEEASDSRT 899

Query: 1258 PYFLVYVK 1265
             Y L+Y K
Sbjct: 900  AYILMYQK 907

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 1198 SIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEV 1247
            SI Y L  +  H G  + GHY  + K   +N  W K+ND  +T++ + +V
Sbjct: 398  SILYELIGIISHTGSVNEGHYVAFCK--IENGEWFKFNDSMVTKILEKDV 445

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            Y+L +V +H G  +YGHY  + K       W + +DET+  V ++EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRK---YRGYWWRISDETVYIVDETEVL 621

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 742 AENWPTGLNNIGNTCYLNSLLQYYF--AISPLR-DEIINYTKTVDDIENNLQLQGITRR 797
           ++ +  GL N+GN+CY+N++LQ  F   +S    DE+ ++   V  + +NL+ Q I  R
Sbjct: 304 SKRYGCGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSSNLKCQLIKLR 362

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 35.8 bits (81), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + +   R++++ Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 1185 MELNISNMFKEFQSIKYNLFAVFIHRGEA-SYGHYWTYIKDFQQNSIWRKYNDETITEVP 1243
            ++L +S+ F    S  Y L  + +H G    +GHY +  K+  +   W  ++DET+  + 
Sbjct: 597  LDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKN--EKFGWLLFDDETVEAIS 654

Query: 1244 DSEVFNFI--EGNTATPYFLVY 1263
            +  V  +   +    T Y L Y
Sbjct: 655  EQAVLQYTGDKDTMTTAYVLFY 676

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE--GNTATP 1258
            Y L  V  H G +S G ++T     Q    W + +D T+TE+   EV    E   ++ T 
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTA 826

Query: 1259 YFLVY 1263
            Y L+Y
Sbjct: 827  YILIY 831

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1200 KYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE--GNTAT 1257
            +Y L  V  H G +S G ++T      +++ W + +D  ITE+ D +V    E   ++ T
Sbjct: 843  RYKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRT 902

Query: 1258 PYFLVYVK 1265
             Y L+Y K
Sbjct: 903  AYILMYQK 910

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
            Anc_3.270 YBR058C
          Length = 795

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 83/190 (43%), Gaps = 27/190 (14%)

Query: 910  IKEEEVKKINTLKPVTSTRVAKISPDQLEN-------ALEMGRQQDVTECIGNVLNQLES 962
            +K + +K +N  K         I P   +N         +   QQD TE +  +L QLE 
Sbjct: 382  LKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFKSNNQQDATEFLTFLLEQLEK 441

Query: 963  ASIPLSLDDDEEQNDLLKNCFLVKTK---QSIIPLEKSKPPRNKIERFLSLLVNIGDHPK 1019
                     D   N+++K  F+++ K   QS   ++ S  P      ++ L ++  ++P+
Sbjct: 442  T----LFKKDNNPNNIMK--FIMEDKIQCQSCGNVKYSYEPT----EYIQLPLDGTNNPQ 491

Query: 1020 NIYDALDLYFNDELLQMEEYGEVRKTLSITE------FPSILQIQIQRVYYDREKFIPFK 1073
            N+ + L  +FN E +   +    +KT+  T+       P+ L I   R+ +++E + P K
Sbjct: 492  NLVETLTNFFNGENIDF-DCPTCKKTVVATKRQRFKTSPNTLVISPHRISFEKETWTPIK 550

Query: 1074 SIEPLPFGNV 1083
            +   L   N+
Sbjct: 551  TSAELTLPNL 560

>NDAI0A07700 Chr1 complement(1769901..1772906) [3006 bp, 1001 aa]
           {ON} 
          Length = 1001

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 5/96 (5%)

Query: 505 SYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQER 564
           S+Q+I +C  ++I         +K+F + L  T L+S+   +I+S+Y     ++ +  E 
Sbjct: 262 SFQVICFC--IEIYFTHIYNGPMKSF-VTLIPTILNSIGVPIIISLYNNIFVSRIIKWEN 318

Query: 565 HVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAY 600
           +++  N L  ++ Y+K+  L F ++Y P L T   Y
Sbjct: 319 NMSFENEL--ISKYEKNFILTFLINYVPLLITLFVY 352

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + ++ LR  I+ +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 22/94 (23%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKD--------FQQNSIWR--------------KYNDET 1238
            Y L  V +H G+ S GHY+T IK         F  + +WR              +  DE 
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDEWYRFDDDRVWRATKKQIFDDNFGFDRLPDEK 499

Query: 1239 ITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDI 1272
            I  +   +  +++       Y LVY+  E  ++I
Sbjct: 500  IRTMTREQYQDYLIQRHTNAYMLVYIAEEKEEEI 533

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + +  LR  ++ Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {ON}
            Anc_3.270 YBR058C
          Length = 780

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 1197 QSIKYNLFAVFIHRGEASY-GHYWTYIK-DFQQNSIWRKYNDETITEVPDSE 1246
            Q   Y L AV  H+G + + GHY  +IK +    S W  +NDE I    D++
Sbjct: 714  QPASYQLTAVVCHKGNSVHSGHYVAFIKKNIDNKSNWVLFNDEKIVLAQDTD 765

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 8/69 (11%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            I + L  +  HRG  + GHY  + K       W K+ND  ++ + + E+           
Sbjct: 403  IIFELIGIIAHRGTVNEGHYIAFTK--VTTGHWFKFNDSMVSSITEEELLQ------EQA 454

Query: 1259 YFLVYVKNE 1267
            Y L YV N+
Sbjct: 455  YLLFYVVNQ 463

>NDAI0A02790 Chr1 (629617..633309) [3693 bp, 1230 aa] {ON} Anc_7.160
            YIR006C
          Length = 1230

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1099 DTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKT 1158
            DTK+K  + K++   MKKR  E LSR ++   R   ++  K  L++   D  G    + T
Sbjct: 1102 DTKDKNAMFKEK---MKKRMAEKLSRIDVNGRRSPDMVNAKNTLLNRDRDQTGPTTAVPT 1158

Query: 1159 SLISQIEANLLEI 1171
            ++ S  E N+  +
Sbjct: 1159 TITSPFEDNITHL 1171

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 732 TGVIDPSCLPAEN--------------------WPTGLNNIGNTCYLNSLLQYYFAISPL 771
           T  I PSCL   N                    +  GL N+GN+CY+N ++Q       L
Sbjct: 527 TSTIQPSCLSLSNNDSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCIIQCILGTHEL 586

Query: 772 RDEIIN--YTKTVDDIENNLQLQGITRRVGGRVTNTIEVER 810
               ++  Y K + +I + L  +GI  +   R+ + +  E+
Sbjct: 587 TQIFLDDSYAKHI-NINSKLGSKGILAKYFARLVHMMYKEQ 626

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 20/24 (83%)

Query: 740 LPAENWPTGLNNIGNTCYLNSLLQ 763
           LP +++  GL N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N  NTCY+NS++Q  F+ +  RD
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRD 322

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 1187 LNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSE 1246
            ++ +N +K+ ++ +Y+L  V  H G +S G ++T     +++  W + +D +I E+   +
Sbjct: 746  ISSANAYKD-ENRRYHLTGVIYHHGVSSDGGHYTADVYHRESDKWYRIDDVSIIELEKED 804

Query: 1247 VFNFIE--GNTATPYFLVYVK 1265
            V    E  G++ T Y L+Y K
Sbjct: 805  VLKGGEESGDSRTAYILMYQK 825

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + +       W + +DET+  V ++EV +
Sbjct: 652  LTYSLRSVVVHYGTHNYGHYIAFRR---YRGYWWRISDETVYIVDETEVLS 699

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIIN--YTKTVDDIENNLQLQGITRRVGGRVTNT 805
           GL N+GN+CY+N ++Q   +   L    +N  Y K + ++ + L  +G+  +   R+ +T
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI-NLNSKLGSKGVLAKYFARLVHT 578

Query: 806 IEVERSVQ 813
           +  E S +
Sbjct: 579 MYREGSFK 586

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 303 TGLQNPCNTCYINSIIQCLFGTTLFRD 329

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + ++  R  ++ Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773
           TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 298 TGLQNPCNTCYINSIIQCLFGTTLFRD 324

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 734 VIDPSCLP------AENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           +I PS  P        N   G  N GNTCY NS+LQ  + +  LR  ++ +
Sbjct: 124 LIKPSVTPLLPYGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQGITRRVGGRVTNT 805
           GL N+GNTCY+NS LQ    +    +  +   Y K + +++N +  QG      G++ + 
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEI-NLDNPIGYQGNVANAFGKLIHK 473

Query: 806 IEVER 810
           +  ER
Sbjct: 474 LFEER 478

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            + Y+L +V +H G  +YGHY  + +       W + +DE++  V ++EV +
Sbjct: 672  LTYSLRSVIVHYGTHNYGHYIAFRR---YRGCWWRISDESVYIVEEAEVLS 719

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENNLQLQGITRRVGGRV 802
           GL+N+GNTCY+NS LQ    I  L +  +   Y + + +I N L  +G      G +
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREI-NINNPLGHKGDVAHAFGHL 395

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 741 PAENWPTGLNNIGNTCYLNSLLQYYF 766
           P++    GL N+GN+CYLNS+LQ  F
Sbjct: 314 PSKEVGCGLINMGNSCYLNSVLQCLF 339

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 946  QQDVTECIGNVLNQLES-ASIPLSLDDDEEQNDLLKNCFLVKT-----KQSIIPLEKSKP 999
            QQD  E    +LNQL     +      ++  +D L  C    T     K SI+  +    
Sbjct: 233  QQDAHEFWQFLLNQLHHDFQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQND 292

Query: 1000 PRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYG--------EVRKTLSITEF 1051
             +  I+ F+ L ++I D   N+Y+ LD +   E L    Y         +  K LSI + 
Sbjct: 293  SKTTIDPFMDLSLDIKD-KSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKL 351

Query: 1052 PSILQIQIQR 1061
            PS+L +Q++R
Sbjct: 352  PSVLVLQLKR 361

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIE--GNTATP 1258
            Y L  V  H G  S G ++T      +++ W + +D  ITE+ D +V    E   ++ T 
Sbjct: 842  YKLTGVIYHHGVGSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRTA 901

Query: 1259 YFLVYVK 1265
            Y L+Y K
Sbjct: 902  YILMYQK 908

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGN--TATP 1258
            Y L  V  H G +  G ++T     QQ + W + +D  I+E+ +  V +  + +  T T 
Sbjct: 849  YKLTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADDNDMGTRTA 908

Query: 1259 YFLVYVK 1265
            Y L+Y K
Sbjct: 909  YILIYEK 915

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 8/64 (12%)

Query: 1201 YNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYF 1260
            Y L A+  H G    GHY T  +      IW K+ND  +T + + ++           Y 
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRI--NGDIWAKFNDSMVTVISEEDMLK------EQAYL 460

Query: 1261 LVYV 1264
            L YV
Sbjct: 461  LYYV 464

>KLTH0E04224g Chr5 complement(380176..384102) [3927 bp, 1308 aa]
           {ON} similar to uniprot|Q08748 Saccharomyces cerevisiae
           YOR296W Hypothetical ORF
          Length = 1308

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 47/93 (50%), Gaps = 10/93 (10%)

Query: 131 YSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKANTLDDLS 190
           YS++R+ +           +VI   +E++S TC   N +   M ++ D  ++ N  +++S
Sbjct: 785 YSEMRSALKSS-------DVVIPKPYEFQSKTCTCLNNLNQMMQMISDLEERINP-EEMS 836

Query: 191 NIIINHVKITVKTRTVLERTRRLMGLSKFHLVK 223
           +++  H ++  K R + +R  +  GL   + VK
Sbjct: 837 SVVNQHERLDAKRRMMTDRQNK--GLKHLYTVK 867

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYT 779
           GL N+GN+CY+N ++Q  FA + L    +N T
Sbjct: 526 GLENMGNSCYINCIIQCIFATTELIKIFLNGT 557

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 20/23 (86%)

Query: 741 PAENWPTGLNNIGNTCYLNSLLQ 763
           P++++  GL N+GN+CYLNS++Q
Sbjct: 317 PSKDYGCGLINLGNSCYLNSVMQ 339

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINY 778
           G  N GNTCY NS+LQ  + ++  R +++ +
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 1198 SIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            SI Y L  V  H G  + GHY   +K    N  W K+ND  +T + + EV 
Sbjct: 377  SIIYELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 1190 SNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            S+  +   S  Y L  V  H G +  G ++T     +Q   W + +D  IT++ D +V  
Sbjct: 736  SSALRNNSSKTYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVLK 795

Query: 1250 FIEGN--TATPYFLVY 1263
              E N  + T Y L+Y
Sbjct: 796  GGEDNMDSRTAYILMY 811

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)

Query: 740 LPAEN-WPTGLNNIGNTCYLNSLLQ 763
           LPA N +  GL N+GN+CYLNS++Q
Sbjct: 315 LPASNEYGCGLINLGNSCYLNSVMQ 339

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            I Y L  +  H+G  + GHY  + K       W K+ND  ++ +   EV 
Sbjct: 411  IIYELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSMVSSISQEEVL 458

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            I Y L  +  H+G  + GHY  + K       W K+ND  ++ +   EV 
Sbjct: 409  IIYELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSMVSSISQEEVL 456

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 8/65 (12%)

Query: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258
            I Y L  V  H G  + GHY    K    N+ W K+ND  IT V +  V           
Sbjct: 401  IIYELIGVICHTGTVNEGHYICSCK--LANNQWVKFNDSMITIVDNETVLK------EQA 452

Query: 1259 YFLVY 1263
            Y L+Y
Sbjct: 453  YLLIY 457

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIINYT 779
           GL N+GN+CYLN ++Q       L    +NY+
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNYS 779

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 741 PAENWPTGLNNIGNTCYLNSLLQYYF 766
           P +    GL N+GN+CYLNS+LQ  F
Sbjct: 317 PDQEHGCGLINLGNSCYLNSVLQCLF 342

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 1195 EFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVF 1248
            E  +I Y L  +  H+G  + GHY +  K       W K+ND  +T V + +V 
Sbjct: 388  ETPAIVYELIGLISHQGSVNQGHYTSICKI--PGGQWFKFNDSMVTAVAEIDVL 439

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 743 ENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITR 796
           + + TGL N GN CY NS++Q   +I    D I  +   +D  EN +   G+ +
Sbjct: 68  DKYTTGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGID--ENEISSAGLEK 119

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
            (UBP3) - Ubiquitin-specific protease [contig 231] PARTIAL
          Length = 444

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 1190 SNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249
            +N +KE  S  Y L  V  H G +S G ++T     +    W + +D  + E+   EV  
Sbjct: 367  ANFYKESGST-YKLIGVVYHHGVSSSGGHYTCDVYQEAQKKWFRIDDINVQEIEMEEVLQ 425

Query: 1250 FIE--GNTATPYFLVYVK 1265
              E   ++ T Y L+Y K
Sbjct: 426  PGEEGSDSRTAYILIYQK 443

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,246,627
Number of extensions: 6504048
Number of successful extensions: 27612
Number of sequences better than 10.0: 375
Number of HSP's gapped: 28551
Number of HSP's successfully gapped: 485
Length of query: 1283
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1162
Effective length of database: 39,606,813
Effective search space: 46023116706
Effective search space used: 46023116706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)