Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E011205.351ON73373339700.0
Kpol_339.125.351ON73373334010.0
Suva_15.2625.351ON73173032050.0
KAFR0D046705.351ON73172932020.0
Smik_8.1485.351ON73173031760.0
YHR072W (ERG7)5.351ON73173031610.0
KNAG0B045805.351ON72972731290.0
Skud_8.1315.351ON73172531200.0
TDEL0E027605.351ON73173131020.0
CAGL0J10824g5.351ON73373030870.0
NCAS0H016405.351ON72873230730.0
TBLA0A031205.351ON74372730700.0
NDAI0C019705.351ON73173230490.0
SAKL0G08844g5.351ON74673030330.0
ZYRO0D10164g5.351ON73273129710.0
KLLA0B10175g5.351ON73173029410.0
Kwal_34.159795.351ON72872429160.0
KLTH0H14850g5.351ON72672629150.0
Ecym_81825.351ON73273227650.0
AGR351W5.351ON72972926970.0
Suva_4.4318.570ON57276725.0
KLTH0E14608g3.322ON65390716.3
TPHA0I032307.533ON324142706.6
ZYRO0B07612g4.212ON60864708.0
KLTH0C10890g6.32ON75651709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E01120
         (733 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1533   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1314   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1239   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1238   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1228   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1222   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1209   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1206   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1199   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1193   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1188   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1187   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1179   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1172   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1149   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1137   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1127   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1127   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1069   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1043   0.0  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    32   5.0  
KLTH0E14608g Chr5 (1298047..1300008) [1962 bp, 653 aa] {ON} simi...    32   6.3  
TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON...    32   6.6  
ZYRO0B07612g Chr2 (598538..600364) [1827 bp, 608 aa] {ON} highly...    32   8.0  
KLTH0C10890g Chr3 complement(894335..896605) [2271 bp, 756 aa] {...    32   9.6  

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1533 bits (3970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/733 (100%), Positives = 733/733 (100%)

Query: 1   MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP 60
           MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP
Sbjct: 1   MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP 60

Query: 61  APNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120
           APNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI
Sbjct: 61  APNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120

Query: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180
           EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA
Sbjct: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180

Query: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240
           RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV
Sbjct: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240

Query: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA 300
           YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA
Sbjct: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA 300

Query: 301 NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS 360
           NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS
Sbjct: 301 NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS 360

Query: 361 KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY 420
           KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY
Sbjct: 361 KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY 420

Query: 421 KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH 480
           KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH
Sbjct: 421 KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH 480

Query: 481 NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV
Sbjct: 481 NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 541 ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA 600

Query: 601 MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV 660
           MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV
Sbjct: 601 MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV 660

Query: 661 LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA 720
           LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA
Sbjct: 661 LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA 720

Query: 721 LGLYVKNYGNDSI 733
           LGLYVKNYGNDSI
Sbjct: 721 LGLYVKNYGNDSI 733

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1314 bits (3401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/733 (83%), Positives = 673/733 (91%), Gaps = 3/733 (0%)

Query: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62
           +EFYSE+IGL KTDPK WRLRTD+LGRESWEYL   + D  D QS+YT+WLLQVP+FP P
Sbjct: 2   VEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDAD-KDPQSSYTQWLLQVPEFPTP 60

Query: 63  NPAINS--ESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120
           +P  NS  ++ N+ A +ACHNGASF+KLLQD  SG+FPCQYKGPMFM IGYIAVNYIAG+
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180
           +IPDHERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYVNLRLLGLSKDHPVCVKA
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240
           RDTL++LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPYSL IHPGRWWVHTRGV
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA 300
           Y+P+SYLSL +Y+CELTPLLAE+R EIYTK F+SIDFS+HRNTVCGVDLYYPHSK+LDVA
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 301 NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS 360
           NDC+VFYE YLRP+WV++KS+++VY+LIKKEIENTDYLCIAPVNQAFCALVTLIEEG++S
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 361 KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY 420
           + F+RF++R KDALFHGPQGMTVMGTNG QVWDCAF IQY+FVAGLAEKPEFYD I  AY
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 421 KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH 480
           +FLCRSQFDTEC PGSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS  F  +H
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 481 NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           ++ SDERL KGID+LMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 541 ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHKH  Y+KEEI+ RIKLAIDYIKSCQQ+DGSWYGCWGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 601 MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV 660
           MEAL TVGENY NSE VRKGCDFLV KQMEDGGW ESMKSSELH+YV SE+SLVVQTAWV
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 661 LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA 720
           L+ALLLA+YP KDVIDRGIQLLK RQ PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 721 LGLYVKNYGNDSI 733
           LGLY K Y ++ I
Sbjct: 721 LGLYTKAYSDNGI 733

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1239 bits (3205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/730 (79%), Positives = 647/730 (88%), Gaps = 1/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           EFYSE+IGLPKTDP+ WRLRTD+LGRESWEYL   E   ND  ST+T+WLLQ PDFP P+
Sbjct: 3   EFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTP-EQAANDPPSTFTQWLLQDPDFPQPH 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           PA N  S +F A +ACHNGASF+KLLQ+P SG+FPCQYKGPMFM IGY+AV+YIAGI+IP
Sbjct: 62  PAKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQIP 121

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGLSKDHPVCVKARDT
Sbjct: 122 EHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARDT 181

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L+RLGGAIGAPHWGK+WLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP
Sbjct: 182 LLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 241

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLSL K+ C +TPLL E+R EIYTK F+ I+FS HRNTVCGVDLYYPHSK+L++AN+ 
Sbjct: 242 VSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANNF 301

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLR  ++Y  S++ VY+L+KKEIENTD LCIAPVNQAFCALVTLIEEG +S+ F
Sbjct: 302 VVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQAF 361

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
           + FQYR KDALFHGPQGMT+MGTNG Q WDCAF IQY+F AGLAE+PEF+D I +AYKFL
Sbjct: 362 KDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKFL 421

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CRSQFDTEC PGSFRDKR GAWGFSTKTQGYTVSDCTAESIKAIIMVRNSP F+ +H+  
Sbjct: 422 CRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHLI 481

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           ++ERL++GID+L++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 482 TNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVECT 541

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHK +DYKKEEIS  I++AI+YIK  Q  DG WYG WGICFTYAGMFA+EA
Sbjct: 542 DSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALEA 601

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L TVGE Y+NS  VRKGCDFLV KQMEDGGW ESMKSSELH+YV SE SLVVQTAW LIA
Sbjct: 602 LHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALIA 661

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           LL A+YP ++VIDRGI+LLK RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 662 LLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 724 YVKNYGNDSI 733
           Y K Y  +S+
Sbjct: 722 YTKAYEPESL 731

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/729 (78%), Positives = 645/729 (88%), Gaps = 1/729 (0%)

Query: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64
           FYS+++GL KTDP+ WRLRTD+LGR++W+Y+ + + + +D Q+T+ +WLLQ+P FP+PNP
Sbjct: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAE-SDPQTTFVQWLLQLPGFPSPNP 62

Query: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124
            I +   +F A++AC+NGA+F+KLLQD  SG+FPCQYKGPMFM IGY+AVNYIAGIEIP+
Sbjct: 63  DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPE 122

Query: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184
           HE+IE+IRYIVNT+HPVDGGWGLHSVDKST FGTA+NYV LRLLGLSK H VCV+ARDTL
Sbjct: 123 HEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTL 182

Query: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244
           +RLGGAIG PHWGKIWLS LNLY WEGVNPAPPETWLLPY LPIHPGRWWVHTRGVY+P+
Sbjct: 183 LRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPI 242

Query: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304
           SYLSL +Y+ E TPLL EIR EIY K F+ I+FS+HRNTVCGVDLYYPHS LLD AN  +
Sbjct: 243 SYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAI 302

Query: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364
           V YE +LRP W+ EKSRK++YELI+KE +NTDYLCIAPVNQAFCAL TLIEEG  SK F 
Sbjct: 303 VLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFR 362

Query: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424
           ++Q R KDALFHGPQGMTV GTNG Q WDCAF IQY F+AGLAE+PEFYDA+SAA+KFLC
Sbjct: 363 KYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLC 422

Query: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484
           RSQFDTEC PGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSP FAKIH+E +
Sbjct: 423 RSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEIT 482

Query: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544
           DERL KGIDIL+ LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVECTD
Sbjct: 483 DERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTD 542

Query: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604
           SSVLGLTYFH+HY Y+ EEIS RI+LAI YIK+ QQ DGSWYG WGICFTYAGMFAMEAL
Sbjct: 543 SSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEAL 602

Query: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664
           ++VGE Y+NS+ V KGCDFLV KQM DGGWSESMKSSELHTYVS++ SLVVQTAWVLIAL
Sbjct: 603 QSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIAL 662

Query: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724
           LLAKYP K VIDRGI LLKSRQ+PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKALGLY
Sbjct: 663 LLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 722

Query: 725 VKNYGNDSI 733
           VK YG   I
Sbjct: 723 VKEYGAQGI 731

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/730 (77%), Positives = 646/730 (88%), Gaps = 1/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           EFYSE IGLPKTDP+ WRLRTDE+GRESWEYL   E   N+  ST+T+WLLQ P+FP P 
Sbjct: 3   EFYSETIGLPKTDPRLWRLRTDEIGRESWEYLT-SEQAANEPPSTFTQWLLQDPEFPHPQ 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P  N  S NF A +ACHNGASF+KLLQ+P SG+FPCQYKGPMFM IGY+AVNYIAGI+IP
Sbjct: 62  PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIP 121

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGTALNYV LRLLGL KDHPVCVK+R+T
Sbjct: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNT 181

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L+RLGGA+G+PHWGKIWLSALNLY+WEGVNPAPPETWLLPYSLP+HPGRWWVHTR VYIP
Sbjct: 182 LLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIP 241

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLSL K+TC +TPLL E+R EIYTK F+ I FSKHRNTVCGVDLYYPHSK L++AN+ 
Sbjct: 242 VSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNF 301

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLR  ++Y  S++ VY+L++KEI+NTD LCIAPVNQAFCALVTLIEEG +S+ F
Sbjct: 302 VVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAF 361

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
           ++FQYR KDALFHGPQGMT+MGTNG Q WDCAF IQY F+AGLAE+ EFY+ I +AYKFL
Sbjct: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFL 421

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CR+QFDTEC PGSFRDKR GAWGFSTKTQGY VSDCTAE+IKAIIMV+NSP F ++HN  
Sbjct: 422 CRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMI 481

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           S+ERL++GID+L++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 482 SNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECT 541

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHK++DYKKEEI  RI++AI++IK  Q  +GSWYG WGICFTYAGMFA+EA
Sbjct: 542 DSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALEA 601

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L TVGE Y+NS  VRKGCDFLV KQM+DGGW ESMKSSELH+YV SE+SLVVQTAWVLIA
Sbjct: 602 LHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIA 661

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           LL A+YP KDVIDRGI+LLK+RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 662 LLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 724 YVKNYGNDSI 733
           Y K Y   ++
Sbjct: 722 YSKAYEQHAL 731

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1222 bits (3161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/730 (77%), Positives = 642/730 (87%), Gaps = 1/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           EFYS+ IGLPKTDP+ WRLRTDELGRESWEYL   +   ND  ST+T+WLLQ P FP P+
Sbjct: 3   EFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQA-ANDPPSTFTQWLLQDPKFPQPH 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P  N  S +F A +ACHNGASF+KLLQ+P SG+FPCQYKGPMFM IGY+AVNYIAGIEIP
Sbjct: 62  PERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEIP 121

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDHPVC KAR T
Sbjct: 122 EHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARST 181

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L+RLGGAIG+PHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTRGVYIP
Sbjct: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLSL K++C +TPLL E+R EIYTK F+ I+FSK+RNTVCGVDLYYPHS  L++AN  
Sbjct: 242 VSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANSL 301

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLR  ++Y  S+K VY+LIK E++NTD LCIAPVNQAFCALVTLIEEG +S+ F
Sbjct: 302 VVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEAF 361

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
           +R QYR KDALFHGPQGMT+MGTNG Q WDCAF IQY+FVAGLAE+PEFY+ I +AYKFL
Sbjct: 362 QRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKFL 421

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           C +QFDTEC PGS+RDKR GAWGFSTKTQGYTV+DCTAE+IKAIIMV+NSP F+++H+  
Sbjct: 422 CHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHMI 481

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           S ERL++GID+L++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 482 SSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECT 541

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHK++DY+KEEI  RI++AI++IK  Q  DGSWYG WGICFTYAGMFA+EA
Sbjct: 542 DSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALEA 601

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L TVGE Y+NS  VRKGCDFLV KQM+DGGW ESMKSSELH+YV SE+SLVVQTAW LIA
Sbjct: 602 LHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALIA 661

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           LL A+YP+K+VIDRGI LLK+RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 662 LLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 724 YVKNYGNDSI 733
           Y + Y   ++
Sbjct: 722 YSRAYETHTL 731

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1209 bits (3129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/727 (77%), Positives = 637/727 (87%), Gaps = 6/727 (0%)

Query: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62
           I  YSEQ+GLP+TDPK WRLRTDELGRE+W+Y+ E + ++ D QS++T+WLLQ+ D    
Sbjct: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEM-DPQSSFTQWLLQIRDTETS 62

Query: 63  NPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122
            P          A ++C NGA+F+K LQDP SGMFPCQYKGPMFM IGYIAVNYIAGIEI
Sbjct: 63  AP-----KEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEI 117

Query: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182
           P HER+E+IRYIVNTSHPVDGGWGLHSVDKSTVFGT LNYV LRLLGL +DHPVC+KARD
Sbjct: 118 PKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARD 177

Query: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242
           TL+RLGGAIGAPHWGKIWLS LNLYKWEGVNPAPPETWLLPY LPIHPG+WWVHTRGVY+
Sbjct: 178 TLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYL 237

Query: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302
           P+SYLSL  Y+CELTPLL EIR EIYTK F+SIDFSKHRNTVCGVDLYYPHSK+LD+AN+
Sbjct: 238 PISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANN 297

Query: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362
            ++FYE YLRP W+Y+KS+  VY LI+KEI+NTDYLCIAPVNQAFCALVTLIEEG +S+ 
Sbjct: 298 AIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEA 357

Query: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422
           F +F+ R KDALFHGPQGMTVMGTNG Q WDCAF +QY+FVAGLAE+PEFY+ I AAY+F
Sbjct: 358 FTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRF 417

Query: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482
           L RSQFDTEC PGSFRDKR G+WGFSTKTQGYTVSDCTAE+IKAIIMV+N+P F+ +H+E
Sbjct: 418 LIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDE 477

Query: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
             D RLY+GID+L+SLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVEC
Sbjct: 478 IEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVEC 537

Query: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602
           TDSSVLGLT+FHK+Y Y+ EEIS+RI++AI+Y+K  Q+ DGSWYGCWGIC+TYAGMFA+E
Sbjct: 538 TDSSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALE 597

Query: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLI 662
           AL +V ENY NS +VRKGCDFLV KQ+ DGGW ESMKSSELH+YVS+  SLVVQTAW +I
Sbjct: 598 ALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVI 657

Query: 663 ALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALG 722
           ALLLA+YP K VI+RGI+LL+SRQ PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG
Sbjct: 658 ALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 717

Query: 723 LYVKNYG 729
           LY K Y 
Sbjct: 718 LYNKTYA 724

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1206 bits (3120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/725 (78%), Positives = 642/725 (88%), Gaps = 1/725 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           EFYSE+IGLPKTDP+ WRLRTDELGRESWEYL   E   N+  ST+T+WLLQ P+F  P 
Sbjct: 3   EFYSERIGLPKTDPRLWRLRTDELGRESWEYLTP-EQAANEPPSTFTQWLLQDPNFSQPQ 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P  N  S +F A +ACHNGASF++LLQDP SG+FPCQYKGPMF+ IGY+AVNYIAG++IP
Sbjct: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDHPVC KAR T
Sbjct: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L+RLGGAIG+PHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTRGVYIP
Sbjct: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLSL K++C +TPLL EIR EIYTK F+ IDFS HRNTVCGVDLYYPHS+ LD+AN+ 
Sbjct: 242 VSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNF 301

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLR  ++Y  S++ VY+LIK EIENTD LCIAPVNQAFCALVT IEEG +S+ F
Sbjct: 302 VVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAF 361

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
           ++FQYR KDALFHGPQGMT+MGTNG Q WDCAF IQY+F+AGLAE+PEFY+ I +AYKFL
Sbjct: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFL 421

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CR+QFDTEC PGSFR+KR G+WGFSTKTQGYTV+DCTAESIKAIIMV+NSP F+++H+  
Sbjct: 422 CRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLI 481

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           + ERL++GID+L+SLQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 482 TSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECT 541

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHK +DYKKEEI +RI++AI+YIK  Q  DGSWYG WGICFTYAGMFAMEA
Sbjct: 542 DSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAMEA 601

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L TVGENY+NS  VRKGCDFLV KQM+DGGW ESMKSSELH+YV S +SLVVQ+AW LIA
Sbjct: 602 LHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIA 661

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           L  A+YP+K+VIDRGI+LLK+RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 662 LFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721

Query: 724 YVKNY 728
           Y K Y
Sbjct: 722 YAKAY 726

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1199 bits (3102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/731 (76%), Positives = 634/731 (86%), Gaps = 1/731 (0%)

Query: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62
           ++FYSE++GL +TDP  WRLRTDELGRE+W YL   +   NDEQ T+T+WLLQ   FP P
Sbjct: 2   VQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAK-NDEQCTFTQWLLQSEKFPKP 60

Query: 63  NPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122
           +P  +S + +FKA +AC NGASF+KLLQDP SG+FPCQYKGPMF+ IGY+AV+YI+G  I
Sbjct: 61  SPNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTI 120

Query: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182
           P+HERIE+IRYIVNT+HPVDGGWGLHSVDKST FGT +NYV LRLLGL KDHPVC+KAR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARA 180

Query: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242
            LM+LGGAIGAPHWGKIWLS LNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTR +Y+
Sbjct: 181 LLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYL 240

Query: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302
           PVSYLSL +Y+C L  LL E+R+EIY K F+SI+FS +RNTVCG+DLYYPH+ +L++AN+
Sbjct: 241 PVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANN 300

Query: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362
            +VFYE +LRP W+ +K++  VY LIKKEI NTDYLCIAPVNQAFCALVT IEEGK S  
Sbjct: 301 VMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSA 360

Query: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422
           F++F+ R+KDALFHGPQGMT+MGTNG Q WDCAF IQY+FVAGLAEKPE+YD I AAYKF
Sbjct: 361 FKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKF 420

Query: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482
           LCR+QFDTEC  GSFRDKRVGAW FSTK QGYTVSDCTAE+IKAIIMVRNSP FA I NE
Sbjct: 421 LCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNE 480

Query: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
            +DERL KGID+L+SLQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVEC 540

Query: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602
           TDSSVLGLTYFH  YDY+KEEISKRIKLAIDYIK  Q +DGSWYGCWG+C++YAGMFAME
Sbjct: 541 TDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAME 600

Query: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLI 662
           AL +VGENY NSE VRKGCDFLV +Q+ DGGW ESMKSSELH+YVS+  SLVVQTAWVLI
Sbjct: 601 ALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLI 660

Query: 663 ALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALG 722
           ALLL KYP+K VID GI+LLK RQ  +GEWKFE +EGVFNHSCAIEY SYRFLFPIKALG
Sbjct: 661 ALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 723 LYVKNYGNDSI 733
           LY   YG+DSI
Sbjct: 721 LYTATYGDDSI 731

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/730 (78%), Positives = 633/730 (86%), Gaps = 4/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           +FYS+ +G+P+TDPK WRLRT ELGRE+WEY+++ +VD  D QST+ +WLLQ  +FP P+
Sbjct: 3   QFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDA-DPQSTFVQWLLQDEEFPTPS 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P    E  +  +E AC+ GASFYKLLQD  SG+FPCQYKGPMFM IGY+AVNYIAG+++P
Sbjct: 62  P--RKEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKLP 119

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDH VCV+AR T
Sbjct: 120 EHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARHT 179

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L RLGGA GAPHWGKIWLS LNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTR VY+P
Sbjct: 180 LHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYLP 239

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLSL KY+C LT LL+EIR EIYTK F+ I+FS+HRNTVCGVDLYYPHSK+LD AND 
Sbjct: 240 VSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTANDV 299

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLRP  V   S+K VY LIKKEI+NTD LCIAPVNQAFCALVT +EEGK+SK F
Sbjct: 300 IVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKAF 359

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
           ERFQYR KD LFHGPQGMTVMGTNG Q WDCAF IQY+FVAGLAEKPEF + I  AYKFL
Sbjct: 360 ERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKFL 419

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CRSQFDTEC  GSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNSP F+ +H+E 
Sbjct: 420 CRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDEI 479

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           +DERL KGID+L+SLQN+G FEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 480 TDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVECT 539

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHK+YDY+K+EIS RI++AIDYIK  QQ DG WYGCWGICFTYAGMFAMEA
Sbjct: 540 DSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEA 599

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L +VGE Y NS  VRKGCDFL+ KQM DGGW ESMKSSELH YV S +SLVVQTAW LIA
Sbjct: 600 LHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIA 659

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           LLLAK P++D I+RGI LLKSRQQPSGEWKFE  EGVFNHSCAIEY SYRFLFPIKALGL
Sbjct: 660 LLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGL 719

Query: 724 YV-KNYGNDS 732
           Y  +NY N S
Sbjct: 720 YNGRNYTNSS 729

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/732 (75%), Positives = 631/732 (86%), Gaps = 5/732 (0%)

Query: 1   MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP 60
           M+ + YS+++GL KTDP  WRLRT+ LGR +WEY+   E   ND QST+TKWLLQ+PDFP
Sbjct: 1   MSAKLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINS-EQKTNDPQSTFTKWLLQLPDFP 59

Query: 61  APNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120
           AP P          A  AC++GASF++LLQD  SG FPCQYKGPMFM IGY+AVNYIAG+
Sbjct: 60  APTPTTEEPRT---AREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGL 116

Query: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180
           EIP+HERIE+IRY+VNT+HPVDGGWGLHS DKSTVFGT +NYV LRLLG+SKDH VC +A
Sbjct: 117 EIPNHERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRA 176

Query: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240
           R TL+ LGGAIGAPHWGK+WLS LNLYKWEGVNPAPPETWLLPY LPIHPGRWWVHTRGV
Sbjct: 177 RKTLLSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGV 236

Query: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYT-KDFESIDFSKHRNTVCGVDLYYPHSKLLDV 299
           Y+P+SYLSL  ++CELTPLL EIR EIYT + FE+I F+++RN VCGVDLYYPHS++LDV
Sbjct: 237 YLPISYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDV 296

Query: 300 ANDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKN 359
           AN C+V YE YLRP W+ + S++ VYELIKKEI NTDYLCIAPVNQAFCALVTLIEEG +
Sbjct: 297 ANACIVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVD 356

Query: 360 SKQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAA 419
           S  F++F YR KD+LFHGPQGMTVMGTNG QVWDCAF IQY+FVAGLAEK EFYD I++A
Sbjct: 357 SNAFQKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASA 416

Query: 420 YKFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKI 479
           Y FLCRSQFDTEC  GSFRDKRVG+WGFSTKTQGYTVSDCTAESIKAIIMV+NSP F  I
Sbjct: 417 YAFLCRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAI 476

Query: 480 HNEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPY 539
           H+  +DE++Y+GID+L+SLQN+GSFEYGSFATYEKIKAPLF+E LNPAEVFGNIMVEYPY
Sbjct: 477 HHLITDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPY 536

Query: 540 VECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMF 599
           VECTDSSVLGLTYFH +Y+Y+  EIS+RIK+A+DYIK  Q  DGSWYG WGIC+TYAGMF
Sbjct: 537 VECTDSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMF 596

Query: 600 AMEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAW 659
           AMEAL +VGE Y NS VV+KGCDFLV +QM DGGW E MKSSELHTYV+SERS VVQTAW
Sbjct: 597 AMEALHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAW 656

Query: 660 VLIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIK 719
           V+IALLLAKYP KDVI +G++LLKSRQ+PSGEWKFE  EGVFNHSCAIEY SYR LFPIK
Sbjct: 657 VVIALLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIK 716

Query: 720 ALGLYVKNYGND 731
           ALGLY + Y  +
Sbjct: 717 ALGLYAEIYDKE 728

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1187 bits (3070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/727 (76%), Positives = 625/727 (85%), Gaps = 4/727 (0%)

Query: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64
            YS+++ LPKTDP+ WRL TD+LGRESWEYL E E      QST+ KWLLQ+PDFP P P
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSE-EDSKKIPQSTFVKWLLQIPDFPTPKP 72

Query: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124
            I     NF   +A  NGA+F+KLLQDP SG+FPCQYKGPMF+ IGY+AV YIAGI+IP+
Sbjct: 73  KIKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPE 132

Query: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184
           HER+E+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGL K HPVCVKAR TL
Sbjct: 133 HERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTL 192

Query: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244
           +RLGGAIG+PHWGKIWLS LNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVY+PV
Sbjct: 193 IRLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPV 252

Query: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304
           SYL LTK+ C  TPL+ EIR EIY  ++++IDFSKHRNTVCGVDLYYPHSK+LDVAN+ L
Sbjct: 253 SYLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNIL 312

Query: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364
           VFYE ++RP ++Y KS++ V +LI+KEI NTDYLCIAPVNQAFC+LV L+E+G NSK+FE
Sbjct: 313 VFYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFE 372

Query: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424
           R QYR KDALFHGPQGMTVMGTNG Q WDCAF +QY+F+AGLAE+PEF D I  +YKFLC
Sbjct: 373 RCQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLC 432

Query: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484
           RSQFDTEC PGSFRDKR+G WGFSTKTQGYTVSDCTAESIKAIIMVRNSP F ++H+E S
Sbjct: 433 RSQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEIS 492

Query: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544
           DERLY+GI+ILMSLQNLG FEYGSFATYEKIKAPL ME LNPAEVF NIMVEYPYVECTD
Sbjct: 493 DERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTD 552

Query: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604
           SSVLGLTYFHKHYDYK +EI KRI+LAIDYIK  Q  DGSWYG WGICFTYA MFA+EAL
Sbjct: 553 SSVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEAL 612

Query: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSS---ERSLVVQTAWVL 661
           ET+GE+Y NSE V+KGCDF+V KQ +DGGWSE+MKSSE+H YV S   E S VVQT+W +
Sbjct: 613 ETIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSV 672

Query: 662 IALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKAL 721
           I L+LA YP KDV+ RGI+ +KS+Q PSGEW+F+ VEGVFNHSC IEY SYRFLFPIKAL
Sbjct: 673 IGLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKAL 732

Query: 722 GLYVKNY 728
           GLY   Y
Sbjct: 733 GLYRTRY 739

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/732 (76%), Positives = 628/732 (85%), Gaps = 3/732 (0%)

Query: 1   MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP 60
           MA + YSE++GL KTDP  WRLRT+  GR+SWEY+ + +   ND QS +TKWLLQ+PDFP
Sbjct: 1   MANKLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSP-NDPQSNFTKWLLQLPDFP 59

Query: 61  APNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120
            P    N +  +  AE  C  GA F++LLQD TSG FPCQYKGPMFM IGY+AVNY+A I
Sbjct: 60  TPQYPDNIKDVS--AEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADI 117

Query: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180
           +IP+ ERIE+IRYIVNT+HPVDGGWGLHS DKSTVFGT LNY+ LRLLGL  +HPVC+KA
Sbjct: 118 KIPESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKA 177

Query: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240
           RDTL+RLGGAI APHWGK+WLS LNLYKWEGVNPAPPETWLLPY +PIHPGRWWVHTRGV
Sbjct: 178 RDTLLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGV 237

Query: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA 300
           Y+P+SYLSL  Y CELT LL EIR+EIY K F+SIDFSKHRNTVCGVDLYYPHSK LD A
Sbjct: 238 YLPISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFA 297

Query: 301 NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS 360
           N  +V YE YLRP  + + S+  VY+LIKKEIENTDYLCIAPVNQAFCALVTL+EEG +S
Sbjct: 298 NSLIVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADS 357

Query: 361 KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY 420
           K FERFQYR KDALF GPQGMTVMGTNG Q WDCAF IQY FVAGLA++PEFY+ IS AY
Sbjct: 358 KAFERFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAY 417

Query: 421 KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH 480
           KFLCRSQFDT+C  GSFRDKR GAWGFSTKTQGYTVSDCTAESIKAIIMVRNS  F  IH
Sbjct: 418 KFLCRSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIH 477

Query: 481 NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           +E SDERLYK +DIL+ LQN GSFE+GSFATYEKIKAPLF+EALNPAEVFGNIMVEYPYV
Sbjct: 478 DEISDERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYV 537

Query: 541 ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT FHKHY+Y+K+EISKRI +AI+YIK  Q+ DGSWYG WGIC+TYAGMFA
Sbjct: 538 ECTDSSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFA 597

Query: 601 MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV 660
           MEAL +VGE Y NS VV+KGCDFLV +Q+EDGGW ESMKSSELHTYVS++ SLVVQTAWV
Sbjct: 598 MEALHSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWV 657

Query: 661 LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA 720
           ++ALLLA+YP+K++ID+GI LLK RQQ SGEWKFE  EGVFNHSCAIEY SYRFLFPIKA
Sbjct: 658 VLALLLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKA 717

Query: 721 LGLYVKNYGNDS 732
           LGLY + Y +++
Sbjct: 718 LGLYSQIYEHNA 729

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/730 (75%), Positives = 619/730 (84%), Gaps = 2/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           + YS+Q+GLPKTDP  WRL TDELGRE+WEYL   E    + QS+Y K+LLQ+PDFPAP 
Sbjct: 19  KLYSDQLGLPKTDPTRWRLHTDELGRETWEYLST-EQAAKEPQSSYVKYLLQLPDFPAPK 77

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P   SE   F A +A +NGA F +LLQ+  SG+FPCQYKGPMF+ IGY+A  Y AGIEIP
Sbjct: 78  PERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEIP 136

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HER E++RYIVN +HPVDGGWGLHS DKST FGT++NYV LRLLGL  DH VC +AR T
Sbjct: 137 EHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARST 196

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L++LGGAIGAPHWGKIWLS LNLY WEGVNPAPPE WLLPY+LPIHPGRWWVHTR VY+P
Sbjct: 197 LLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMP 256

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           V YLS  K+ CELTPLL EIRTEIYTK++++IDFSKHRNTVCG+DLYYPH+KLLDVAN  
Sbjct: 257 VGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWG 316

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +VFYE YLRP W    + K VYELIKKEI NTDYLCIAPVN AFCA+VTLIEEG +S +F
Sbjct: 317 MVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEF 376

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
            RF+ R KD LFHGPQGMT+MGTNG QVWDCAF +QY F+A LAE PEF   I  AYKFL
Sbjct: 377 NRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKFL 436

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CRSQFDTECEPGSFRDKRVG W FSTKTQGYTVSDCTAE++KAIIMVRNSP F +  NE 
Sbjct: 437 CRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEI 496

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           SDERLYK +DIL++LQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVECT
Sbjct: 497 SDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECT 556

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYFHKHYDY+K++I+  IK+AIDYIK  Q K+GSWYG WG+CFTYAGMFA+EA
Sbjct: 557 DSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALEA 616

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L TVGENY+NSEVVRKGCDFLV +QMEDGGW ES KSSELH YVSSE+SLVVQTAW +I 
Sbjct: 617 LYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIG 676

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           LLLA+YP K VIDRGIQLLKSRQ PSGEWKFE +EGVFNHSC IEY SY+FLFPIKALGL
Sbjct: 677 LLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGL 736

Query: 724 YVKNYGNDSI 733
           Y K YGND+I
Sbjct: 737 YAKRYGNDAI 746

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/731 (72%), Positives = 617/731 (84%), Gaps = 2/731 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           + YSE++ L +TDP  WRLR D+LGRESWEY+ + +   ND QS Y +WLLQ+P FP P+
Sbjct: 3   KLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAK-NDPQSKYVQWLLQLPSFPKPS 61

Query: 64  PAINSESAN-FKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122
           P I+S +A  F A  AC NGASFY+LLQDP SG+FPCQYKGPMFM IGY+ V+Y+AGIEI
Sbjct: 62  PKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIEI 121

Query: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182
           P  +R+EMIRYIVNTSHPVDGGWGLHS DKSTVFGTA+NYVNLRLLGL +DHPVCVKAR 
Sbjct: 122 PKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKARR 181

Query: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242
           TL +LGGA+GAPHWGKIWLS LNLYKWEGVNPAPPETWLLPY LPIHPGRWWVHTR +Y+
Sbjct: 182 TLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIYL 241

Query: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302
           PVSYLSL +Y C LTPLL E+R E+Y K F SIDF  +RNTVCGVDLYYPHSK+LD+ N 
Sbjct: 242 PVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMNS 301

Query: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362
            LVFYE +LR  W+   ++  VY LIKKEI NTDYLCIAPVNQAFCALVTLIEEG NS Q
Sbjct: 302 VLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSPQ 361

Query: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422
           F+RFQ+R  DALFHGPQGMT+MGTNG Q WDCAF IQ  F AGLAEK ++Y+ +  AY+F
Sbjct: 362 FKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYEF 421

Query: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482
           L R+QF  EC PGSFRD R GAWGFSTKTQGYTVSDCTAESIKAIIMV+ SP +AK+H+ 
Sbjct: 422 LNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHSL 481

Query: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
             DERL + ID+L+SLQN+G FEYGSFATYE IKAPL ME LNPAEVFGNIMVEYPYVEC
Sbjct: 482 IDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVEC 541

Query: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602
           TDS+VLGLT FH + DY+++EIS RI +A+DYIK CQ +DGSWYGCWG+CFTYAGMFA+E
Sbjct: 542 TDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALE 601

Query: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLI 662
           AL +VGE+Y NS++V+KGCDFLV +QM DGGW E+MKS ELHTYV S+ S+VVQT+WV+I
Sbjct: 602 ALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVII 661

Query: 663 ALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALG 722
           ALLL+KYP+K VIDR ++ L++RQ+ SGEWKF+ VEGVFNHSCAIEY +YRF+FPIKALG
Sbjct: 662 ALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALG 721

Query: 723 LYVKNYGNDSI 733
           LYV  +G ++I
Sbjct: 722 LYVNAFGKEAI 732

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/730 (72%), Positives = 606/730 (83%), Gaps = 1/730 (0%)

Query: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63
           E YSE IGLP+TDPK WRL TD+LGR++WEYL E +      QST+ +WLL+  DFP P+
Sbjct: 3   ELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSK-KVPQSTFARWLLKCEDFPEPH 61

Query: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123
           P INS+++ F A NA HNGA F++LLQDP SG FPCQYKGPMFM IGY+   YIA IEIP
Sbjct: 62  PEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIP 121

Query: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183
           +HE+ EMIRY+ N +HPVDGGWGLH VDKSTV GT LNYV +RLLGL KDH VCV+ARDT
Sbjct: 122 EHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDT 181

Query: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243
           L+RLGGAI +PHW KIWLS LNLYKWEGVNPAPPE W+LPY L IHP RWWVHTRG+Y+P
Sbjct: 182 LLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLP 241

Query: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303
           VSYLS T+Y+CEL PLL EIRTEIYT+ FE+IDF KHRNTVCGVDLYYPH+K+LD  N  
Sbjct: 242 VSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYF 301

Query: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363
           +  YE Y+RP W+ +KS   VYEL+KKEI NTDYLCIAPVN AFCA+VTLIEEGK+S++F
Sbjct: 302 ISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEF 361

Query: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423
            RF YR KD LFHGPQG+TVMGTNG QVWDCAF+IQY F+AGLAE PEF++ I  ++KFL
Sbjct: 362 GRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFL 421

Query: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483
           CRSQF  +C  GSFRDKR+GAW FSTKTQGYTVSDCTAE+IKAIIMV NS  +  +   +
Sbjct: 422 CRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVY 481

Query: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
             E+L  GID+L+ LQNL SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVECT
Sbjct: 482 DTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECT 541

Query: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLTYF ++++Y+K++I   I  AI YIK  QQ +GSWYGCWGIC+TYAGMFA+EA
Sbjct: 542 DSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEA 601

Query: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663
           L T+GE Y+NSEVVRKGCDF V KQ+ DGGWSE MKSSELHTYVS + S VVQTAWVLI 
Sbjct: 602 LNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIG 661

Query: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723
           L+LAK+P K VIDR I LLK RQQPSGEWK+E VEGVFNHSCAIEY SYRFLFPIKALGL
Sbjct: 662 LILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGL 721

Query: 724 YVKNYGNDSI 733
           YVK YG+ +I
Sbjct: 722 YVKEYGHSAI 731

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/724 (73%), Positives = 604/724 (83%), Gaps = 2/724 (0%)

Query: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64
            YSE++GLPKTD K WRL+TD LG E WEYL E E      QS Y K+LLQ+PDF AP P
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAK-QQPQSAYVKYLLQLPDFEAPKP 60

Query: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124
           A+N  SA+F A++A  NGA F+ LLQ+  SG+FPCQYKGPMFM IGY+A  Y A + IP 
Sbjct: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119

Query: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184
             + E+IRYIVN+SHPVDGGWGLH VDKST FGT +NYV LRLLGL  D+ VC +AR TL
Sbjct: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179

Query: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244
            RLGGA+GAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+LPIHPGRWWVHTR +Y  +
Sbjct: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239

Query: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304
            YLS  KY+C +TPLL EIR EIYT+ FESIDFSK +N VCGVDLYYPH++LL++AN  +
Sbjct: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299

Query: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364
           +FYE YL+P+W  + S + VYELIKKEI+NTDYLCIAPV+ AFCA+VTLIEEG++S +F+
Sbjct: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359

Query: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424
           RF  R +D LF GPQGMTVMGTNG QVWDCAF IQYYFVAGLAE PEF++ I  AYKFLC
Sbjct: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419

Query: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484
           RSQFDTECEPGSFRDKR+GAW FSTKTQGYTVSDCTAES+KAIIMVRNSP+FA + +E S
Sbjct: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479

Query: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544
           DERLYK +D+L++LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTD
Sbjct: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539

Query: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604
           SSVLGLTYF KHY Y++EEI K I++AI YIK+ Q+ DGSWYGCWGICFTYAGMFA+EAL
Sbjct: 540 SSVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEAL 599

Query: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664
            TV E Y+NSEVV+KGCDFLV KQ  DGGWSESMKSSELH+YV S  S  VQTAW LI L
Sbjct: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659

Query: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724
           LLA+YP+K++ID+GI LLK RQ  SGEWKFEEVEGVFNHSCAIEY SY+FLFPIKALGLY
Sbjct: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719

Query: 725 VKNY 728
            K Y
Sbjct: 720 AKKY 723

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/726 (73%), Positives = 601/726 (82%), Gaps = 2/726 (0%)

Query: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62
           ++ Y++++GLP TD   WRLRTDELG E WEYL E E    D QS+Y K+LLQ PDF AP
Sbjct: 1   MKLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAK-ADPQSSYVKYLLQNPDFEAP 59

Query: 63  NPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122
            P  +S+   F A +A  NGA F+ LLQ+ T G+FPCQYKGPMF+ IGY+A  Y A I +
Sbjct: 60  EPLRSSKCDEFTAGDAAFNGAQFFSLLQEDT-GIFPCQYKGPMFLTIGYVATLYCARIPV 118

Query: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182
           P+H +IE+IRYIVN++HPVDGGWGLH VDKST FGTA+NYV LRLLGL  DH VC +AR 
Sbjct: 119 PEHIKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARK 178

Query: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242
           TL RLGGAIGAPHWGK WLS LNLY+WEGVNPAPPE WLLPY+LPIHPGRWWVHTR VY 
Sbjct: 179 TLHRLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQ 238

Query: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302
            + YLS  KY CELTPLL EIR EIY K FESIDFSKH+NTV GVDLYYPH+KLL++AN 
Sbjct: 239 ALGYLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANV 298

Query: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362
            L  YENYL+P W  + S + VYELIKKEI+NTDYLCIAPV+ AFCA+VTLIEEG++S +
Sbjct: 299 ALTLYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYE 358

Query: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422
           F+RF    ++ LF GPQGMTVMGTNG QVWDCAF IQYYFVAGLAE PEF D I  AYKF
Sbjct: 359 FKRFVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKF 418

Query: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482
           LCRSQFDTECEPGSFRDKRVGAW FSTKTQGYTVSDCTAE++KAIIMVRNSP F  +  E
Sbjct: 419 LCRSQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGE 478

Query: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
            SDERLYK +DIL+ LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVEC
Sbjct: 479 ISDERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVEC 538

Query: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602
           TDSSVLGLTYF K+Y+Y+K+EI+K I++AI YIK  Q  DGSWYGCWG+CFTYAGMFA+E
Sbjct: 539 TDSSVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALE 598

Query: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLI 662
           AL TVGENY+NSEVVRKGCDF   +Q  DGGWSESMKSSELHTYV ++ S VVQTAW LI
Sbjct: 599 ALYTVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALI 658

Query: 663 ALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALG 722
            LLLAKYP++DVIDRGI LLK RQ PSGEWKFE+VEGVFNHSCAIEY SY+FLFPIKALG
Sbjct: 659 GLLLAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALG 718

Query: 723 LYVKNY 728
           LY K Y
Sbjct: 719 LYSKRY 724

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/732 (67%), Positives = 588/732 (80%), Gaps = 2/732 (0%)

Query: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62
           +E YS+ +GLP TDP  WRL    LG  SW+Y+ E +      Q   TKWLL   +F  P
Sbjct: 2   VELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSK-KIPQCNCTKWLLNADNFSTP 60

Query: 63  NPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEI 122
            P + +  ANFKA NA +NGASF KLLQ+  SG FP QYKGPMFM I Y+   Y+   EI
Sbjct: 61  EPDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEI 120

Query: 123 PDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARD 182
           P+ E+IE+IRYIVNT+HPVDGGWGLH+  KSTVFGT LNY+ LRLLG+SKDH VC +AR 
Sbjct: 121 PECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARS 180

Query: 183 TLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 242
           TL RLGGAIGAPHWGKIWLS LNLYKWEGVNPAP E W LPY +PIHP RWW+HTR +Y+
Sbjct: 181 TLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYL 240

Query: 243 PVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVAND 302
           P+SYL    Y CELTPLL EIR EIYT +F+ I FSKHRNTVC VDLY+PHS +L+V N 
Sbjct: 241 PMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINS 300

Query: 303 CLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQ 362
            +V+Y+NYLRP+W+ + S K VYELI+KEI NT+YLC+APV+ AFC++VT IEEG +S +
Sbjct: 301 AIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPE 360

Query: 363 FERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKF 422
           FER        +FHGPQGMTVMGTNG+QVWDC+FF+QY F+A LAE PEF DA++ AYKF
Sbjct: 361 FERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKF 420

Query: 423 LCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNE 482
           LCRSQF  EC  GS+RDKRVG W FSTKTQGYTVSDCTAE++KA+IMV+ SP FA IH+E
Sbjct: 421 LCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDE 480

Query: 483 FSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
            S+E L K ID+L+SLQN+GS EYGSFATYEKI+APL ME LNPAEVF NIMVEYPYVEC
Sbjct: 481 ISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVEC 540

Query: 543 TDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAME 602
           TDS +LGLTYF ++YDY+K++I   +K+A DYIK  Q KDGSWYGCWGIC+TYAGMFA+E
Sbjct: 541 TDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALE 600

Query: 603 ALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSER-SLVVQTAWVL 661
           AL T+GENY+NSEVVR+GCDFLVKKQ+ DGGWSES+KS+EL  Y++ ++ SLVV T+W L
Sbjct: 601 ALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWAL 660

Query: 662 IALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKAL 721
           I LLLA YP K+VIDRGIQLLKSRQ  SGEWKFE++EG+FNHSCAIEY +YRFLFPIKAL
Sbjct: 661 IGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKAL 720

Query: 722 GLYVKNYGNDSI 733
           G+Y K YG  +I
Sbjct: 721 GIYAKKYGKRAI 732

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/729 (64%), Positives = 579/729 (79%), Gaps = 1/729 (0%)

Query: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64
            YS+++GLP TD + WRL  DE+G E WEY+ E E      Q+T  +WLL VP FP P P
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETS-KVPQTTCVQWLLNVPSFPTPEP 60

Query: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124
            ++S+   F A NA +NGA F  LLQD  SG FPC Y+GPMFM IGY+   ++ G+ IP+
Sbjct: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120

Query: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184
            +R E++RY+VNT+HPVDGGWGLHS DKSTV GTALNYV LRLLG+ ++H V  +AR TL
Sbjct: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180

Query: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244
           +R+GGAIG+P+WGK+WLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+
Sbjct: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240

Query: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304
           SYL+  +Y C LTPLL EIR+EI+T+ FE IDF+ +RN VCG+DLYYPH+ +L+  N C+
Sbjct: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300

Query: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364
           V YE YLRP W+ + S   +YELIK EI+NTDYLCIAPVN A  A+VT IEEG +S +F 
Sbjct: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360

Query: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424
           RF  R K+ LF GPQGM VMGTNG QVWDCAF+IQ  F A L +KPEFY+ I  AY+FLC
Sbjct: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420

Query: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484
           RSQ   +C PGS+RD R+GAW FSTKTQGY VSDCTAE+ K++++VRNSP F ++ +E S
Sbjct: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480

Query: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544
            E+L K ID L+ LQNLGSF+YGSFA+YEKI+APL +E+LN AEVF NIMVE+PYVECTD
Sbjct: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540

Query: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604
           SSVLGL+++ K++DY+++E+   IK+A+ +IKS Q+KDGSWYGCWGIC+TYAGMFA+EAL
Sbjct: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600

Query: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664
              GE+Y +SEVV+KGC+FLV KQ+ DGGWSE+MKSSELHTYVS +RS VVQTAW LI L
Sbjct: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660

Query: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724
           LLA YP + VIDRGIQLLK RQ PSGEWK+E +EGVFNHSCAIEY SYRF+FPIKALG+Y
Sbjct: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720

Query: 725 VKNYGNDSI 733
            K Y  D++
Sbjct: 721 SKKYAKDAL 729

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
          (REAL)
          Length = 572

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 1  MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFP 60
          + ++  S+  G  +T   S +   D++  ESW+ + + +    DE          +P+ P
Sbjct: 11 LGLQINSQDSGTSRTTFHSLQDLGDDIINESWDRVNQKKTSAKDE---------VLPETP 61

Query: 61 APNPAINSESANFKAE 76
           P+P+++++  N K E
Sbjct: 62 LPSPSLSAKKVNTKEE 77

>KLTH0E14608g Chr5 (1298047..1300008) [1962 bp, 653 aa] {ON} similar
           to uniprot|P38121 Saccharomyces cerevisiae YBL035C POL12
           Subunit of the DNA polymerase alpha-primase complex
           required for the initiation of DNA replication during
           mitotic DNA synthesis and premeiotic DNA synthesis
          Length = 653

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 14/90 (15%)

Query: 234 WVHTRGVYIPVSYLSLTKYTCELTPLLAEIRTEI--YTKDFESIDF---------SKHRN 282
           W H  G  + VSYL LT++   L P L  I +E+  +T+  +++ F         +  R 
Sbjct: 552 WEHVSGADLEVSYLGLTEFVANLLPDLVIIPSELSYFTRVVQNVLFINPGMFIRPTGLRG 611

Query: 283 TVCGVDLYYP---HSKLLDVANDCLVFYEN 309
           T   + +  P     +L  V  D +V+  N
Sbjct: 612 TFAQLSILPPDLADGRLTKVEGDEMVYLHN 641

>TPHA0I03230 Chr9 complement(713161..714135) [975 bp, 324 aa] {ON}
           Anc_7.533 YPR176C
          Length = 324

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 57/142 (40%), Gaps = 20/142 (14%)

Query: 521 MEALNPAEVFGNIMVEYPYVECTDSSVLGLTYFHKHYDYKKEEISKRIKLA--------- 571
           +  LN  + F    V    + C D    G   F KH  +    +S    LA         
Sbjct: 46  LSLLNAKDTFKREDVIKFVLSCFDDQYGGFAPFPKHDGHLLSTLSGLQILATYNSLDALT 105

Query: 572 -------IDYIKSCQQKDGSWYGC-WGICFTYAGMFAMEALETVGENYKNSEVVRKGCDF 623
                  I +IK  Q  DGS+ G  +G   T     A+ +L  +GE   +S+VV    DF
Sbjct: 106 VIRREKCIKFIKGNQLPDGSFQGDRFGEVDTRFSYNALSSLSILGE--LSSDVVDPAVDF 163

Query: 624 LVKKQMEDGGWSESMKSSELHT 645
           ++K    DGG+  S   +E H+
Sbjct: 164 ILKCYNFDGGFG-SCPGAESHS 184

>ZYRO0B07612g Chr2 (598538..600364) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P53241 Saccharomyces cerevisiae
           YGR065C VHT1 vitamin H transporter H -biotin symporter
          Length = 608

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 7/64 (10%)

Query: 7   SEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNPAI 66
           S  +GL +  P   R   DE GR+ W+Y  E E  LN E     KW     +F  PN A 
Sbjct: 78  SHPLGLQRDYPYELR---DESGRKWWKYFDEYEYRLNKEYKKSRKWY----EFLYPNHAT 130

Query: 67  NSES 70
            +++
Sbjct: 131 QTKA 134

>KLTH0C10890g Chr3 complement(894335..896605) [2271 bp, 756 aa] {ON}
           similar to uniprot|P04786 Saccharomyces cerevisiae
           YOL006C TOP1 topoisomerase I
          Length = 756

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 6   YSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQV 56
           + +Q  LP++  K W  R DEL ++  E L+ G+V L     +  K  +Q+
Sbjct: 632 FEKQEELPESQLKEWMARVDELEKQYNEELESGKVQLKTNSESAEKLKMQI 682

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,140,249
Number of extensions: 3632888
Number of successful extensions: 8423
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8495
Number of HSP's successfully gapped: 28
Length of query: 733
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 616
Effective length of database: 40,065,477
Effective search space: 24680333832
Effective search space used: 24680333832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)