Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E011305.350ON27727712900.0
NDAI0C043105.350ON2592664852e-59
NCAS0F028605.350ON2532654772e-58
KAFR0C018605.350ON2592614582e-55
TDEL0E027705.350ON2582614548e-55
Kpol_339.115.350ON2582594461e-53
ZYRO0D10142g5.350ON2552554363e-52
CAGL0H07117g5.350ON2602564312e-51
KLTH0H14828g5.350ON2512544077e-48
Kwal_34.159845.350ON2512684033e-47
Suva_2.4885.350ON2742783992e-46
Skud_4.5855.350ON2742583932e-45
Smik_4.5785.350ON2742553913e-45
YDR319C5.350ON2742623888e-45
SAKL0G08866g5.350ON2552373781e-43
Ecym_81835.350ON2652643731e-42
TBLA0A031105.350ON2752303722e-42
AGR350C5.350ON2612473564e-40
KNAG0C055105.350ON2642623461e-38
KLLA0B10153g5.350ON2672513286e-36
TPHA0J018106.117ON39037800.12
Kpol_461.26.117ON39753770.34
TBLA0F025006.117ON327106750.50
Kwal_14.17966.117ON36338740.68
KLTH0H06556g6.117ON36338731.0
Ecym_30686.117ON36750721.2
KAFR0A046406.117ON237119711.2
CAGL0I00330g6.117ON37128711.5
TDEL0G035306.117ON36843683.9
SAKL0A07062g6.117ON42926684.3
NCAS0B050508.271ON92329675.2
ZYRO0A09240g6.117ON37218665.9
Skud_7.1466.117ON31698666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01130
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   501   0.0  
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   191   2e-59
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   188   2e-58
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   181   2e-55
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   179   8e-55
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   176   1e-53
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   172   3e-52
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   170   2e-51
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   161   7e-48
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   159   3e-47
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   158   2e-46
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   155   2e-45
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   155   3e-45
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   154   8e-45
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   150   1e-43
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   148   1e-42
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   147   2e-42
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   141   4e-40
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   137   1e-38
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   130   6e-36
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    35   0.12 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    34   0.34 
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    33   0.50 
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    33   0.68 
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    33   1.0  
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    32   1.2  
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    32   1.2  
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    32   1.5  
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    31   3.9  
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    31   4.3  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271     30   5.2  
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    30   5.9  
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    30   6.9  

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  501 bits (1290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/277 (90%), Positives = 251/277 (90%)

Query: 1   MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTI 60
           MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTI
Sbjct: 1   MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTI 60

Query: 61  NQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYL 120
           NQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYL
Sbjct: 61  NQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYL 120

Query: 121 FKQYFFKYCVKSASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISG 180
           FKQYFFKYCVKSASLFVIFFAIDTLFVL              ETCRSNKGKWEGGFDISG
Sbjct: 121 FKQYFFKYCVKSASLFVIFFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISG 180

Query: 181 HFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIY 240
           HFCFLITISLILWCELYKLHKRMESESFEVELNVVFT            WFGLLWITAIY
Sbjct: 181 HFCFLITISLILWCELYKLHKRMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIY 240

Query: 241 YHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLYK 277
           YHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLYK
Sbjct: 241 YHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLYK 277

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  191 bits (485), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 151/266 (56%), Gaps = 14/266 (5%)

Query: 16  FPLFAISISYIF--VLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWF 73
            P+    I YI+  +L  G  ++ +L  ETL+ HK+++Y LNSKN  NQ+ AYNGN VW 
Sbjct: 4   LPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWS 63

Query: 74  LLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSA 133
           +LF L+  + +  ++ N   LLP   D             +R    L KQY  K+ +K+ 
Sbjct: 64  ILFILLSVIQIRLQSTNI-NLLPRHVDSAAS--------KRRHVNSLIKQYVIKFVLKNV 114

Query: 134 SLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILW 193
            L  +F  ID+LF+L              E C++  G+WEGGFDISGHFCFLI ISLILW
Sbjct: 115 LLAFLFLIIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILW 174

Query: 194 CELYKLHKRMES--ESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGC 251
            EL  L+K +E   E+F  +++                W G+L++TA+YYHT  EK+LGC
Sbjct: 175 SELSLLNKVLEDREETF-TKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGC 233

Query: 252 MLGFVTPLLMYYTIPSNEFLNGLLYK 277
           +LGFV P++MYY IP+N  L   LYK
Sbjct: 234 ILGFVCPIVMYYFIPNNVKLKQTLYK 259

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  188 bits (477), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 152/265 (57%), Gaps = 13/265 (4%)

Query: 13  KNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVW 72
           + +F    + + Y  +L+ G  ++ I+  ETL+  K  +Y L+SKN +N++FAYNGNL+W
Sbjct: 2   RAYFKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIW 61

Query: 73  FLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKS 132
            +LF ++ Y  +    + +++LLP  A +     +R  Q  QR    L KQY  K+ +K 
Sbjct: 62  AMLFGMMAYFQVWIR-IRTQDLLPRDAQII----NR--QRLQR----LIKQYIVKFVLKY 110

Query: 133 ASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLIL 192
             LF+ F  ID LF+               E C++  G WEGGFDISGHFCFL+ +SLIL
Sbjct: 111 LLLFITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLIL 170

Query: 193 WCELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCM 252
           WCEL  L + +  E  E+E+  + T            W  +L +TAIYYHT  EK+LGC+
Sbjct: 171 WCELSILERYLRDE--ELEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCL 228

Query: 253 LGFVTPLLMYYTIPSNEFLNGLLYK 277
           LG+  PL+MY+ IP++  LN +LY 
Sbjct: 229 LGYCCPLIMYWLIPNHYKLNHILYS 253

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  181 bits (458), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 137/261 (52%), Gaps = 9/261 (3%)

Query: 16  FPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLL 75
            P   IS+ Y  +L  G FL  ++  ET  Y K   Y L S N IN+IFAYNGNLVWF+L
Sbjct: 6   LPPLIISLIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFIL 65

Query: 76  FCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASL 135
           F  V  L ++  + ++  LLP      V + S+     +     L K+Y  K+ +K   L
Sbjct: 66  FSFVASLQIYIRS-HTFILLPHDI---VDVDSK-----ENVRAKLLKEYMVKFLLKVFIL 116

Query: 136 FVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCE 195
           FV F  ID +F+L              E C++  G W GGFDISGHFCFL  ISLILW E
Sbjct: 117 FVCFLIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIE 176

Query: 196 LYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGF 255
           L+   K  E E  +  +N                W  LL +T+IYYHT  EK+LGC++G+
Sbjct: 177 LHHYSKYTEEEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGY 236

Query: 256 VTPLLMYYTIPSNEFLNGLLY 276
             PL+MY+ IP+   +  LLY
Sbjct: 237 ACPLVMYWLIPNQPRMKSLLY 257

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  179 bits (454), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 137/261 (52%), Gaps = 12/261 (4%)

Query: 17  PLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLF 76
           P  A SI Y   L+ G  +  ILG + LE  + ++Y L SKN IN IFAY GNLVW + F
Sbjct: 10  PKIAASI-YPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDF 68

Query: 77  CLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLF 136
             +  + ++ +  N   LLP  A             +      L KQY  K  +K+  L 
Sbjct: 69  VCLALVQIYVKCRN-HALLPRDAR----------TNSSGPLKSLLKQYTSKIILKNVLLA 117

Query: 137 VIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCEL 196
           + FF ID++FVL              E CR + G+W+GGFDISGHFCFL+ IS+ILW EL
Sbjct: 118 ITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLEL 177

Query: 197 YKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFV 256
            +    ME ES    ++ V              W  +L +TA+YYHT  EKVLGC LG+V
Sbjct: 178 SQFRSYMERESVVFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYV 237

Query: 257 TPLLMYYTIPSNEFLNGLLYK 277
             L+MY+ IP +   NGLLY 
Sbjct: 238 CVLVMYWLIPRSRRFNGLLYS 258

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  176 bits (446), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 145/259 (55%), Gaps = 7/259 (2%)

Query: 18  LFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFC 77
           L  +S+ Y F +L G  L  I+G   LE  + +FY L S N +N++FAY+GN VW +LF 
Sbjct: 6   LRVVSLIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFI 65

Query: 78  LVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFV 137
            +  + +++ +     L+ + +      + R  Q   R    L KQY  K  +K+  L +
Sbjct: 66  FLCLVQIYYRSKRFSLLISSES-----FNGRD-QLIARGKP-LVKQYICKLILKNLMLIL 118

Query: 138 IFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELY 197
           +F  ID +F+               + CR   G WEGGFDISGHFCFL+TIS+ILW EL+
Sbjct: 119 VFSVIDNVFIFSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELH 178

Query: 198 KLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVT 257
           +  K ++ E    +L++               W  +L+IT++YYHTF EKVLGC +G++T
Sbjct: 179 QFKKHVDLEGLSGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYIT 238

Query: 258 PLLMYYTIPSNEFLNGLLY 276
           P +MY+ IP+NEFL  +LY
Sbjct: 239 PYVMYHIIPNNEFLYSILY 257

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  172 bits (436), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 137/255 (53%), Gaps = 11/255 (4%)

Query: 22  SISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFY 81
           +I Y   L+ G  L  ++G E LE  +   YFLN  N INQIFAY GN +W +LFC +  
Sbjct: 12  AIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAG 71

Query: 82  LHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFA 141
           L ++ +T +  +++P  A   V          ++    L K+Y  K  +K+  L +IF  
Sbjct: 72  LQVYMKT-HVPDVIPRDARTIV----------RKPMTSLLKEYAVKIILKNLLLAIIFLF 120

Query: 142 IDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHK 201
           ID +F+L              E C  N G WEGGFDISGHFCFL++IS+ILW EL  L  
Sbjct: 121 IDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180

Query: 202 RMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLM 261
            +  E     LNV               W  +L +T+IYYHT  EK+LGC +G++ P++M
Sbjct: 181 WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIM 240

Query: 262 YYTIPSNEFLNGLLY 276
           Y+ IP+++ +  +LY
Sbjct: 241 YWLIPNHDIVRKVLY 255

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 136/256 (53%), Gaps = 9/256 (3%)

Query: 21  ISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVF 80
           +S++Y  +L+ G FL ++L  E     + ++Y LNSKN  NQI AY GN VW  LF  V 
Sbjct: 9   VSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGVA 68

Query: 81  YLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFF 140
            +  +  T  S+ LLPT         +R    + +    + K+YF KY +K   L VIF 
Sbjct: 69  AVQYNLRT-KSQSLLPTD--------TRALVVSNKTKLQIIKEYFCKYFLKLFILDVIFL 119

Query: 141 AIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLH 200
            ID +F++              E C+S  GKW GGFDISGHFCFL+ IS+ILW EL  + 
Sbjct: 120 VIDGVFIMTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIA 179

Query: 201 KRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLL 260
           + +      + L+ +              W G+L +TA YYHT  EK++GC+ G++ P +
Sbjct: 180 EHVCGYDTVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFV 239

Query: 261 MYYTIPSNEFLNGLLY 276
           MY  IP++  LN L Y
Sbjct: 240 MYGLIPNSHDLNKLFY 255

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  161 bits (407), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 134/254 (52%), Gaps = 18/254 (7%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y  VL+ G  +HL+    TL++ K ++Y L+  N IN +FAY GNL+W +LF  +    +
Sbjct: 14  YPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAAYQI 73

Query: 85  HFETVNSKELLPTSADV--PVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAI 142
               V+  +LLP  A    P   H             L K+Y  K  +K+  L+VIFF I
Sbjct: 74  KIR-VSRSDLLPRDARTTYPARWHR------------LGKEYAVKIILKNLLLYVIFFVI 120

Query: 143 DTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKR 202
           D +FV               E CR   GKWE GFDISGHFCFL  +SLILW EL  + K 
Sbjct: 121 DCVFV-WTGGSCSSSATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKY 179

Query: 203 MESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMY 262
           + S+  E   + ++             W  +L +TAIYYHT  EK+LG ++G++ P++MY
Sbjct: 180 LNSD--ERTPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMY 237

Query: 263 YTIPSNEFLNGLLY 276
           + +PS+  L  LLY
Sbjct: 238 WLVPSHTALRQLLY 251

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  159 bits (403), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/268 (36%), Positives = 139/268 (51%), Gaps = 23/268 (8%)

Query: 11  LQKNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNL 70
           ++K  F L      Y  +L +G  ++L++    LE  ++S+Y L+S N +N++FAY GNL
Sbjct: 5   IEKAQFTLV-----YPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNL 59

Query: 71  VWFLLFCL--VFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKY 128
            W +LF L  VF + LH E     +LLP  A     +H RV          L KQY  K 
Sbjct: 60  TWTILFTLLAVFQVWLHAE---QSDLLPRDAR---SVH-RV------GGVRLAKQYTVKL 106

Query: 129 CVKSASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITI 188
            +K+  L++ F  ID LFV               E CR   G W+ GFDISGHFCFL  I
Sbjct: 107 ILKNVLLYLAFLFIDNLFV-WTGGSCSTSSTRSAERCRKEGGSWDNGFDISGHFCFLTNI 165

Query: 189 SLILWCELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKV 248
           SLILW EL  + K++ S+  ++     +             W  +L +TA+YYHT  EKV
Sbjct: 166 SLILWYELRSIQKKISSD--DISPTKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKV 223

Query: 249 LGCMLGFVTPLLMYYTIPSNEFLNGLLY 276
           LG  +G++ P +MY  IP++  L  LLY
Sbjct: 224 LGLTMGYLCPTIMYLVIPNHSGLRSLLY 251

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  158 bits (399), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 144/278 (51%), Gaps = 12/278 (4%)

Query: 5   IEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIF 64
           I +L +  +  + ++ I +      L G  + +++  ETL + K ++  L S N +N IF
Sbjct: 2   IRQLSYWSRKAYLVYPIQV------LVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIF 55

Query: 65  AYNGNLVWFLLFCLVFYLHLHFETVNSKELLP---TSADVP---VGLHSRVCQYTQRANY 118
           AY  N +W + F  +  L ++F  +   ++LP   +S+D     +   +R      R   
Sbjct: 56  AYKANKIWPIFFFSLALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVIT 115

Query: 119 YLFKQYFFKYCVKSASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDI 178
            +  QY  K+ +K+  LF+ F  ID +FV               E CR  KGKW GGFDI
Sbjct: 116 TMAAQYACKFVLKNLLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDI 175

Query: 179 SGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITA 238
           SGHFCFL+ IS+ILW EL+   + +++E     +N                W G+LW+TA
Sbjct: 176 SGHFCFLVNISMILWMELHLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTA 235

Query: 239 IYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLY 276
           IYYHT  EK+LGC++G++ P+ +Y+ +P  E L+  LY
Sbjct: 236 IYYHTILEKMLGCLMGYICPVFIYHILPRIELLHDYLY 273

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  155 bits (393), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/258 (33%), Positives = 136/258 (52%), Gaps = 6/258 (2%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y F +L G  + +++ +ETL + K ++  L S N  N +FAY  N +W  LF  + +L +
Sbjct: 16  YPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFFSLAFLQI 75

Query: 85  HFETVNSKELLP---TSADVPVGLHSRVCQYT---QRANYYLFKQYFFKYCVKSASLFVI 138
           +F  +   ++LP   +S++      S + ++     R    +F QY  K+ +KS  L+V 
Sbjct: 76  YFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILKSLLLYVC 135

Query: 139 FFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYK 198
           F  ID +F+               E CR   GKW+GGFDISGHFCFL+ IS+ILW EL+ 
Sbjct: 136 FQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWMELHL 195

Query: 199 LHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTP 258
             K +++E      N                W  +LW+TAIYYHT  EK+LGC +G++ P
Sbjct: 196 FSKFVQAEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMGYICP 255

Query: 259 LLMYYTIPSNEFLNGLLY 276
           + +Y+ +P    L+  +Y
Sbjct: 256 IFIYHVLPKIGLLHDYIY 273

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  155 bits (391), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 132/255 (51%), Gaps = 6/255 (2%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y F +L G  + +++  +TL++ K +   L S N  N IFAY  N +W +LF  + +L +
Sbjct: 16  YPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQV 75

Query: 85  HFETVNSKELLP----TSADVPVGL--HSRVCQYTQRANYYLFKQYFFKYCVKSASLFVI 138
           +F  +   ++LP    +S   P  L   +R      R    +  QY  K+ +K   LF+ 
Sbjct: 76  YFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLFLS 135

Query: 139 FFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYK 198
           F  ID +F+               E CR   GKW GGFDISGHFCFL+ IS+ILW EL+ 
Sbjct: 136 FQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHM 195

Query: 199 LHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTP 258
             + ++SE     +N                W  +LW+TAIYYHT  EK+LGC++G++ P
Sbjct: 196 FCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICP 255

Query: 259 LLMYYTIPSNEFLNG 273
           + +Y+ +P  E L+ 
Sbjct: 256 IFIYHILPKIELLHN 270

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  154 bits (388), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 133/262 (50%), Gaps = 14/262 (5%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y F +  G  L +++ +ETL + K +   L S N  N IFAY  N +W  LF  + +L +
Sbjct: 16  YPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFFSLAFLQI 75

Query: 85  HFETVNSKELLPTSADVPVGLHSRVCQYTQRANYY----------LFKQYFFKYCVKSAS 134
           +F  +   ++LP    +P+        Y    N++          +  QY  K+ +K   
Sbjct: 76  YFHYLARMDILP----LPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLKYLL 131

Query: 135 LFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWC 194
           LF+ F  ID +F+               E CR   GKW+GGFDISGHFCFL++IS+ILW 
Sbjct: 132 LFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWM 191

Query: 195 ELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLG 254
           EL+   + +++E     +N                W  +LW+TAIYYHT  EKVLGC++G
Sbjct: 192 ELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMG 251

Query: 255 FVTPLLMYYTIPSNEFLNGLLY 276
           F+ P+ +Y+ +P    L+  LY
Sbjct: 252 FICPVFIYHILPKIGILHNYLY 273

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  150 bits (378), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 125/237 (52%), Gaps = 14/237 (5%)

Query: 40  GTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSA 99
             + L+  K  +Y L+S+N IN++FAY GN ++ + F L+  L +H  + N ++LLP   
Sbjct: 33  SAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQIHIHSKN-QDLLPR-- 89

Query: 100 DVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDTLFVLXXXXXXXXXXX 159
                 +S     T+ A   L +QY  K+ +K   L+V+F+ ID +F+            
Sbjct: 90  ------NSSSSPRTEAAG--LARQYAIKFLLKQLLLYVVFYIIDHVFI-WTGGVCSISKT 140

Query: 160 XXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXX 219
              E CR   G WEGGFDISGHFCFL  +SLILW ELY   K +     E+ +N  F   
Sbjct: 141 RSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDN--ELRVNRKFAWI 198

Query: 220 XXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLY 276
                     W  +L +TA YYHT  EKVLG ++G+  P +MY  IPS   LN L+Y
Sbjct: 199 KYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKLMY 255

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  148 bits (373), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 135/264 (51%), Gaps = 16/264 (6%)

Query: 19  FAISISYIFV---LLFG-EFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFL 74
           F ++  YI V   L+FG   + L+ G+E LE  + S+Y L   N +N +F  NGN VW +
Sbjct: 12  FIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLV 71

Query: 75  LFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYL--FKQYFFKYCVKS 132
           L+ L+  +  +  T  S  L P    VP G  SR     +R   +L   KQ+  K  +K 
Sbjct: 72  LYILMAGVQCYIRTKESDSL-PLGGSVP-GSSSR-----ERYTIFLCLVKQFIVKLALKM 124

Query: 133 ASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLIL 192
             L  IF+ ID +F+               E C    GKW GGFDISGHFCF+  +SLIL
Sbjct: 125 VLLDRIFWLIDHVFIWTGGRCTVSDTKSSME-CYRLHGKWVGGFDISGHFCFVTNLSLIL 183

Query: 193 WCELYKLHKRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCM 252
           WCEL+ L + + +   E+ L                 W  +LW+TA++YHT  EKVLG +
Sbjct: 184 WCELFSLEQYLSAN--EIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLI 241

Query: 253 LGFVTPLLMYYTIPSNEFLNGLLY 276
           LG+V P++MY  IP    L  +LY
Sbjct: 242 LGYVCPVVMYAIIPYYPKLQRILY 265

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  147 bits (372), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 124/230 (53%), Gaps = 4/230 (1%)

Query: 48  KTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHS 107
              F+ + S +  NQ+FAYNGN V+  LF ++  L ++F   +++  LP    + +   S
Sbjct: 50  SDKFWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLP----IEIRTIS 105

Query: 108 RVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDTLFVLXXXXXXXXXXXXXXETCRS 167
           R+ Q+  +    + K+Y  K  +K   L++ F  ID LFVL                CRS
Sbjct: 106 RIKQFQTKHYLRIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRS 165

Query: 168 NKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXXXXXXXXXX 227
             G+W GGFDISGHFCFL+T+SLI+W EL+KL + + S   +  +               
Sbjct: 166 GNGEWVGGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVSIL 225

Query: 228 XXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLYK 277
             W  +L +T++YYHTF EK+LGC++G++ P++MY  +P N      +YK
Sbjct: 226 ILWIVMLCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIYK 275

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  141 bits (356), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 125/247 (50%), Gaps = 17/247 (6%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y  +LL GE + LILG ET+E+ + ++Y LN  N +NQ+F ++G L+W LL  LV  L  
Sbjct: 20  YPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLALQY 79

Query: 85  HFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFK----QYFFKYCVKSASLFVIFF 140
           H  T        T  D P+ L +R     +R    +      Q   K  +    L  +F+
Sbjct: 80  HVRT--------TEFD-PLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQALFW 130

Query: 141 AIDTLFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLH 200
            +D LFV                 CR   G+W GGFDISGHFC ++ +SL+LW EL +L 
Sbjct: 131 FMDHLFVWTGGRCTVSDTKDSV-ACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQ 189

Query: 201 KRMESESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLL 260
           + M S+  ++     F             W  LL ITAIYYHTF EK+LG + G+ T L+
Sbjct: 190 RYMHSQEIQLR---KFAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLV 246

Query: 261 MYYTIPS 267
           +YY +P 
Sbjct: 247 IYYVLPR 253

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  137 bits (346), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 132/262 (50%), Gaps = 23/262 (8%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y FVL  G  LH+++  +  +  K   YF NSKN +NQ+FAY GNLVW +LF  +  L  
Sbjct: 15  YPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAVLSY 74

Query: 85  HFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDT 144
             +T++   L   +               ++ ++ + +QY +K  +K+  L++ F  ID 
Sbjct: 75  FIKTMSRDPLEQRAGG-------------RQVDWQIVRQYCWKLLLKNGLLYLCFLVIDG 121

Query: 145 LFV----LXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLH 200
           +F+    +              E+C+ N G+WE GFDISGHFCFL+ ISLILW EL  L 
Sbjct: 122 VFIATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQ 181

Query: 201 KRMESESFEVELNVVF------TXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLG 254
             +  E    E   ++                   W  LL++TA +YHT  EK++GC  G
Sbjct: 182 DAIRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFG 241

Query: 255 FVTPLLMYYTIPSNEFLNGLLY 276
           +V P +MY+ IP++  LN   Y
Sbjct: 242 YVCPFVMYHLIPTSPRLNEFFY 263

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  130 bits (328), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 125/251 (49%), Gaps = 7/251 (2%)

Query: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84
           Y  +++FG F+ +++G + LE  +  +Y++  +N +N +FAY G  ++ +LF L+  L +
Sbjct: 22  YPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQV 81

Query: 85  HFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDT 144
           +    + + LLPTS     G   R      +    + K Y  K+ +    L+  F  ID 
Sbjct: 82  YVRMKHEESLLPTSN----GEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDH 137

Query: 145 LFVLXXXXXXXXXXXXXXETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRME 204
           LFV               E CRS  G W GGFDISGHFCFL  ISL LW EL  L +   
Sbjct: 138 LFV-WTGGNCDLSDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYAN 196

Query: 205 SESFEVELNVVFTXXXXXXXXXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYT 264
             +  +  N   +            W  +L IT+IYYHTF EKVLGC  G+   L++YY 
Sbjct: 197 QHT--ISWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYI 254

Query: 265 IPSNEFLNGLL 275
           +P  + +N  L
Sbjct: 255 LPRIKHVNKFL 265

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHK 201
           C+ N G W GG D SGH   L  + +++  EL K+++
Sbjct: 225 CKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINR 261

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 163 ETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHK--------RMESES 207
             CR++ G W GG D SGH   L  + +++  E+ ++ K        R+E ES
Sbjct: 231 SNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPRIIKFKYLRSNGRIEDES 283

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 24/106 (22%)

Query: 163 ETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXXXXX 222
           + CR   G W GG D SGH  FL+T+ ++ +                  L +  +     
Sbjct: 238 QKCRKIGGAWSGGHDPSGHM-FLLTLMIMTF------------------LTISISKDNYL 278

Query: 223 XXXXXXXWFGLL-----WITAIYYHTFFEKVLGCMLGFVTPLLMYY 263
                   FGL+      +T   +HTF E++ G M  ++   L  Y
Sbjct: 279 FVRLIAAMFGLMSSYSFMVTIFNFHTFAEQITGFMAAYIPAGLYIY 324

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKR 202
           CRS  G W GG D SGH   +  + + L  EL  L KR
Sbjct: 206 CRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGKR 243

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKR 202
           CRS  G W GG D SGH   +  + + L  EL  + KR
Sbjct: 206 CRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQAIGKR 243

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 163 ETCRSNKGKWEGGFDISGHFCFLITISLILWCELY----KLHKRMESESF 208
           + CR   G W GG D SGH   +  +++ L  EL     K+ +R+ S S+
Sbjct: 206 QMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELRLFSDKVGRRLRSTSY 255

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 48/119 (40%), Gaps = 16/119 (13%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHK----RMESESFEVELNV------ 214
           C+   G W  G D SGH   L  ++  +  E  K+ +    ++  +  E + N+      
Sbjct: 119 CKKIGGNWINGHDPSGHIFLLSIMTTFMINEFSKIRRVSMTQLRQDFVETDWNLDRQLPV 178

Query: 215 -----VFTXXXXXXXXXXXXWFGLLWITAI-YYHTFFEKVLGCMLGFVTPLLMYYTIPS 267
                +              W+  L IT+I YYHT  E++ G +  ++    +Y  +PS
Sbjct: 179 KIILFISNNPVIIMLSFILLWWHSLVITSINYYHTLSEQLSGLLFAYIIMGPLYLFLPS 237

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 164 TCRSNKGKWEGGFDISGHFCFLITISLI 191
            CR N G W+GG D SGH  FL+T+ ++
Sbjct: 234 ACRLNGGYWQGGHDPSGHI-FLLTLMIL 260

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLI-LWCELYKLHKRMESE 206
           CR+  G W GG D SGH  FLIT+ ++ L  EL+   KR  S 
Sbjct: 205 CRTLGGYWVGGHDPSGHI-FLITLMIMYLLGELHIFGKRAFSR 246

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 163 ETCRSNKGKWEGGFDISGHFCFLITI 188
           + C+S  G W GG D SGH  FLIT+
Sbjct: 268 QKCKSLGGHWSGGHDPSGHI-FLITL 292

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 30.4 bits (67), Expect = 5.2,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 114 QRANYYLFKQYFFKYCVKSASLFVIFFAI 142
           +RAN+Y  K YF+    K+A + ++F AI
Sbjct: 365 ERANFYFKKFYFYAQAAKNAIIIIVFTAI 393

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 10/18 (55%), Positives = 12/18 (66%)

Query: 164 TCRSNKGKWEGGFDISGH 181
            CR+  G W+GG D SGH
Sbjct: 207 ACRATGGHWKGGHDPSGH 224

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 8/98 (8%)

Query: 165 CRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTXXXXXXX 224
           CR   G W GG D SGH      + + L  EL    +R  +  +  + +++         
Sbjct: 217 CRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRRALAHLYAQKWHLL--------G 268

Query: 225 XXXXXWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMY 262
                W  LL   A ++HT  E + G +  ++   ++Y
Sbjct: 269 MVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.145    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,148,964
Number of extensions: 1050406
Number of successful extensions: 3252
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3273
Number of HSP's successfully gapped: 43
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 65 (29.6 bits)