Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E002505.700ON1068106854510.0
Kpol_1043.685.700ON1042105425770.0
KAFR0D022405.700ON1187116325330.0
Kwal_55.197075.700ON1143109325250.0
Kpol_2001.745.700ON1113112525100.0
ZYRO0G06644g5.700ON1166109925040.0
SAKL0E14872g5.700ON1140113824970.0
CAGL0H06567g5.700ON1169114924610.0
KLLA0A00638g5.700ON1155114624290.0
KLTH0E01100g5.700ON1177115524240.0
TDEL0B022105.700ON1095109723840.0
TPHA0D045905.700ON1127111823750.0
Smik_9.225.700ON1230122123300.0
KNAG0L021105.700ON120091622210.0
AFR284W5.700ON1103112722030.0
Ecym_40205.700ON1125108221620.0
TBLA0E021005.700ON1140115219500.0
NCAS0G002505.700ON118372118110.0
YIL147C (SLN1)5.700ON122072415510.0
NDAI0F003105.700ON125954112411e-150
Skud_9.215.700ON122147611811e-142
Suva_9.415.700ON121945111521e-138
TBLA0I016805.700ON121439310921e-129
TBLA0A107004.385ON5871221844e-13
TDEL0D003204.385ON5472071818e-13
KLLA0A10219g4.385ON4751291809e-13
Kpol_265.24.385ON5491191801e-12
NCAS0A064504.385ON6091221791e-12
KAFR0B069904.385ON5451221772e-12
TPHA0C001504.385ON5101291763e-12
KNAG0B051405.230ON6481271763e-12
ADL388W4.385ON4821221754e-12
KNAG0M001804.385ON6151191754e-12
CAGL0F09097g4.385ON6301191754e-12
NDAI0D034304.385ON5971151745e-12
Kwal_47.167704.385ON4611191735e-12
Ecym_74744.385ON4961191736e-12
ZYRO0G00484g4.385ON6471221746e-12
Skud_8.2734.385ON6231491738e-12
TDEL0E039805.230ON7301401721e-11
ZYRO0A11154g5.230ON7761461711e-11
Smik_8.2964.385ON6251221702e-11
SAKL0B12408g4.385ON4651191682e-11
YHR206W (SKN7)4.385ON6221221692e-11
Suva_15.4124.385ON6171221692e-11
KLTH0D17182g4.385ON4641191682e-11
NCAS0D029005.230ON7621391693e-11
Suva_10.845.230ON6951471622e-10
KAFR0J007005.230ON6201251612e-10
ADR343C5.230ON7491481595e-10
NDAI0I020005.230ON8901431578e-10
CAGL0D02882g5.230ON6671481568e-10
YLR006C (SSK1)5.230ON7121471551e-09
Smik_12.685.230ON7121471542e-09
Ecym_50775.230ON7951701542e-09
Skud_12.725.230ON7021471514e-09
Kpol_1004.45.230ON7141501497e-09
Kwal_33.152885.230ON5871431406e-08
KLTH0B02684g5.230ON5951421371e-07
TPHA0N008505.230ON6701481343e-07
TBLA0D031705.230ON7651771246e-06
SAKL0G12100g5.230ON738721192e-05
KLLA0E09505g5.230ON635711093e-04
TBLA0B015507.222ON39481860.16
Klac_YGOB_Anc_8.348.34ON1571113860.20
KLLA0E04533g7.222ON42182800.74
KAFR0C035208.34ON1450180801.0
NDAI0G031108.34ON1707110791.2
Smik_9.542.253ON145299772.6
Kwal_47.181517.222ON41481743.9
Suva_9.1587.222ON39398744.0
KNAG0D024308.90ON38378744.2
ZYRO0B09878g2.163ON13096695.2
KNAG0D017507.222ON40999735.5
Ecym_32334.285ON664104727.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00250
         (1068 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...  2104   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   997   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   980   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   977   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   971   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   969   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   966   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   952   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   940   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   938   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   922   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   919   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   902   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   860   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   853   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   837   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   755   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   702   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   602   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   482   e-150
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   459   e-142
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   448   e-138
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   425   e-129
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    75   4e-13
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    74   8e-13
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    74   9e-13
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    74   1e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    74   1e-12
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    73   2e-12
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    72   3e-12
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    72   3e-12
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    72   4e-12
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    72   4e-12
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    72   4e-12
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     72   5e-12
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    71   5e-12
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    71   6e-12
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    72   6e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    71   8e-12
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    71   1e-11
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    70   1e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    70   2e-11
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    69   2e-11
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    70   2e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    70   2e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    69   2e-11
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    70   3e-11
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    67   2e-10
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    67   2e-10
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    66   5e-10
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    65   8e-10
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    65   8e-10
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    64   1e-09
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    64   2e-09
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    64   2e-09
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    63   4e-09
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    62   7e-09
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    59   6e-08
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    57   1e-07
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    56   3e-07
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    52   6e-06
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    50   2e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    47   3e-04
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    38   0.16 
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    38   0.20 
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    35   0.74 
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    35   1.0  
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    35   1.2  
Smik_9.54 Chr9 complement(122052..123763,123794..126440) [4359 b...    34   2.6  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    33   3.9  
Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON...    33   4.0  
KNAG0D02430 Chr4 (431696..432847) [1152 bp, 383 aa] {ON} Anc_8.9...    33   4.2  
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    31   5.2  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    33   5.5  
Ecym_3233 Chr3 complement(434815..436809) [1995 bp, 664 aa] {ON}...    32   7.1  

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score = 2104 bits (5451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1036/1068 (97%), Positives = 1036/1068 (97%)

Query: 1    MNLKNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIA 60
            MNLKNLRLATSPPYPMNLRAQ                    GVYFTNNYKSLRAEQLFIA
Sbjct: 1    MNLKNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIA 60

Query: 61   AQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSS 120
            AQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSS
Sbjct: 61   AQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSS 120

Query: 121  IFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLN 180
            IFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLN
Sbjct: 121  IFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLN 180

Query: 181  TSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKY 240
            TSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKY
Sbjct: 181  TSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKY 240

Query: 241  RNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVA 300
            RNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVA
Sbjct: 241  RNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVA 300

Query: 301  VGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKP 360
            VGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKP
Sbjct: 301  VGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKP 360

Query: 361  IIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTE 420
            IIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTE
Sbjct: 361  IIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTE 420

Query: 421  DERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDE 480
            DERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDE
Sbjct: 421  DERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDE 480

Query: 481  LTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRT 540
            LTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRT
Sbjct: 481  LTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRT 540

Query: 541  PLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHF 600
            PLNGILGMTAIALEEDDNEKLQGSLKLIYRSG            FSKNVLQKTKLEKIHF
Sbjct: 541  PLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHF 600

Query: 601  CIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFT 660
            CIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFT
Sbjct: 601  CIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFT 660

Query: 661  PIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSS 720
            PIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSS
Sbjct: 661  PIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSS 720

Query: 721  SIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWV 780
            SIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWV
Sbjct: 721  SIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWV 780

Query: 781  ISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDS 840
            ISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDS
Sbjct: 781  ISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDS 840

Query: 841  TTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAA 900
            TTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAA
Sbjct: 841  TTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAA 900

Query: 901  EKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLK 960
            EKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLK
Sbjct: 901  EKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLK 960

Query: 961  LEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYP 1020
            LEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYP
Sbjct: 961  LEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYP 1020

Query: 1021 IVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEFQNPPNDL 1068
            IVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEFQNPPNDL
Sbjct: 1021 IVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEFQNPPNDL 1068

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1054 (50%), Positives = 705/1054 (66%), Gaps = 33/1054 (3%)

Query: 13   PYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQSL 72
            PY + LR Q                    GVYFT NY+ LR +QL+IAA+LKSSQ+DQ++
Sbjct: 13   PYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72

Query: 73   NYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTNF 132
            N LYYQ +W    D +  AL  Y +GN++ ENW  +   +S FL SS +F   T+YD+ F
Sbjct: 73   NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132

Query: 133  MEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLPI 192
              I N +NN T  +IPDD++  L PLS  + LP+ +GT G LTDPVLN S YLMS+SLPI
Sbjct: 133  NLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192

Query: 193  FGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYHF 252
              NPS+ LSDSRV+GY+T++  A +I AV NDTTALE S VA+IS+   N T+    YHF
Sbjct: 193  IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTS-GQEYHF 251

Query: 253  VFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLAN 312
            VFPP+G+   +++  YP+ N++FL DAF+    GS++ +   YS  VA+GY  C+F LAN
Sbjct: 252  VFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLAN 311

Query: 313  WVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELIS 372
            WV  VSQPE VF SS++KLTKII+GTV+ I   VC +TF +S + V+PI++L++ATE+IS
Sbjct: 312  WVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVIS 371

Query: 373  RGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSKSLSNIAS 432
            +  G       +    S  ++ +  + +    DG  N    +L    E       +N ++
Sbjct: 372  KRDG-----NEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEKYTEIGKANKST 426

Query: 433  KSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMA 492
            +S+  +   I  +SS +      S+  ++  +    +VP    ++ DEL+EL ET+ +M 
Sbjct: 427  ESL--SKENITDYSSSN------SSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMT 478

Query: 493  DSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIA 552
            D+LDEHS LLE RVK RTK+LEAAKI AE+ NEAKTVFIAN++HELRTPLNGILGMTAIA
Sbjct: 479  DALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIA 538

Query: 553  LEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSI 612
            +EE D E++Q SLKLIYRSG            FSKNVL++TKLEK HFC+ D+ALQI+SI
Sbjct: 539  MEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESI 598

Query: 613  FGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKL 672
            FGKI+KDQ V  SI I PN +R+MV +GD NRI+QVIMNLVSNALKFTP+DG + V IKL
Sbjct: 599  FGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKL 658

Query: 673  LGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDEN 732
            LGEYD+++S+  NY  VY+KE  +  GD      +P+   IS     S   +  +K+  +
Sbjct: 659  LGEYDKDRSAAENYKDVYMKEIRNSNGDK----IKPLMTLISSKDTMSVADNISNKSVAS 714

Query: 733  DNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGI 792
            D   TE +S ++TI  YS +   GS +++ +   + +GVP+ K +KWVISV+VEDTGPGI
Sbjct: 715  D---TE-RSTNNTI--YSNKFKNGSNFQDTD---DAIGVPLDKKRKWVISVEVEDTGPGI 765

Query: 793  SPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTV 852
             P+LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKF FTV
Sbjct: 766  EPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTV 825

Query: 853  PLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFK--TDKVTSRGIPSKAAEKNDDANTNG 910
            PLLQ R+I F+  E  FEDEFN NSKKNR+V F+  TD+V    I   +  + +      
Sbjct: 826  PLLQTREIEFNGNELVFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCT- 884

Query: 911  QTTLNAEAKSKTLKPTHITISEDNIDQHD---FKVLIVEDNMVNQEVIKRLLKLEKIKTI 967
            +   + E++S+ + P+  +    N  ++D   FK+LIVEDN VNQ V+ R+LKLE I+  
Sbjct: 885  EPKKSTESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENF 944

Query: 968  EYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAF 1027
              A DGQEA++ +K+  S  + + ++ MDIQMP VDG TAT++IR EL Y  PIVALTAF
Sbjct: 945  TIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAF 1004

Query: 1028 ADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            ADDSN + C  SGM+ FLAKPIKR +LK I+ EF
Sbjct: 1005 ADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/1163 (48%), Positives = 725/1163 (62%), Gaps = 117/1163 (10%)

Query: 3    LKNL-RLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAA 61
            LK L  L T PPY +++R Q                    GVYFT++YK+LRA +L+IAA
Sbjct: 15   LKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAA 74

Query: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121
            QLKSSQ+DQ+L YLYYQS W    D L D+L  + +GNK++ NW  + S +  FL+SS  
Sbjct: 75   QLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDY 134

Query: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181
            FS   +YD NF  + +V+NNGTG  I  D++ +L PLS++  L +S+ T G LTDPVLN 
Sbjct: 135  FSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNG 194

Query: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241
            ++YLMS+SLP+F NPSIILS SRVYGY+TII  A  +++VFNDTTA+E SNVAI+SA Y 
Sbjct: 195  TSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYN 254

Query: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301
            N +   D YH   PPYG  ASV DI + L N+SFL  A  +   GS+  T F Y+  VAV
Sbjct: 255  NQSEL-DAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAV 313

Query: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361
            GYS C+F LANWV+VVSQ ESVF+  + KLTKII+G VVGI+  V  VT  ++Y+ VKPI
Sbjct: 314  GYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPI 373

Query: 362  IKLKQATELISRGRGLRPYYENLSD--RTS--QDNTSTRTTIDLSDLDGYTNEKEKSLPT 417
            ++LK+ATE+I+ GRGLRP         RTS  +   S RT+I +S           SL  
Sbjct: 374  VRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSI-VSSRKSTATGNSNSL-- 430

Query: 418  CTEDERSKSLSN----IASKSIFTTL------------RKILGFSSRSGM---------- 451
               +E S SLS+    + S+++  T             +++L  +S S +          
Sbjct: 431  ---NENSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDR 487

Query: 452  LSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTK 511
            LS  S + I   +    RVP+      DEL++L ETFN M D+LDEH  LLE+RV+ARTK
Sbjct: 488  LSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTK 547

Query: 512  ELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRS 571
            +LEAAKI AEA NEAKTVFIANISHELRTPLNGILGMTAI++EE+D  K++ SLKLI+RS
Sbjct: 548  QLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRS 607

Query: 572  GXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPN 631
            G            FSKNVLQ+TKLEK +FCI D+ALQ+KSIFGK+AKDQ V  SI++SPN
Sbjct: 608  GELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPN 667

Query: 632  LIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYI 691
            ++RTMV +GDSNRIIQV+MNLVSNALKFTP+DG V V+IKLLGEYDEE S  + ++KVY+
Sbjct: 668  IMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYV 727

Query: 692  K---EGTSFTGDNDAIPTEP-------------ISDKIS------FAGG--------SSS 721
            K   E TS   +  A+                 I +K+       FA           ++
Sbjct: 728  KGGTEFTSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGTT 787

Query: 722  IHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYY---------ENKNPGQELLGVP 772
            I+    +T  N++    I    ++ S Y ++ I  S +         E+ N G+EL    
Sbjct: 788  INTSQQRTSSNEDYVDNISIASTSTSSY-DDAIFNSQFKKTPDLYEDEDGNLGEEL---- 842

Query: 773  IPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIM 832
              + K WV  ++V DTGPGI  +LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++M
Sbjct: 843  -SQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMM 901

Query: 833  HGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNF------- 885
            +GTM L+ST G GSKF FTVPL Q R I   E+E  +EDEFN  SK NRKV F       
Sbjct: 902  NGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSIN 961

Query: 886  --------------------KTDKVTSRGIPS--KAAEKNDDANTNGQTTLNAEAKSKTL 923
                                +  ++ +R   S    + KN+ A+   ++  N       L
Sbjct: 962  SRRSRSSLITSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFL 1021

Query: 924  KPTHITISEDNIDQ-----HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAID 978
            + T   IS  N+           VL+ EDN VNQEVIKR+L LE +K I+ A DGQ+A D
Sbjct: 1022 QSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFD 1081

Query: 979  IVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECEN 1038
             VK      + +D+IFMD+QMP VDG +AT++IRN+L Y +PIVALTAFADDSN KEC +
Sbjct: 1082 NVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLD 1141

Query: 1039 SGMNAFLAKPIKRFELKEIIKEF 1061
            +GM+ FL+KPIKR +LK I+ E+
Sbjct: 1142 AGMDGFLSKPIKRPQLKTILLEY 1164

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1093 (47%), Positives = 706/1093 (64%), Gaps = 77/1093 (7%)

Query: 42   GVYFTNNYKSLRAEQLFIAAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKT 101
            GVYFT+++KSLRAE+L +AAQLKSSQ+DQ+LNYLYYQ  W    D+L +AL +Y +GN +
Sbjct: 49   GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108

Query: 102  TENWVESISSVSAFLTSSSIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSD 161
            TENW ++ +++  FL SS++FS A +YD++F ++ NVSNNG+G  IP++++ QL PLS+D
Sbjct: 109  TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168

Query: 162  ERLPASIGTIGFLTDPVLNTSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAV 221
              LP+S+   G LTDPVLN S YLMS+SLPIF NPSIILS ++VYGY+T++  A  + +V
Sbjct: 169  VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228

Query: 222  FNDTTALENSNVAIISAKYRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFT 281
            +NDTTAL++S+V I+S  Y +      GYH VFPPY     VI+  Y + N SFL DA  
Sbjct: 229  YNDTTALDDSSVIIVSTVYDDHELA--GYHLVFPPYNMYPDVINEHYQIENGSFLEDAIK 286

Query: 282  EDTTGSVSSTTFFYSSLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVG 341
            +   GS+ ST FF +  +AVGYS C  +LA WVA+++QPE++F S + +L KII GT + 
Sbjct: 287  DGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIA 346

Query: 342  IAAVVCFVTFIMSYYIVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTT--- 398
            IA V C VTF +S++ V+PI++L++ATE+I+ GRGLR   +N S   S   TST  +   
Sbjct: 347  IAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRS--DNSSTLFSHKRTSTAESFSS 404

Query: 399  ------------IDLSDLDGYTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFS 446
                        +  +  D Y  +  K +P       S ++  +  ++I     + +   
Sbjct: 405  IFGTGSVRRSGSVARAGRDKYIPDSSKEVP---RGNSSDAIHEVNQENIEDIEMQKVNSP 461

Query: 447  SRSGMLSPT----STNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLL 502
            +   M++ +    S  +I + +    RVPV+    +DEL+EL ETFN M D LD H  LL
Sbjct: 462  TPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALL 521

Query: 503  EERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQ 562
            E+RV+ART++LEAAKI AE  NEAKTVFIANISHELRTPLNGILGMTAIA+ E+D  K++
Sbjct: 522  EDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVK 581

Query: 563  GSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGV 622
             SLKLI+RSG            FSKNVL++TKLE+  F I DIALQ++SIFGK+AKDQ V
Sbjct: 582  SSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHV 641

Query: 623  NFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSS 682
            N +I I PNL+R+MV +GDSNRI+Q++MNLVSNALKFTP+DG VDV+ +LLGEYDEEKS 
Sbjct: 642  NLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSK 701

Query: 683  LNNYDKVYI----KEGTSFTGDNDAIPTEPISD--------------------KISFAGG 718
             + Y +V++    +  TS T   D    E   D                    KI     
Sbjct: 702  ASEYKEVFVLPPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSE 761

Query: 719  SSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQE-LLGVPIPKPK 777
            S +I     ++ + D+   + KS  S  +   ++ I  +     +  +E   G  +  PK
Sbjct: 762  SEAIDSEAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESPK 821

Query: 778  KWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTME 837
            KWVIS++V DTGPGI P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+
Sbjct: 822  KWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 881

Query: 838  LDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGI-- 895
            LDS  G+GSKF+FTVPL Q ++++F + E  FEDEFN +SKKNRKV F+  K   R    
Sbjct: 882  LDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSR 941

Query: 896  -------------PSKAAEKNDDANTNGQTTLNA--------EAKSKTLKPTHITISEDN 934
                         P       +   T  + ++ +        ++    L  T +T S   
Sbjct: 942  SESSGTEGNGGNSPGVEGSGGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTTLVTTS-SL 1000

Query: 935  IDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIF 994
             D+   K+L+ EDN VNQEVIKR+L LE ++ +E A DGQ+A D VK + +    +D+IF
Sbjct: 1001 ADRR--KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIF 1058

Query: 995  MDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFEL 1054
            MD+QMP VDG TATR+IR EL Y +PIVALTAFADDSN KEC ++GMN FL+KPIKR ++
Sbjct: 1059 MDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKI 1118

Query: 1055 KEIIKEFQNPPND 1067
            K I+KE+   P D
Sbjct: 1119 KAILKEYCPRPID 1131

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1125 (49%), Positives = 736/1125 (65%), Gaps = 89/1125 (7%)

Query: 4    KNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQL 63
            ++ R A  PPY + +RAQ                    GVYFT NYK LR+ +L IAA+L
Sbjct: 3    QSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKL 62

Query: 64   KSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFS 123
            KSSQ+DQ+LNYL+YQ  +    D L +ALI Y +GNKT ENW+ES + V  FL+SS +F 
Sbjct: 63   KSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFY 122

Query: 124  RATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSN 183
             A +YD NF ++ N +NNGTG  IP++++ +L PLS+++ LP+S+   G LTDPVLN S 
Sbjct: 123  VARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSI 182

Query: 184  YLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNS 243
            YLMS+SLPI  NPSIILS SRVYGY+TI+  A  +  V+ + TALENSNV +ISA Y N 
Sbjct: 183  YLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIY-ND 241

Query: 244  TTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGY 303
                DG+HFVF     D S + I YP+ N ++L  A  E  +GS+  T + ++  +A+GY
Sbjct: 242  QGKVDGFHFVFEVENDDFSTL-IEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300

Query: 304  STCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIK 363
            S C+FSL+NWVA+V+QPE+VF S + KL KIISGTVV IA  VC +TF +S++ VKPI++
Sbjct: 301  SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360

Query: 364  LKQATELISRGRGLRPY--YENLSDRTSQDN------TSTRTTIDL--SDLDGYTNEKEK 413
            L++ATELIS+GRGL+P   + N    ++ DN      +  R ++ +  S  +  +NE + 
Sbjct: 361  LQKATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNGSNELQS 420

Query: 414  SLPTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVH 473
            +      +ERS S +N    +I     K     S S     T++N +        RVPV+
Sbjct: 421  NDDMNEINERS-SKNNSTGDNI-----KSSDNDSSSSFQRYTTSNLV------QARVPVY 468

Query: 474  STYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIAN 533
              ++ DEL+EL +TFN M ++LD+H  LLE+RV+ARTK+LEAAKI AEA NEAKTVFIAN
Sbjct: 469  GRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIAN 528

Query: 534  ISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKT 593
            ISHELRTPLNGILGMTAI++EEDD++K++ +LKLI+RSG            FSKNVL++T
Sbjct: 529  ISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRT 588

Query: 594  KLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLV 653
             LEK  FCI +IALQIKSIFGK+A+DQ V   I++ PN IR+MV +GDSNRIIQ++MNLV
Sbjct: 589  NLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLV 648

Query: 654  SNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDN----DAI--PTE 707
            SNALKFTPIDG VDVRIKLLGEYDEE+S  ++Y +VYIK GT     N    D +    +
Sbjct: 649  SNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQ 708

Query: 708  PISDKISFAGGSSS--------------IHD-----YCSKTDENDNIKTEIKSDDSTISD 748
             +S+K    G ++S              I D     +    D N++I+    +  ST S 
Sbjct: 709  ELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRS- 767

Query: 749  YSEENIMGSYYENKNPG----QELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPF 804
            Y +  +   +   K P     +E LGV + +PK WVISV+VEDTGPGI P LQ++VFEPF
Sbjct: 768  YDDAALQRQF--KKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPF 825

Query: 805  VQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSE 864
            VQGDQ LSRQYGGTGLGLSICRQLA++MHGTM+L+ST G+GSKF FTVPL Q R+I F  
Sbjct: 826  VQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFD- 884

Query: 865  TEKAFEDEFNFNSKKNRKVNFK----------TDK-----VTSRGIPSKAAEKNDDANTN 909
             ++ FEDEFN  SKKNR++ FK           D+      +SR I S   E  D+  T+
Sbjct: 885  -DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTS 943

Query: 910  G-------------QTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIK 956
                          Q+T  A +  K   PT I   + NI++   ++L+ EDN VNQEVIK
Sbjct: 944  PDNHSKVRLDRPFLQSTGTATSSQKI--PTLINKEDTNIEKS-IRILVAEDNHVNQEVIK 1000

Query: 957  RLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELN 1016
            R+L LEKI  I+ A DGQ+A D VK     ++ +DIIFMD+QMP VDG  +T++IR +LN
Sbjct: 1001 RMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLN 1060

Query: 1017 YPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            Y +PIVALTAFA+D N KEC ++GM+ FL KPIKR +LK+I++E+
Sbjct: 1061 YKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1099 (49%), Positives = 704/1099 (64%), Gaps = 59/1099 (5%)

Query: 13   PYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQSL 72
            P  + +RAQ                    GVYFT+NYK+LR+E+L++AAQLKS+Q+DQ+L
Sbjct: 14   PIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQIDQNL 73

Query: 73   NYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTNF 132
            NY+YYQ  W    D L +AL  Y +GNKT  NWV+S + +  FLTSS +FS ATIYD  F
Sbjct: 74   NYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYDATF 133

Query: 133  MEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLPI 192
              + + +NNGTG HIP+  + +L PLS ++ LP+S+ + G LT+PVLN ++YLMS+SLPI
Sbjct: 134  TPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPI 193

Query: 193  FGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYHF 252
            F NPSIIL+ S VYGY+TI+  A S+  VF+DTTALE SNVAI+SA Y  + T +  Y+F
Sbjct: 194  FANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLS-SYNF 252

Query: 253  VFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLAN 312
            VF P G  +S++    P+ N +FL  A  +   G++  T F Y+  VAVGYS C+    N
Sbjct: 253  VFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVN 312

Query: 313  WVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELIS 372
            W+AVV Q E+VF     KLTKIISGTVVGI   VC VTF ++++ VKPI++L++ATELI+
Sbjct: 313  WIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELIT 372

Query: 373  RGRGLRPYY-----ENLSDRTS--QDNTSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSK 425
             GRGLR         N+S R+S     ++  ++I     D + NEK   L      E+ +
Sbjct: 373  EGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNH-NEKGHDL----HGEQIQ 427

Query: 426  SLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELK 485
                  + SI  +L   +  SS +  LS  S     + +    RVPV+  + +DEL+EL 
Sbjct: 428  HGFFAMNGSINHSLAASIA-SSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELT 486

Query: 486  ETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGI 545
            +TFN M D+LD+H  LLE+RV+ART++LEAAKI AEA NEAKTVFIANISHELRTPLNGI
Sbjct: 487  DTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGI 546

Query: 546  LGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDI 605
            LGMTAI++EE D +K+Q SLKLI+RSG            FSKNVL++TKLEK +F + D+
Sbjct: 547  LGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDV 606

Query: 606  ALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGN 665
            ALQIKSIFGK+AKDQ V  SI + PNLIRTMV FGDSNRIIQ++MNLVSNALKFTP+DG 
Sbjct: 607  ALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGK 666

Query: 666  VDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISF---------A 716
            V+V + LLGEYD E+S   N+ KVY+  GT   G ND      I +K  F         +
Sbjct: 667  VNVYMSLLGEYDAERSENENHKKVYVIPGTEPKG-NDEKDKGGIEEKERFSIENTPNDTS 725

Query: 717  GGSSSIHDYCSKTDENDNIKTEIKSDD-----STISDYSE------------ENIMGSYY 759
              SS+ H     T   ++   +  SDD       + D  E            + +  S +
Sbjct: 726  SNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQF 785

Query: 760  ENKNP-----GQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQ 814
            + K P       E LGV +   KKWVIS+ VEDTGPGI  +L +SVFEPFVQGDQ LSRQ
Sbjct: 786  K-KTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQ 844

Query: 815  YGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFN 874
            YGGTGLGLSICRQLA++M+GTM+L S  G+GS+FTFTVPL Q R+I F +   AFEDEFN
Sbjct: 845  YGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFN 904

Query: 875  FNSKKNRKVNFKTDKVTSRGIPSK-----AAEKNDDANTNGQTTLNAEAKSKT-----LK 924
             +SKKNRKV FK  K                + +    +  Q  L    +S       L+
Sbjct: 905  PDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPKSSSSDKSLSQLKLTDSDRSVRLDRPFLQ 964

Query: 925  PTHITISEDNIDQHDF--KVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKK 982
             T    S  N+       K+L+ EDN VNQEVIKR+L LE +  IE   DGQEA+D VK+
Sbjct: 965  STGTASSNTNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQ 1024

Query: 983  KISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMN 1042
             +   + +++IFMD+QMP +DG  +T++IR +LNY +PIVALTAFADDSN +EC ++GM+
Sbjct: 1025 LVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMD 1084

Query: 1043 AFLAKPIKRFELKEIIKEF 1061
             FLAKPIKR +L++II+EF
Sbjct: 1085 GFLAKPIKRAQLRKIIEEF 1103

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1138 (47%), Positives = 716/1138 (62%), Gaps = 94/1138 (8%)

Query: 3    LKNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQ 62
            + +LR    PP+ + +R Q                    GVYFT NYKSLRA++L +AAQ
Sbjct: 4    IGHLRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQ 63

Query: 63   LKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIF 122
            LKSSQ+DQ+LNYLYYQ  W    D L D+LIRY +GN T ENW E+   +  FL SS +F
Sbjct: 64   LKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLF 123

Query: 123  SRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTS 182
            S A IYD+ F  + N +NNG+G  +P+ ++  L PLS+D+ L +S+ T G LTDPVLN +
Sbjct: 124  SVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDT 183

Query: 183  NYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRN 242
             Y+MS+SLPIF +PSI+L++S + GY+T++  A S+  VFNDTTAL+ S+VAI+SA+Y N
Sbjct: 184  VYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243

Query: 243  STTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVG 302
             +     YHFVFPP+G  A +ID  + + N SF+  AF +  +GSV  T+FFY   VAVG
Sbjct: 244  QSLPV-SYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVG 302

Query: 303  YSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPII 362
            YS C F    WVAV+SQPE+VF S + +LT II GT +GIA  +C VTF ++++ VKPI+
Sbjct: 303  YSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIV 362

Query: 363  KLKQATELISRGRGLRPYYENLSDRTSQDNT-----STRTTIDLSDLDGYTNEKEKSLPT 417
            +L++ATE+I+  RGLR Y  N S   S+ N+     ST ++I  S     T+   +    
Sbjct: 363  RLQKATEIITARRGLRSY--NQSAPASRTNSFRKRPSTSSSIG-SVFRTITDRPHERDNG 419

Query: 418  CTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTS----------TNFIVNNDTKT 467
             +  E     SN           +I G    +   +PTS           NF+ + +   
Sbjct: 420  HSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLID 479

Query: 468  VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527
             RVPV+    +DEL+EL +TFN M D LD H  LLE+RV+ARTK+LEAAKI AEA NEAK
Sbjct: 480  ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAK 539

Query: 528  TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSK 587
            TVFIANISHELRTPLNGILGMTAI++ E D +K+Q SLKLI+RSG            FSK
Sbjct: 540  TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSK 599

Query: 588  NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQ 647
            NVLQ+TKLE+ +F I D+ALQ+KSIFGK+AKDQ VN SI++SPN+IRTM+ +GDSNRIIQ
Sbjct: 600  NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659

Query: 648  VIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGT------------ 695
            ++MNLVSNALKF+P+DG V VRIKLLGEYD +KS  +NY+ V+IK GT            
Sbjct: 660  IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSL 719

Query: 696  ----------------SFTGDNDAIPTEPI--SDKISFAGGSSSIHDYCSKTDENDNIKT 737
                            S + D+  +  EPI  SD  S  G   S  D  + TD+  N  +
Sbjct: 720  STLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSN--S 777

Query: 738  EIKS------------DDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWVISVDV 785
            EI              DD+ +  +++   + S    ++ G  L G  +   K WVI+++V
Sbjct: 778  EISDSLSLVSSNNSSYDDAIL--HAQLRKVPSCGNGEDSGDSL-GRKLEISKTWVIAIEV 834

Query: 786  EDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLG 845
            EDTGPGI P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M GTM+L+S  G+G
Sbjct: 835  EDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVG 894

Query: 846  SKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAAEKNDD 905
            SKFTFTVPL Q R++ F + E  FEDEFN +SKKNRKV FK +K  S G  S+ +     
Sbjct: 895  SKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNK-NSGGSKSRPS----- 948

Query: 906  ANTNGQTTLNAEAKSKTLKPTHITISEDNID----------------------QHDFKVL 943
             NT+  +  ++ A+   L  + +++    +D                      +  FK+L
Sbjct: 949  VNTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKIL 1008

Query: 944  IVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVD 1003
            + EDN VNQEV+KR+L LE +  I+ A DGQEA D VK      D + IIFMD+QMP VD
Sbjct: 1009 VAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVD 1068

Query: 1004 GHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            G  +T++IR EL Y +PIVALTAFADDSN K C +SGMN FL+KPIKR +LK ++ EF
Sbjct: 1069 GLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  952 bits (2461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1149 (48%), Positives = 707/1149 (61%), Gaps = 122/1149 (10%)

Query: 12   PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
            PP+ + +RAQ                    GVYFT+NYK+LR+++L+IAAQLKSSQLDQ+
Sbjct: 16   PPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQN 75

Query: 72   LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
            LNYLYYQ  W    D L +AL  Y +GNKT ENW ES + +  FL+SS++F  + +YD +
Sbjct: 76   LNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYDYD 135

Query: 132  FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
            F  + N +NNGTG  +P+ I  QL PLS+D  LP+S+ T G LTDPVLN ++YLMS+SLP
Sbjct: 136  FKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLP 195

Query: 192  IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
            IF NPSII SD +VYGY+T++  A  + +VFNDTTALE SNVAI+SA+Y N T   D Y 
Sbjct: 196  IFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI-DSYR 254

Query: 252  FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311
            FVFPPYG   S+++  + L ++SFL  AF +   GS+  T FFY+  VA+GY  C+F+  
Sbjct: 255  FVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFV 314

Query: 312  NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371
            NWVAVVSQ ESVF S + KLTKIISGTVVGIA  V  +TF ++ + VKPI++L++ATELI
Sbjct: 315  NWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374

Query: 372  SRGRGLRPYYENLSDRTSQDNTSTRTTI-DLSDLDGYTNEKEKSLPTCTEDERSKSLSNI 430
            + GRGLRP       R+    +S +  I DL+ +   +  ++   P       S S SN 
Sbjct: 375  AEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYD----SASDSNY 430

Query: 431  ASKSIFTTLRKILGFSSRSG---------MLSPTSTNFIVNNDTKTVRVPVHSTYITDEL 481
            A+    +   +    S+R               TSTN          R+P +    +DEL
Sbjct: 431  ATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNL------NEARLPDYRRLFSDEL 484

Query: 482  TELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTP 541
            ++L  TFN M D+LD+H  LLE+RV+ARTK+LEAAKI AEA NEAKTVFIANISHELRTP
Sbjct: 485  SDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTP 544

Query: 542  LNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFC 601
            LNGILGMTAI++EE D  K++ SLKLI+RSG            FSKNVL++T LEK +FC
Sbjct: 545  LNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFC 604

Query: 602  IHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTP 661
            I D+ALQIKSIFGK+AKDQ V  SI ++PN+IRTMV +GDSNRIIQ++MNLVSNALKFTP
Sbjct: 605  ITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTP 664

Query: 662  IDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSSS 721
            +DG V+VRIKLLGEYDEE +  +N+ +++         D+DA    P+S   S   G   
Sbjct: 665  VDGKVNVRIKLLGEYDEEATKADNFKQIHT------IADSDAHQQHPVS---SSPNGVLV 715

Query: 722  IH---------------DYCSKTDENDNIKTEIK--SDDSTISDYSEENIMGSY------ 758
             H                Y  KT + D+ +  I   SD S        +   SY      
Sbjct: 716  KHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSSTSSYDNALFN 775

Query: 759  ---------YENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQ 809
                     YE+ N G   LG  +   K WV +++VEDTGPGI P L +SVFEPFVQGDQ
Sbjct: 776  TQFKKTPDLYEDSNDG---LGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQ 832

Query: 810  TLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAF 869
            TLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKFTFTVPL Q R I F E E  F
Sbjct: 833  TLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLF 892

Query: 870  EDEFNFNSKKN----------------------RKVNFKTDKVTSRG------------- 894
            EDEFN  SKKN                      R  N   DK +S G             
Sbjct: 893  EDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDE 952

Query: 895  ----------IPSKAAEKNDDANTNGQTTLNAEAKSKT-------LKPTHITISEDNIDQ 937
                      +P    E +  A+++   + N + K +        L+ T    S  N+  
Sbjct: 953  DIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPT 1012

Query: 938  H-----DFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDI 992
                   FK+L+ EDN VNQEVIKR+L LE I  I+ A DGQ+A D V+  + + D +D+
Sbjct: 1013 MADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDM 1072

Query: 993  IFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRF 1052
            IFMDIQMP VDG  +T++IR +LNY   IVALTAFADDSN KEC  +GMN FL+KPIKR 
Sbjct: 1073 IFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRP 1132

Query: 1053 ELKEIIKEF 1061
            +LK I++E+
Sbjct: 1133 KLKMILEEY 1141

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1146 (45%), Positives = 711/1146 (62%), Gaps = 96/1146 (8%)

Query: 2    NLKNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAA 61
            +LK LR   +PP+ + LR Q                    GVYFT NYKS+RAE+L +AA
Sbjct: 10   SLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAA 69

Query: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121
            QLKSSQ+DQ+LNYLYYQ  W    D L DAL+ + +GN + +NW  +  S+  FL SS +
Sbjct: 70   QLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGL 129

Query: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181
            FS A +YDT+F  + N +NNG+G +IP++++ +L PLS  E L +S+ T G +TDPV N 
Sbjct: 130  FSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNW 189

Query: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241
            +NYL+S+SLP+  NPSIIL+ + + GY+T+I  A S+ AV NDT AL+ S+V+I+SA + 
Sbjct: 190  TNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVF- 248

Query: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301
            +S +   GYHFVFPP+G+ +    + +P+ N +F+ DAF     GSV  T       +AV
Sbjct: 249  DSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAV 308

Query: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361
            GYS  TF L NWVAVV+QPE VF S T++L KII+GTV  IA  +C +TF ++++ V+PI
Sbjct: 309  GYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPI 368

Query: 362  IKLKQATELISRGRGLRPYYE--NLSDRTSQDNTSTRTTIDLSDL-------------DG 406
            ++L++ATE+I+ GR L+ Y    N    T+  ++ TR+T + + +               
Sbjct: 369  VRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSN 428

Query: 407  YTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGML----------SPTS 456
            Y N      P    D  S S  N        T+ +  G  +RS             S TS
Sbjct: 429  YLNHNYNVFPPSRTDSPSVSARNSQ------TIPRGPGDLTRSATTGSTPFSNDSSSYTS 482

Query: 457  TNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAA 516
              +I + +     VPV+  +  DEL+EL +TFN M D LD H  LLEERV+ARTK+LEAA
Sbjct: 483  ERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAA 542

Query: 517  KIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXX 576
            KI AE+ NEAKTVFIANISHELRTPLNGILGMTAIA+ E D +K+Q SLKLI+RSG    
Sbjct: 543  KIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLL 602

Query: 577  XXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTM 636
                    FSKNVL++TKLE+  F + DIALQIKSIFGK+AKDQ V  SI ++PN IRT+
Sbjct: 603  HILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTL 662

Query: 637  VFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTS 696
            V +GDSNRIIQ++MNLVSNALKFTP+DG VDVRIKLLGEYD ++S   +Y +V++  G+ 
Sbjct: 663  VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722

Query: 697  FTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDENDNIKT-----EIKSDDSTISDYSE 751
               D +   T     ++ F   S S++        +   KT     +++S+ ST  + ++
Sbjct: 723  ANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDND 782

Query: 752  EN--IMGSYYENKNPGQELLGV-----------------------------------PIP 774
            E+  ++ S +E     +E + +                                    + 
Sbjct: 783  ESSIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLK 842

Query: 775  KPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHG 834
             PK WVIS++VEDTG GI P+LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M G
Sbjct: 843  VPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKG 902

Query: 835  TMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRG 894
            TM+LDS  G+GSKF FTVPL Q ++I+F   EK FEDEFN +S+KNRKV FK +  + + 
Sbjct: 903  TMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINS-SRKS 961

Query: 895  IPSKAAEKNDDANTN--------GQTTLNAEAKSKTLKP-----------THITISEDNI 935
            + +K ++ + D +++          +T N+    +  +P             I+     +
Sbjct: 962  VQTKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEV 1021

Query: 936  DQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFM 995
             +H  +VL+ EDN VNQEVIKR+L+LE +  ++ A DGQEA + V++ +   + + +IFM
Sbjct: 1022 TRH--RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFM 1079

Query: 996  DIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELK 1055
            D+QMP VDG  AT++IRN+L Y  PIVALTA+ADDSN K C  SGM+ FL KPIKR  LK
Sbjct: 1080 DVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLK 1139

Query: 1056 EIIKEF 1061
            +II ++
Sbjct: 1140 KIIAQY 1145

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1177

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1155 (45%), Positives = 712/1155 (61%), Gaps = 120/1155 (10%)

Query: 12   PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
            PP+ +++R Q                    GVYFT+++KS+RAE+L++A+QLK+SQ+DQ+
Sbjct: 19   PPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQN 78

Query: 72   LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
            L YLYYQ  +    DVL +AL +Y +GN TTENW ++++++  FL SS++FS A +YD++
Sbjct: 79   LYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138

Query: 132  FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
            F ++ N SNN +G  +P+ ++ QL PLS++  LP+S+   G LTDPVLN + YLMS+SLP
Sbjct: 139  FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198

Query: 192  IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
            IF NPSIILS S+VYGY+T++  A  +  VFNDTTALE+S+V ++S  Y N      GYH
Sbjct: 199  IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA--GYH 256

Query: 252  FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311
             VFPPYG  + +ID  Y + N+SFL DAF +   GS+ ST F YS  VA+GYS C+  L 
Sbjct: 257  LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316

Query: 312  NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371
             WVA+++QPES F   + +L +II GT V IA V C VTF +S++ V+PI++L++ATE+I
Sbjct: 317  QWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEII 376

Query: 372  SRGRGLRP-----YYENLSDRTSQDNTST--------RTTIDLSDLDGYTNEKEKSL--- 415
            + GRGLR       Y +    T++  +S           ++  S    Y  E  K     
Sbjct: 377  TAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTLNK 436

Query: 416  -------PTCTEDERSKSLSNIASK---SIFTTLRKILGFSSRSGMLSPTSTNFIVNNDT 465
                   P   E+    +L  + S    S+F+  R     S+RS     TSTN I     
Sbjct: 437  NDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQR-----SARSERYI-TSTNLI----- 485

Query: 466  KTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNE 525
               RVP ++   +DEL+EL ETFN M D LD H  LLE+RV+ART++LEAAKI AE  NE
Sbjct: 486  -EARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANE 544

Query: 526  AKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXF 585
            AKTVFIANISHELRTPLNGILGMTAIA+ E+D +K++ SLKLI+RSG            F
Sbjct: 545  AKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTF 604

Query: 586  SKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRI 645
            SKNVL++TKLE+  F +H+IALQ++SIFGK+AKDQ VN +I I PN++RTMV +GDSNRI
Sbjct: 605  SKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRI 664

Query: 646  IQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDE---------------------EKSSLN 684
            +Q++MNLVSNALKFTP+DG V+V+  LLGEYDE                     E S+L 
Sbjct: 665  VQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESSTLG 724

Query: 685  NYDKVYIKEGT-SFTGDNDAIPTEPISDKIS----------------------------- 714
              +K  IK+ T S +  N   P  P + + S                             
Sbjct: 725  PTEKGGIKDVTESASSSNATWPPSPSTSETSNGSKAETTSGKLTESSEEDEKEEKLDHDD 784

Query: 715  -----------------FAGGSSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGS 757
                                G    ++   + D N+N   + +S +S  +   ++ I  S
Sbjct: 785  KDEGDEESEEEEYRGEAEVSGKDDTNNETQREDSNENQNEDARSIESENASSYDDAIFHS 844

Query: 758  YYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGG 817
                 N G+   G P+  P++  I+++V+DTGPGI P LQ+SVFEPFVQGDQTLSRQYGG
Sbjct: 845  RLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGG 904

Query: 818  TGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNS 877
            TGLGLSICRQLA++M+G+M LDS  G+GSKFTFTVPL Q +++ F E E  FEDEFN +S
Sbjct: 905  TGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDS 964

Query: 878  KKNRKVNFKTDKVTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKT-------LKPTHITI 930
            KKNRKV FK  K  ++   S ++    +++    T   +E    +       L+ T   +
Sbjct: 965  KKNRKVKFKVSK-NNKRKKSHSSSSGQNSSVGTPTVSESEVSVGSVRVDRPFLQSTGTAL 1023

Query: 931  SEDNID----QHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISE 986
            S  ++      +  KVL+ EDN VNQEVIKR+L LE +  ++ A DGQ+A D VK +   
Sbjct: 1024 STRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEA 1083

Query: 987  KDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLA 1046
               +D+IFMD+QMP VDG +ATR+IRNEL+Y +PIVALTA+ADD N KEC ++GMN FLA
Sbjct: 1084 GKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLA 1143

Query: 1047 KPIKRFELKEIIKEF 1061
            KPI+R ++KEI+ E+
Sbjct: 1144 KPIRRPKIKEILSEY 1158

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1097 (47%), Positives = 699/1097 (63%), Gaps = 54/1097 (4%)

Query: 6    LRLAT------SPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFI 59
            +RL T      SPP+ +++R Q                    GVYFT+NYKSLR+E+L++
Sbjct: 1    MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 60   AAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSS 119
            AAQLKSSQ+DQ+LNYLYYQ  W      L  +L  Y SGNKT  NWV+S S +  FL+SS
Sbjct: 61   AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 120  SIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVL 179
            ++FS A +YD +F  + N +NNGTG  + DD++ +L PLSS+  LPAS+ + G LTDPVL
Sbjct: 121  ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 180  NTSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAK 239
            N ++YLMS+SLPI+ NPSIIL++SRVYGYVTII  A S+ +V++D TALE S+V I+SA 
Sbjct: 181  NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 240  YRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLV 299
            Y+        Y FVF PYG+   ++D  +P++NNSFL  A  +   GS   T  FY+   
Sbjct: 241  YKKDQGLG-SYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPS 299

Query: 300  AVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVK 359
            AVGYS C+F   NWVA++SQ E+VF   + +LTKII G VVGI A VC  TF ++++ V+
Sbjct: 300  AVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQ 359

Query: 360  PIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCT 419
            PI++L++ATE+I+ GRGLR      S  +   +   R     S +   +   EK      
Sbjct: 360  PIVRLQKATEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKG----- 414

Query: 420  EDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITD 479
                  ++   +++  F   + +   +S + + S  +  ++ +++    RVPV+  + +D
Sbjct: 415  ------AVGRASTEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSD 468

Query: 480  ELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELR 539
            E +EL +TFN M ++LD+H  LLE+RV+ARTK+LEAAK+ AEA NEAKTVFIANISHELR
Sbjct: 469  EFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELR 528

Query: 540  TPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIH 599
            TPLNGILGMTAI++EE D +K+Q SLKLI+RSG            FSKNVLQ+TKLEK  
Sbjct: 529  TPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRD 588

Query: 600  FCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKF 659
            F I D+A+QIKSIFGK+AKDQ V FSI + PN IR MV +GDSNRIIQ++MNLVSNALKF
Sbjct: 589  FSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKF 648

Query: 660  TPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGD------------NDAIPTE 707
            TP+DG V VR++LLGEYD+++S   ++  VY+ +GT    D             + +  E
Sbjct: 649  TPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKE 708

Query: 708  PISDKISFAGGSSSIHDYCSKTDENDNIKTEIKSDDSTI-----SDYSEENIMGSYYENK 762
             IS+K +    S+S  +  +  D+  + K     D  ++     S Y +      + ++ 
Sbjct: 709  KISEKHNEEEASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHT 768

Query: 763  NPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGL 822
            +   +  G  +  PK W ISV+VEDTGPGI P+L +SVFEPFVQGDQ LSRQYGGTGLGL
Sbjct: 769  SSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGL 828

Query: 823  SICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRK 882
            SICRQLA++M+GTM+LDS  G+GSKFTFT+PL Q R+I F E E AFEDEFN  SKKNRK
Sbjct: 829  SICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEF-EDENAFEDEFNPLSKKNRK 887

Query: 883  VNFKTDKVTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKT-------------LKPTHIT 929
            V FK  K         +   +     +   +      S++             L+ T   
Sbjct: 888  VKFKVAKSIKSRKSKSSLSNSSGKGGSSDKSSKQLKGSESEFSVGNVSLDRPFLQSTGTA 947

Query: 930  ISEDNID-----QHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKI 984
             S  N+         +++L+ EDN VNQEVIKR+L LE I  I+ A DGQ+A D VK   
Sbjct: 948  SSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQ 1007

Query: 985  SEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAF 1044
             + + +++IFMD+QMP VDG  AT++IR +L+Y YPIVALTAFADDSN + C  +GMN F
Sbjct: 1008 EKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGF 1067

Query: 1045 LAKPIKRFELKEIIKEF 1061
            L+KPIKR +LK II ++
Sbjct: 1068 LSKPIKRPKLKTIIAQY 1084

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1118 (46%), Positives = 713/1118 (63%), Gaps = 74/1118 (6%)

Query: 12   PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
            PPY +++RAQ                    GVYFT NYK+L+  +L+IAAQLK+SQ+DQ+
Sbjct: 11   PPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQT 70

Query: 72   LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
            LNYLYYQ  +    + L ++L+ Y +GN ++ NW ES   +  FLTSS +FS A +YDTN
Sbjct: 71   LNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDTN 130

Query: 132  FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
            F  + N +NN +G ++P+ +I +L  LS +  LP+S+ TIG  TDPVLN SN+LMS+SLP
Sbjct: 131  FNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSLP 190

Query: 192  IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
            IF NPSIILSDSR+YGY+++I  A  + +VFNDTTALENS V +ISA Y + TT  + ++
Sbjct: 191  IFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADY-SITTNLEYFN 249

Query: 252  FVFP-PYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSL 310
            F+F   Y +     D+ Y + N++F+++       G+V  T  F  +  AVGYS+C+FSL
Sbjct: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309

Query: 311  ANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATEL 370
             NW+A+V+QPE+ F+ S  KL +IISG VV +A  VC +TF +S++ V+P+I+L++ATE 
Sbjct: 310  VNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATER 369

Query: 371  ISRGRGLRPYYENLSDRTSQDNT-STRTTID--LSDLDGYTNEKEKSLPTCTEDERSKSL 427
            I+ GRGLRP    +    S++++   R +++  +    G+   K     + T    + + 
Sbjct: 370  IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSIT----ANNF 425

Query: 428  SNIASKSIFTTLRKILGF--SSRSGM-------LSPTSTNFIVNNDTKTVRVPVHSTYIT 478
             N  S S   T   I G   SS S M       LS +S  +  + +    RVPV+   + 
Sbjct: 426  KNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQ 485

Query: 479  DELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHEL 538
            DEL+EL +TFN M D+LD+H  LLEERV+ARTK+LEAAKI AE+ NEAKTVFIANISHEL
Sbjct: 486  DELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHEL 545

Query: 539  RTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKI 598
            RTPLNGILGMTAI++EEDD +K++G+LKLI+RSG            FSKNVLQ+TKLEK 
Sbjct: 546  RTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKR 605

Query: 599  HFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALK 658
             FCI ++ALQIKSIFGK+AKDQ V  SI++ PN++R+ V +GDSNRIIQV+MNLVSNALK
Sbjct: 606  DFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALK 665

Query: 659  FTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEP---ISDKISF 715
            FTP+DGNVDVRI LLGEYDEE+S   +Y KVY+K+GT    +   + TE    IS K   
Sbjct: 666  FTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSET 725

Query: 716  AGGSSSIHDYCSKTDENDNIKTEIKSDDSTISD----------------YSEENIMGSYY 759
               +     +    D+  +   +I ++D  IS+                Y +  +M    
Sbjct: 726  ELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLI 785

Query: 760  ENK--NPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGG 817
            ++   +  +  LGV + + K WVISV+V+DTG GI P LQ+SVFEPFVQGDQ LSRQYGG
Sbjct: 786  KSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGG 845

Query: 818  TGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNS 877
            TGLGLSIC+QL+++M+GTMEL+S  G+GSKF FT+PL Q R+I   + E  F DEFN  S
Sbjct: 846  TGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDE-LFNDEFNAVS 904

Query: 878  KKNRKVNFK-TDKVTSRGIPSK----AAEKNDDANTNGQTTLNAEAKSKTLKPTHI---- 928
            KKNRKV FK +   +++ I ++    ++  N  + T+  ++ +   +   ++P+ +    
Sbjct: 905  KKNRKVKFKFSGSSSAKSIKTRNSIGSSLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNR 964

Query: 929  ----------------TISEDNIDQHDFKV---------LIVEDNMVNQEVIKRLLKLEK 963
                            T++    D+   KV         L+ EDN VNQEVIKR+LKLE 
Sbjct: 965  PFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEG 1024

Query: 964  IKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVA 1023
            I  I+ A DGQ+A D  K        +DIIFMD+QMP +DG  AT++IR ELNY  PIVA
Sbjct: 1025 INNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVA 1084

Query: 1024 LTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            L+AF  + N KEC + GMN FL+KPIKR +LK I+K++
Sbjct: 1085 LSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1221 (45%), Positives = 728/1221 (59%), Gaps = 178/1221 (14%)

Query: 6    LRLAT----SPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAA 61
            LRL +    +PP+ + +RAQ                    GVYFT+NYK+LR+++L+IAA
Sbjct: 3    LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121
            QLKSSQ+DQ+LNYLYYQ+ +    D L  +L  + +GNK+ +NWV+S+S V  FL+SS++
Sbjct: 63   QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122

Query: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181
            F  A +YD++F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ T G LTDPV+N 
Sbjct: 123  FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182

Query: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241
            ++YLMS+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE SNVAIISA Y 
Sbjct: 183  TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALY- 241

Query: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301
            N+   A GYHF+FPPYG+ +++    + + NN+F+  AF     GS+  T  F    +A+
Sbjct: 242  NNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301

Query: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361
            GYS C+F L NWVAVVSQPESVF S   KL KII+GTV+ I   V  +T  ++++ V+PI
Sbjct: 302  GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361

Query: 362  IKLKQATELISRGRGLRPYYENLSDRTS-----------------QDNT----------- 393
            ++L++ATELI+ GRGLRP       R S                 Q NT           
Sbjct: 362  VRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISASG 421

Query: 394  ----------------STRTTIDLSDLDGYTNEKEKSLPTCTEDER---SKSLSN--IAS 432
                            S ++ I+L +     +E EK +P    D +     SL++  +A 
Sbjct: 422  HGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLAP 481

Query: 433  KSIFT--TLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNI 490
             S+    T R     S+RS +L+ TS N          R+P +    +DEL++L ETFN 
Sbjct: 482  NSLRNNDTDRS----SNRSHILT-TSANLT------EARLPDYRRLFSDELSDLTETFNT 530

Query: 491  MADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTA 550
            M D+LD+H  LLE+RV+ARTK+LEAAKI AEA NEAKTVFIANISHELRTPLNGILGMTA
Sbjct: 531  MTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTA 590

Query: 551  IALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIK 610
            I++EE D  K++ SLKLI+RSG            FSKNVLQ+TKLEK  FCI D+ALQIK
Sbjct: 591  ISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIK 650

Query: 611  SIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRI 670
            SIFGK+AKDQ V  SI + PNLIRTMV +GDSNRIIQ++MNLVSNALKFTP+DG VDVR+
Sbjct: 651  SIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRM 710

Query: 671  KLLGEYDEEKSSLNNYDKVYIKEGTSFT---------------GDNDAIPTEPISDKISF 715
            KLLGEYD++ S    + +V++K GT  T                    +  E  +  I+ 
Sbjct: 711  KLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITS 770

Query: 716  AGGSSSIHDYCSK--TDENDNIKTEIKSDDSTISDYS-----------EENIMGSYYENK 762
               +S I +  +K  T  N+NI   +   +   SD             ++ I  S + NK
Sbjct: 771  NRDTSIIQEEITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQF-NK 829

Query: 763  NPGQEL-----LGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGG 817
             PG +      LG PI  PK WVIS++VEDTGPGI P+LQ+SVF PFVQGDQTLSRQYGG
Sbjct: 830  APGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGG 889

Query: 818  TGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNS 877
            TGLGLSICRQLA++M+GTM L+S  G+GSKFTFT+PL Q ++I F+  +  FEDEFN  S
Sbjct: 890  TGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPES 949

Query: 878  KKNRKVNFKTDK-VTSRGIPSKAAE--------------------------------KND 904
            +KNR+V F   K + SR   S  A                                 K +
Sbjct: 950  RKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKRE 1009

Query: 905  DANTNGQTTLNAEAKS---------------KTLKPTHITISED----NIDQHDFK---- 941
              N  G+     + K+               KT+ P H +  E     N+D+   +    
Sbjct: 1010 GVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGT 1069

Query: 942  ------VLIVEDNMVNQEVIKRLL------------KLEKIKTIE---YAVDGQEAIDIV 980
                  V  ++DN  N   IK L+            ++  ++ IE    A DGQEA D V
Sbjct: 1070 ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKV 1129

Query: 981  KKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSG 1040
            K+  S+   +++IFMD+QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SG
Sbjct: 1130 KELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESG 1189

Query: 1041 MNAFLAKPIKRFELKEIIKEF 1061
            MN FL+KPIKR +LK I+ EF
Sbjct: 1190 MNGFLSKPIKRPKLKTILTEF 1210

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/916 (50%), Positives = 602/916 (65%), Gaps = 46/916 (5%)

Query: 12  PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
           PPY + +RAQ                    GVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 12  PPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71

Query: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
           LNYLYYQ  W    D L   L  Y +GNK+  NW++S S +  FL SS++FS A +YD++
Sbjct: 72  LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131

Query: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
           F  + N +NN TG  IP+D++ QL PLS++  LP+S+ T G +T+PV N S+YLMS+SLP
Sbjct: 132 FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191

Query: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
           IF NPSIIL+DSRVYGYVT++  A  +++VFNDTTALE S VAI+SA Y N+T   D Y 
Sbjct: 192 IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKL-DAYR 250

Query: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311
           FVFPP+GS +S+++  +PL+NN+FL  A  +   G++ ST  FY   +AVGYS  T +LA
Sbjct: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310

Query: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371
           NWVA+V+Q ESVF S   KL KII+GTVVGI      +TF ++++ VKPI++L++ATELI
Sbjct: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370

Query: 372 SRGRGLRPYYENLSDRTSQ--DNTSTRTTIDLSDLD----GYTNEKEKSLPTCTED---- 421
           +  RGLRP       R +    + S+  +  L  +        N  EK+ P   +D    
Sbjct: 371 TESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQPPSDQDTNTN 430

Query: 422 --ERSKSLSNIASK------SIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVH 473
               S ++SNI  +       +F+ +  +   S R   LS TS ++    +    RVP +
Sbjct: 431 NSSSSIAVSNIREEHSPHADGVFSGI-SLSNVSDRLERLSNTSKHYTTAVNLIQARVPSY 489

Query: 474 STYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIAN 533
                DEL++L ETFN M D+LD+H  LLEERV+ARTK+LEAAKI AE  NEAKTVFIAN
Sbjct: 490 RALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIAN 549

Query: 534 ISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKT 593
           ISHELRTPLNGILGMTAI++EE D +K++ SLKLI+RSG            FSKNVL++T
Sbjct: 550 ISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRT 609

Query: 594 KLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLV 653
           KLEK +FCI D+ALQIKSIFGK+AKDQ V  SI++SPN+IR+MV +GDSNRIIQ++MNLV
Sbjct: 610 KLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLV 669

Query: 654 SNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISD-- 711
           SNALKFTP+DG VDVR+K+LG YDE  S   N++KVY+K GT  T   D+ P+  +    
Sbjct: 670 SNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEIT---DSTPSLNVKSEG 726

Query: 712 --KISFAGGSSSIHDYCS-----KTDENDNIKTEIKSDD----------STISDYSEENI 754
             K  F   ++S ++  S      T   D +  E   D+          ST S Y +   
Sbjct: 727 QGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSSYDDAIF 786

Query: 755 MGSYYENKNPGQE----LLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQT 810
              + +  N   E     +GV +  PK WVIS +VED+GPGI   LQ+SVFEPFVQGDQT
Sbjct: 787 NSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQT 846

Query: 811 LSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFE 870
           LSRQYGGTGLGLSICRQLA +M G M L+S  G+GSKFTFT+PL Q R+I F+  E  FE
Sbjct: 847 LSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFE 906

Query: 871 DEFNFNSKKNRKVNFK 886
           DEFN  SKKNRKV F+
Sbjct: 907 DEFNAKSKKNRKVKFR 922

 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 10/171 (5%)

Query: 891  TSRGIPSKAAEKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMV 950
            ++R IP  ++ K +  N      LN  + ++  K T    SE N     +K+L+ EDN V
Sbjct: 1026 STRSIPHLSSFKEEKPN---DPLLNVSSSAEQTKKT----SEGN---GAYKILVAEDNHV 1075

Query: 951  NQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRV 1010
            NQEVIKR+L+LE +K I+ A DGQ+A D VK+   +  ++++IFMD+QMP VDG T+T++
Sbjct: 1076 NQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKM 1135

Query: 1011 IRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            IR++L+  +PIVALTAFADDSN KEC ++GM+ FL+KPIKR +LK I+KEF
Sbjct: 1136 IRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1127 (44%), Positives = 668/1127 (59%), Gaps = 112/1127 (9%)

Query: 7    RLAT-SPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKS 65
            RLA   PP+   LR Q                    GVYFT+NY++LRA++L +AA+L S
Sbjct: 9    RLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMS 68

Query: 66   SQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRA 125
            SQ+DQSL  LYYQ       D + +AL  Y +GN++ ENW+E+   +  FL  S  F  A
Sbjct: 69   SQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIA 128

Query: 126  TIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSD-----ERLPASIGTIGFLTDPVLN 180
             +YD  + E+ +  NN T   + ++ + +L PL  D     E L   + T+ +      N
Sbjct: 129  YLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY------N 182

Query: 181  TSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKY 240
             +  LMS++LP+    S I+    V G++TI+  A  I AV NDT+ L  S V+I++   
Sbjct: 183  KTLNLMSMTLPV--EASTIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTG-I 238

Query: 241  RNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYS---- 296
             N       Y FVFPP  +D SV +  YP+ N SFL DAF   +   V+ST+ FY     
Sbjct: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298

Query: 297  ----SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFI 352
                  VAVGYS C F   +WVAVVSQ ESVF S   KLTKII GTV+G+A  +C VTFI
Sbjct: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358

Query: 353  MSYYIVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKE 412
            ++ + VKPI++L++ATE I+ GRGLR Y  N S R+S  NTS    ID S+  G  +   
Sbjct: 359  LASWAVKPIVRLQKATEFIAAGRGLRTY--NHSGRSSSQNTS----IDRSNSRGSDHSLP 412

Query: 413  KSL--------PTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNND 464
            + L        P  TE+  + S S  +       L  I  +         TSTN + +++
Sbjct: 413  RELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHD-----GETSTNILSDHE 467

Query: 465  TKTV--------RVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAA 516
              +         RVPV+    TDEL+EL +TFN M D LD    +LE+RV+ARTK+LEAA
Sbjct: 468  KGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAA 527

Query: 517  KIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXX 576
            KI AEA NEAKTVFIANI HELRTPLNGILGMTAIA+ E D EK+Q SLKLI+RSG    
Sbjct: 528  KIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLL 587

Query: 577  XXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTM 636
                    FSKNVL++TKLE+ HF I DIALQ+KSIFGK+AKDQ V  SI + PN IRTM
Sbjct: 588  HILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTM 647

Query: 637  VFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTS 696
            V +GDSNRIIQ++MNLVSNALKFTP+DG VDVRIKL+GEYD  +S   N+ +VYI  GT 
Sbjct: 648  VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTE 707

Query: 697  FTGDN-DAIPTEPISDKISFAGGSSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEENI- 754
             T  + + IPT    ++ +     ++           D+     K D  T+ D    +I 
Sbjct: 708  VTNSSVNNIPTVVEEEEKACEEEPTA-----------DDTPERKKKDSETVDDADAISIS 756

Query: 755  --MGSYYENKNPGQELLGVP----------------IPKPKKWVISVDVEDTGPGISPTL 796
              + + Y++     +L  +P                + KP+ WVI ++V+DTGPGI P+L
Sbjct: 757  SSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSL 816

Query: 797  QKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQ 856
             +SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA++M GTM+L+S  G GSKFTFTVPL Q
Sbjct: 817  HESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQ 876

Query: 857  ERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAAEKNDDANTNG-----Q 911
               + F++ +  FEDEFN  SKKNRKV F+ ++       S  + K    N+NG     +
Sbjct: 877  TGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNR-------SGKSRKGKMNNSNGAGSIAE 929

Query: 912  TTLNAEAKSKT-------------LKPTHITISEDNI-----DQHDFKVLIVEDNMVNQE 953
            + + +  KS++             L+ T    S  ++      +   ++L+ EDN VNQE
Sbjct: 930  SAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQE 989

Query: 954  VIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRN 1013
            VIKR+L LE    I+ A DG++A   V   + + + +D+IFMD+QMP +DG   T+++R 
Sbjct: 990  VIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQ 1049

Query: 1014 ELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKE 1060
            +L+Y YPIVALTAFADDSN KEC  SGMN+FLAKPIKR  LK+I+ E
Sbjct: 1050 KLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1082 (46%), Positives = 677/1082 (62%), Gaps = 39/1082 (3%)

Query: 12   PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
            PPY   L  Q                    GVYFT NYKSLRA++L +AAQL S+Q++Q+
Sbjct: 25   PPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQINQT 84

Query: 72   LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
            LN +YYQ  W    D + +AL+ Y  GN ++ N   +   +  FL SS+   R  +YD+ 
Sbjct: 85   LNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYDSA 144

Query: 132  FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
            F E+ +VS N TG  I DD++R L PLSS+  LP+SI   G L++PV N S++ MS+SLP
Sbjct: 145  FNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSMSLP 204

Query: 192  IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
            +    SI+   S   GY+T++  A  + +V     AL  S V++++  Y +     + Y 
Sbjct: 205  VSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVY-DENNILNSYQ 263

Query: 252  FVFPPYGSDA-SVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSL 310
             +FPP       +++I +P++NNSFL++AF   ++GSVS T  FY   VAVGY+ C+F L
Sbjct: 264  VLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFKL 323

Query: 311  ANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATEL 370
             NWVAVV+Q E+VF S + KLTKII GTV+GIA  +C VTFI++ + VKPI++L++ATEL
Sbjct: 324  VNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATEL 383

Query: 371  ISRGRGLRPYYENLSDRT-----SQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSK 425
            I+ GRGLR Y  +    +     ++ N+    +  L + DG      K+ P+      S 
Sbjct: 384  IAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGL----RKTPPSPYTPMHSH 439

Query: 426  SLSNIAS--KSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTE 483
               N +   +     + + +G    S   S     F  + +    RVPV+    +DEL+E
Sbjct: 440  VEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSE 499

Query: 484  LKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLN 543
            L +TFN M D LD H  LLE+RV+ARTK+LEAAKI AE+ NEAKT+FIANISHELRTPLN
Sbjct: 500  LTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLN 559

Query: 544  GILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIH 603
            GILGMTAIA+ E+D EK+Q SLKLI+RSG            FSKN+L++ KLE+ +F + 
Sbjct: 560  GILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMV 619

Query: 604  DIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPID 663
            D+ALQ+KSIFGK+AKDQ V FSI + PNLIR MV +GDSNRIIQ++MNLVSNALKFTP+D
Sbjct: 620  DVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVD 679

Query: 664  GNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDK-ISFAGGSS-- 720
            G V +RIKLLGEYDEE+S   N  +V+IK+GT  + +   +      +K +S +G S+  
Sbjct: 680  GKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVFDTITEEKYVSCSGESTDD 739

Query: 721  ---SIHDYCSKTDENDNIKTEIKSDDSTISD---YSEENIMGSYYENKNPGQELLGVPIP 774
               +  +   K D+ DNI   + S  S+  D   +S    + +  +        +G    
Sbjct: 740  TIETGQEGAQKPDKADNISV-VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-E 797

Query: 775  KPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHG 834
            K K WVIS++VEDTGPGI P+LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+++M G
Sbjct: 798  KKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKG 857

Query: 835  TMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK----- 889
            TM+L S  G+GSKF FTVPL Q   +   + E  FEDEFN  SK NR+V FK +K     
Sbjct: 858  TMKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSR 917

Query: 890  VTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKT-----LKPTHITISEDNID-----QHD 939
             +S  +P  +   +   N+ G++       S       L+ T    S  +I      + +
Sbjct: 918  QSSLSVPEISGVPDSPLNSMGRSESELSVSSVRVDRPFLQSTGTATSTRSIPTVGSLESN 977

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            FKVL+ EDN VNQEVIKR+L+LE I  IE A DG+EA++ V    ++ D ++I+FMD+QM
Sbjct: 978  FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQM 1037

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            P +DG  ATR IR ELNY YPIVALTAFADDSN K C  SGM+ FL+KPIKR +L++I+ 
Sbjct: 1038 PKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILL 1097

Query: 1060 EF 1061
            E+
Sbjct: 1098 EY 1099

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1152 (40%), Positives = 655/1152 (56%), Gaps = 112/1152 (9%)

Query: 1    MNLKNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIA 60
            + LK  +    PPY  +LRAQ                    GVYFT +YK L   +L+IA
Sbjct: 8    IKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIA 67

Query: 61   AQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSS 120
            +QLKSSQ+DQ+LNYLYYQ  W    + +   +    +G       +ES S +  F+ +S 
Sbjct: 68   SQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSD 127

Query: 121  IFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSS-DERLPASIGTIGFLTDPVL 179
            +F    IYD N   I N +NN +G+++   I+ +L PLSS +  +P  I   G LTDP+L
Sbjct: 128  LFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPIL 187

Query: 180  NTSNYLMSLSLPIFGNPSI---ILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAII 236
            N++ YLMS+SLPI G  S    I + S +YGY+T++  A S+ +VFNDT  L +S  A++
Sbjct: 188  NSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALL 247

Query: 237  SAKYRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYS 296
            SA Y N T     +HFVFPP+  D S+ID    + N +F + AF ++ +GS         
Sbjct: 248  SAIYTNDT-LPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNK 306

Query: 297  SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYY 356
               A+GY+   F L  WVAVV+ P+  F S + KLTKII GTVVGIA  V  ++  +SY+
Sbjct: 307  KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYW 366

Query: 357  IVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLP 416
             V+PI++L++A+ELI++ RGLR    NL+D +  D+    T  D +D   Y ++   S P
Sbjct: 367  AVQPIVRLQRASELITKRRGLR----NLNDDSFDDSNDDHT-YDSNDDHTYESKLISSTP 421

Query: 417  TCT------EDERSKSLSNIASKSI---------------FTTLRKILGFSSRSGMLSPT 455
            T         DE+S      A+                  F  LR+ +  S+   +    
Sbjct: 422  TLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSL---- 477

Query: 456  STNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEA 515
                   ++   ++VPV+     DELTEL +TFN+M+++LDEH  LLE+RV  RTK+LEA
Sbjct: 478  -------SEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEA 530

Query: 516  AKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXX 575
            AK+ AEA NEAKTVFIANISHELRTPLNGILGMT+ +LEE+D +K++  LKLI+RSG   
Sbjct: 531  AKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELL 590

Query: 576  XXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISP-NLIR 634
                     FSKNVL KTKLE   F I +I  QIK+IF K+ + Q V   I + P   ++
Sbjct: 591  LNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLK 650

Query: 635  TMVFFGDSNRIIQVIMNLVSNALKFTP-IDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKE 693
            +++F+GDSNRI+QV+MNL+SNA+KFTP ++G V+V + LLGEYDEE+S   NY KV IK 
Sbjct: 651  SLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKP 710

Query: 694  GTSFTGDNDAIPTEPISDKIS-------------FAGGSSSIHDYCS-------KTDEND 733
             T    ++  +    I  KI+              A   S+ + Y S       +T  + 
Sbjct: 711  STQIVTESGELIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHP 770

Query: 734  NIKTEIKSDDSTISDYSE----------ENIMGSYYENKNPGQELLGVP----IPKPKKW 779
               +   S+ ST+++ S           +N+M +    +    ++  +     I   KKW
Sbjct: 771  GADSRRNSNVSTVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKW 830

Query: 780  VISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELD 839
            VI  +V D GPGI   L  SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  +M GT+EL+
Sbjct: 831  VIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELE 890

Query: 840  STTGLGSKFTFTVPLLQERKIIFSETEKAFED-EFNFNSKKNRKVNFKTDKVTSRGIPSK 898
            S  G GSKF +T+PLLQ        T+K  +D E + N   N  V+    + T   I S 
Sbjct: 891  SELGKGSKFIYTIPLLQ-----VGGTKKDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSS 945

Query: 899  AAEKND----DANTNGQTTLN---AEAKSKT---------LKPTHITISE------DNID 936
            +   +D     +N+  +  L+   +EA++ +         L+ T +   +      D+ID
Sbjct: 946  SQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDID 1005

Query: 937  QHD------FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKF 990
              +       KVL+ EDN+VNQEVIKR+LKLE I  IE A DG EA + VKK +    K+
Sbjct: 1006 HCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKY 1065

Query: 991  DIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIK 1050
            DIIFMDIQMP +DG  +T  IR EL Y   IVALTAFAD+SN KEC ++GM+ F+ KPIK
Sbjct: 1066 DIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIK 1125

Query: 1051 RFELKEIIKEFQ 1062
            R  L  +++EFQ
Sbjct: 1126 RVALHTLLEEFQ 1137

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/721 (51%), Positives = 480/721 (66%), Gaps = 50/721 (6%)

Query: 12  PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
           PP+ + +R Q                    GVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 13  PPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 72

Query: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
           LNYLYYQS W    D L   L  Y +GNKT ENW +S   +  FLTS+++FS A +YD++
Sbjct: 73  LNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDSS 132

Query: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
           F  +   +NNGTG  IP+ ++++L PL++++ L +S+ TIG LTDPVLN S Y+MS+SLP
Sbjct: 133 FNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSLP 192

Query: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
           IF NPSIIL+DS+VYGY+TI+  A  +  VFNDTTALE SNVAI+S  Y N +T  + YH
Sbjct: 193 IFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTL-NAYH 251

Query: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311
           FVF PYG+ + VI+  + + NNSFL  A  E   GSV  T FFY+  +AVGYS CTFS  
Sbjct: 252 FVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFV 311

Query: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371
           NW+A+VSQ ESVF S + KL KIISGTVV I   V  +TF ++++ VKPI++L++ATEL+
Sbjct: 312 NWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELM 371

Query: 372 SRGRGLR---PYYENLSDRTS--------------------QDNTSTRTTIDLSDLDGYT 408
           S GRGL+   P  +N+S  +S                     DN ST T       +G+ 
Sbjct: 372 SEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT-------NGHL 424

Query: 409 NEKEKS-LPTCTEDERSKSLSNIASKSI-----------FTTLRKILGFSSRSGMLSPTS 456
           N++  +  P  T D  S S SN A++ I            +        S+RS  L+ TS
Sbjct: 425 NQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLT-TS 483

Query: 457 TNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAA 516
            N I        RVP +    +DEL++L +TFN M D+LD+H  LLE+RV+ARTK+LEAA
Sbjct: 484 ANLI------EARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAA 537

Query: 517 KIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXX 576
           KI AE  NEAKT+FIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG    
Sbjct: 538 KIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLL 597

Query: 577 XXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTM 636
                   FSKNVL++T LEK  FCI D+ALQIKSIFGK+AKDQ V  SI++ PN+IRTM
Sbjct: 598 HILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTM 657

Query: 637 VFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTS 696
           + FGDSNRIIQ++MNLVSNALKFTP+DG V+VRIKL+GEYDE  S  +N+ KV +K GT 
Sbjct: 658 ILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE 717

Query: 697 F 697
           F
Sbjct: 718 F 718

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 98/122 (80%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            FK+L+ EDN VNQEVIKR+L LE ++ IE A DGQ+A + VK  + + + FD+IFMD+QM
Sbjct: 1045 FKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQM 1104

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            P VDG  +T++IRN+L+Y YPIVALTAFADDSN KEC  +GMN FL+KPIKR ++K I++
Sbjct: 1105 PKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILE 1164

Query: 1060 EF 1061
            E+
Sbjct: 1165 EY 1166

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/724 (50%), Positives = 453/724 (62%), Gaps = 115/724 (15%)

Query: 446  SSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEER 505
            S+RS +L+ TS N          R+P +    +DEL++L ETFN M D+LD+H  LLEER
Sbjct: 493  SNRSHILT-TSANLT------EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEER 545

Query: 506  VKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSL 565
            V+ARTK+LEAAKI AEA NEAKTVFIANISHELRTPLNGILGMTAI++EE D  K++ SL
Sbjct: 546  VRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSL 605

Query: 566  KLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFS 625
            KLI+RSG            FSKNVLQ+TKLEK  FCI D+ALQIKSIFGK+AKDQ V  S
Sbjct: 606  KLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLS 665

Query: 626  ILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNN 685
            I + PNLIRTMV +GDSNRIIQ++MNLVSNALKFTP+DG VDVR+KLLGEYD+E S    
Sbjct: 666  ISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQ 725

Query: 686  YDKVYIKEGTSF-----TGDNDAIPT----------EPISDKISFAGGSSSIHDYCSK-- 728
            Y +VYIK+GT       T D   +PT          E  +  +     +S+I +  +K  
Sbjct: 726  YKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRN 785

Query: 729  TDENDNIKTEIKSDDSTISD----------YSEENIMGSYYENKNPGQE-----LLGVPI 773
            T  N++I  ++   +   +D           S +N + +   NK PG +      LG PI
Sbjct: 786  TVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPI 845

Query: 774  PKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMH 833
              PK WVIS++VEDTGPGI P+LQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLA++MH
Sbjct: 846  ENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 905

Query: 834  GTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK-VTS 892
            GTM+L+S  G+GSKFTFT+PL Q ++I F++ E  FEDEFN  S+KNR+V F   K + S
Sbjct: 906  GTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKS 965

Query: 893  RGIPSKAA------------------------------------EKNDD----------- 905
            R   S  A                                    EKND+           
Sbjct: 966  RQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNI 1025

Query: 906  --------ANTNGQTTLNAEAKSKT------------LKPTHITISEDNI--------DQ 937
                    A  N Q +L+++ +S+             L+ T    S  NI        ++
Sbjct: 1026 KPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNE 1085

Query: 938  HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDI 997
               K+L+VEDN VNQEVIKR+L LE I+ IE A DGQEA D VK+  S+ + +++IFMD+
Sbjct: 1086 TSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDV 1145

Query: 998  QMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEI 1057
            QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KPIKR +LK I
Sbjct: 1146 QMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTI 1205

Query: 1058 IKEF 1061
            + EF
Sbjct: 1206 LTEF 1209

 Score =  388 bits (996), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 263/373 (70%), Gaps = 1/373 (0%)

Query: 7   RLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSS 66
           +L  +PP+ + +R Q                    GVYFT+NYK+LR+++L+IAAQLKSS
Sbjct: 8   KLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126
           Q+DQ+LNYLYYQ+ +    D L  +L  Y +GNK+ +NWV+S+S +  FL+SS++F  A 
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAK 127

Query: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186
           +YD++F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ TIG LTDPVLN+++YLM
Sbjct: 128 VYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLM 187

Query: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTY 246
           S+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE+S +AIISA Y NS   
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVY-NSQGK 246

Query: 247 ADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTC 306
           A GYHFVFPPYGS + +    + + N++F+  AF     GS+  T    +   A+GYS C
Sbjct: 247 ASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPC 306

Query: 307 TFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQ 366
           +F+L NWVA+VSQPESVF S   KL KII+GTV+ I   V  +T  ++++ V+PI++L++
Sbjct: 307 SFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 367 ATELISRGRGLRP 379
           ATELI+ GRGLRP
Sbjct: 367 ATELITEGRGLRP 379

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  482 bits (1241), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 278/541 (51%), Positives = 351/541 (64%), Gaps = 67/541 (12%)

Query: 415  LPTCTEDERSKSLSNIASKSIFTTLRKILG---------FSSRSGMLSPTSTNFIVNNDT 465
            LP    + +S S+SN++ +     LR+            FS++SG L+ TS N I     
Sbjct: 474  LPLHGNNFQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLT-TSANLI----- 527

Query: 466  KTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNE 525
               RVP +    +DEL++L +TFN M D+LD+H  LLE+RV+ARTK+LEAAKI AE  NE
Sbjct: 528  -EARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANE 586

Query: 526  AKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXF 585
            AKTVFIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG            F
Sbjct: 587  AKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELLTF 646

Query: 586  SKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRI 645
            SKNVL++T LEK  FCI D+ALQIKSIFGK+AKDQ V  SI ++PN IRTMV +GDSNRI
Sbjct: 647  SKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRI 706

Query: 646  IQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTG------ 699
            IQ++MNLVSNALKFTP+DG V+V++KL+GEYDE  S+ NN+ +VY+K+GT   G      
Sbjct: 707  IQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIE 766

Query: 700  -DNDAIPTEPISDKISFAGGSS---------SIHDYCSKTD-----------ENDNI--- 735
              N++IP+ P S+  + +  +S         S  D  S  D           EN+N    
Sbjct: 767  KTNESIPS-PKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIATKDAENENTDDT 825

Query: 736  -----KTEIKSDD----STISDYSEENIMGSYYENKNPG------QELLGVPIPKPKKWV 780
                 +T+   D+    ST +   ++ I  S ++ K+PG          GV I  PK WV
Sbjct: 826  ENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFK-KSPGLYDDDENNDAGVLIEDPKTWV 884

Query: 781  ISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDS 840
            I + VEDTGPGI  TLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L S
Sbjct: 885  IQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKS 944

Query: 841  TTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAA 900
              G+GS FTFTVPL Q R+I F + E  FEDEFN  S+KNRKV FK     +R I SK +
Sbjct: 945  EVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFK----LARSIRSKKS 1000

Query: 901  E 901
             
Sbjct: 1001 R 1001

 Score =  401 bits (1031), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 270/414 (65%), Gaps = 9/414 (2%)

Query: 7   RLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSS 66
           +    PP+ + +RAQ                    GVYFT NYK+LR+++L+IAAQLKSS
Sbjct: 6   KFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSS 65

Query: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126
           Q+DQ+LNYLYYQ  +    D L  AL  Y +GNK+ ENW +S S +  FL+SS++FS A 
Sbjct: 66  QIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAK 125

Query: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186
           +YD +F  + NV+NNGTG  IPD I+ +L PLS++  L +S+ T G LTDPVLN+S YLM
Sbjct: 126 VYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLM 185

Query: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTY 246
           S+SLPIF NPS+IL++SRVYGY+T++  A  +  VFNDTTALE SNVAI+SA Y N +  
Sbjct: 186 SMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSAL 245

Query: 247 ADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTC 306
              Y FVF P G+ + +I+  Y L+N SFL  A  E   GS+ ST FFYS  VA+GYS C
Sbjct: 246 T-AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPC 304

Query: 307 TFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQ 366
           TFS  NWVAVVSQ ESVF S + KL KII+GTVV I   V  +TF ++++ VKPI++L++
Sbjct: 305 TFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQK 364

Query: 367 ATELISRGRGL-------RPYYENLSDRTSQDNTST-RTTIDLSDLDGYTNEKE 412
           ATELIS GRGL       R    N S +    NTS  R     S +  YT EK+
Sbjct: 365 ATELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQ 418

 Score =  164 bits (415), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/135 (58%), Positives = 101/135 (74%), Gaps = 3/135 (2%)

Query: 930  ISEDNIDQ---HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISE 986
            +SE N D+    + K+L+ EDN VNQEVIKR+L LE +  I+ A DGQEA D VK    +
Sbjct: 1116 LSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQ 1175

Query: 987  KDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLA 1046
             D ++IIFMD+QMP VDG  +T++IR +L+Y +PIVALTAFADDSN KEC  SGMN FL+
Sbjct: 1176 NDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLS 1235

Query: 1047 KPIKRFELKEIIKEF 1061
            KPIKR +L+ IIKE+
Sbjct: 1236 KPIKRPKLRTIIKEY 1250

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  459 bits (1181), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 260/476 (54%), Positives = 326/476 (68%), Gaps = 39/476 (8%)

Query: 446 SSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEER 505
           SSRS +L+ TS N          R+P +    +DEL++L ETFN M D+LD+H  LLE+R
Sbjct: 493 SSRSHILT-TSANLT------EARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDR 545

Query: 506 VKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSL 565
           V+ARTK+LEAAKI AEA NEAKTVFIANISHELRTPLNGILGMTAI++EE D  K++ +L
Sbjct: 546 VRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNL 605

Query: 566 KLIYRSGXXXXXXXXXXXXFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFS 625
           KLI+RSG            FSKNVLQ+TKLE+  FCI D+ALQIKSIFGK+AKDQ V  S
Sbjct: 606 KLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLS 665

Query: 626 ILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNN 685
           I + PNLIRTMV +GDSNRIIQ++MNLVSNALKFTP+DG VDVR+KLLGEYD++ S    
Sbjct: 666 ISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQ 725

Query: 686 YDKVYIKEGTSFTG-----DNDAIPT----------EPISDKISFAGGSSSIHDYCSK-- 728
           + +V++K+GT  T      D   +PT          E  +  I+    +S+I +  +K  
Sbjct: 726 FKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRN 785

Query: 729 TDENDNI------KTEIKSDDSTISDYSEENIMGSYYENKNPGQEL---------LGVPI 773
           T  N+NI      + +  +DD +    +  +       N    + L         +G PI
Sbjct: 786 TAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPI 845

Query: 774 PKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMH 833
             PK WVIS++VEDTGPGI P+LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA++MH
Sbjct: 846 ENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 905

Query: 834 GTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK 889
           GTM+L+S  G+GSKFTFT+PL Q ++I F+  E  FEDEFN  SKKNR+V F   K
Sbjct: 906 GTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAK 961

 Score =  393 bits (1010), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/368 (52%), Positives = 261/368 (70%), Gaps = 1/368 (0%)

Query: 12  PPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71
           PP+ + +RAQ                    GVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131
           LNYLYYQ+ +    D L  +L  Y +GNK+ +NWV+S+S V  FL+SS++F  A +YD++
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191
           F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ T G LTDP++N ++YLMS+SLP
Sbjct: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192

Query: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251
           IF NPSIIL+DSRVYGY+TI+  A  + +VFNDTTALE SNVAIISA Y N+   A GYH
Sbjct: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATY-NAQGRASGYH 251

Query: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311
           FVFPPYG+  S+    +P+ NN+F+   F     GS+  T  F +  +A+GYS C+F L 
Sbjct: 252 FVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLV 311

Query: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371
           NWVAVVSQPESVF S   KLTKII+GTV+ I   V  +T  ++++ VKPI++L++ATELI
Sbjct: 312 NWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELI 371

Query: 372 SRGRGLRP 379
           + GRGLRP
Sbjct: 372 TEGRGLRP 379

 Score =  159 bits (403), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/133 (57%), Positives = 97/133 (72%)

Query: 929  TISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKD 988
            T+   + D    K+L+VEDN VNQEVI+R+L LE I  IE A DGQEA D VK+  S+ +
Sbjct: 1078 TVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGE 1137

Query: 989  KFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKP 1048
             +++IFMD+QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KP
Sbjct: 1138 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKP 1197

Query: 1049 IKRFELKEIIKEF 1061
            IKR +L  I+ EF
Sbjct: 1198 IKRPKLNTILSEF 1210

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  448 bits (1152), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 248/451 (54%), Positives = 313/451 (69%), Gaps = 34/451 (7%)

Query: 468 VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527
            R+P +    +DEL++L ETFN M D+LD+H  LLE+RV+ARTK+LEAAKI AEA NEAK
Sbjct: 508 ARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAK 567

Query: 528 TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGXXXXXXXXXXXXFSK 587
           TVFIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG            FSK
Sbjct: 568 TVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSK 627

Query: 588 NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQ 647
           NVLQ+TKLEK  FCI D+ALQIKSIFGK+AKDQ V  SI + PN IRTMV +GDSNRIIQ
Sbjct: 628 NVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQ 687

Query: 648 VIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGD------N 701
           ++MNLVSNALKFTP+DG V+VR+KLLGEYD+E S    + +V++++GT    D      +
Sbjct: 688 IVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGNINKH 747

Query: 702 DAIPTEPISDKISFAGG---------SSSIHDYCSK--TDENDNIKTEIKSDDSTISD-- 748
           DA  +E     +              +S+I +  +K  T  N+NI  + +  + + +D  
Sbjct: 748 DAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYKKTRDREKSSNDDI 807

Query: 749 ---------YSEENIMGSYYENKNPGQE-----LLGVPIPKPKKWVISVDVEDTGPGISP 794
                      ++ I  S + NK  G +      LG PI  PK W IS++VEDTGPGI P
Sbjct: 808 SSIVSTSTSSYDDAIFNSQF-NKALGSDDDEGGDLGKPIENPKTWAISIEVEDTGPGIDP 866

Query: 795 TLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPL 854
           +LQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKFTFT+PL
Sbjct: 867 SLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPL 926

Query: 855 LQERKIIFSETEKAFEDEFNFNSKKNRKVNF 885
            Q ++I F+     FEDEFN  S++NR+V F
Sbjct: 927 HQTKEISFANMNFPFEDEFNPESRQNRRVKF 957

 Score =  396 bits (1017), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 270/384 (70%), Gaps = 3/384 (0%)

Query: 7   RLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQLKSS 66
           R   +PP+ +++RAQ                    GVYFT+NYK+LR+++L+IAAQLKSS
Sbjct: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126
           Q+DQ+LNYLYYQ+ +    D L ++L  Y +GNK+++NWV+S+S V  FL+SS++F  A 
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127

Query: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186
           +YD++F  + N +NNGTG  IP DI  +L PLS+D  LP+S+ T G LTDP+LN+++YLM
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187

Query: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRN-STT 245
           S+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE SNVAIISA Y N S  
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247

Query: 246 YADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYST 305
           YA  YHFVFPPYG+ +S+    +P+ NN+F+  AF     GS+  T  F    +A+GYS 
Sbjct: 248 YA--YHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSP 305

Query: 306 CTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLK 365
           C+F L NWVAVVSQPESVF S + KL KII+GTV+ I   V  +T  ++++ V+PI++L+
Sbjct: 306 CSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQ 365

Query: 366 QATELISRGRGLRPYYENLSDRTS 389
           +ATELI+ GRGLRP       RTS
Sbjct: 366 KATELITEGRGLRPSTPRTVSRTS 389

 Score =  160 bits (406), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 98/133 (73%)

Query: 929  TISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKD 988
            T+S  +      K+L+VEDN VNQEVIKR+L LE I+ IE A DGQ+A D VK+  S  +
Sbjct: 1078 TVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGE 1137

Query: 989  KFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKP 1048
             +++IFMD+QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KP
Sbjct: 1138 SYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1197

Query: 1049 IKRFELKEIIKEF 1061
            IKR +LK I+ EF
Sbjct: 1198 IKRPKLKTILIEF 1210

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  425 bits (1092), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/393 (51%), Positives = 272/393 (69%), Gaps = 4/393 (1%)

Query: 4   KNLRLATSPPYPMNLRAQXXXXXXXXXXXXXXXXXXXXGVYFTNNYKSLRAEQLFIAAQL 63
           +  R    PP  + +R Q                    G+YFT NYK +R ++L IAA+L
Sbjct: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64

Query: 64  KSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFS 123
           KSSQ+DQ+LN+LYYQ  W    D L  A+  YF+GNK++  W +S   V  FL+SS IFS
Sbjct: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124

Query: 124 RATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSN 183
            + +YD NF  + N +NNGTG  +P+D++ +L PLSS + LPAS+G+ G LTDPVLN++ 
Sbjct: 125 ISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTT 184

Query: 184 YLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNS 243
           YLMS+SLPI  NPSIIL+DS+VYGY+TII  A S+++V+NDTTALE SNVAI+S +Y + 
Sbjct: 185 YLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDY 244

Query: 244 TTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGY 303
           +     YHFVFPPYG+   +IDI+YPL N SFL+DA      GS+  T FFY++ VA+GY
Sbjct: 245 SASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGY 304

Query: 304 STCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIK 363
           S C+F L +WVA+VSQPESVF S + KLT+II+GTVV IA  VCFVTF +S++ VKPI++
Sbjct: 305 SPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVR 364

Query: 364 LKQATELISRGRGLRPYYENLSDRTSQDNTSTR 396
           L++ATELI+ GRGLR    + S+RT   N S +
Sbjct: 365 LQKATELIAEGRGLR----SSSNRTLSRNGSLK 393

 Score =  146 bits (368), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (76%), Gaps = 5/124 (4%)

Query: 943  LIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKIS-----EKDKFDIIFMDI 997
            L+ EDN VNQEVIKR+LKLEK+  I+ A DG+EA   VK+  S     +K+ +D+IFMD+
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 998  QMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEI 1057
            QMP +DG  +T++IR+EL Y  PIVALTAFAD+SN KEC + GM+ FL+KPIKR +LK+I
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1058 IKEF 1061
            + EF
Sbjct: 1193 LNEF 1196

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V  ++  + L+     T+    DG  AI ++     E  +FD++ MDI M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVL-----ENHRFDLVLMDIVM 469

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT ++RN  NY  PI+A+T   +D +       GMN  LAKP  + +L  ++ 
Sbjct: 470  PNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1060 EF 1061
             +
Sbjct: 529  RY 530

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 99/207 (47%), Gaps = 20/207 (9%)

Query: 864  ETEKAFEDEFN---------FNSKKNRKVNFKTDKVTSRGIPSK---AAEKNDDANTNGQ 911
            E  + F D+ N          N  K +K +F  D   +  +P     AA  +      G 
Sbjct: 247  EVPQPFYDQMNRGGNLSKGALNEHKPQK-SFDLDTAAASMVPGTMPLAAPSHPSGAAPGD 305

Query: 912  TTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAV 971
             +L     + +  P  +  ++ ++ +  F VL+VED+ V  ++  + L+     T+E   
Sbjct: 306  LSLPLAHITASKPPGGLDTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVT 364

Query: 972  DGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDS 1031
            DG  AI  +     EK ++D++ MDI MPN+DG TAT ++R+  N+  PI+A+T   +D 
Sbjct: 365  DGLSAISTL-----EKFRYDLVLMDIVMPNLDGATATSIVRSFDNH-TPIIAMTGNIEDQ 418

Query: 1032 NKKECENSGMNAFLAKPIKRFELKEII 1058
            +       GMN  LAKP  + +L  ++
Sbjct: 419  DLITYLQHGMNDILAKPFTKDDLHSML 445

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 12/129 (9%)

Query: 935  IDQH-----DFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDK 989
            +DQH      F VL+VED+ V  ++  + L+     ++E   DG  AI  +     EK +
Sbjct: 319  MDQHPVLRPGFHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTL-----EKQR 372

Query: 990  FDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPI 1049
            FD++ MDI MPN+DG TAT ++R+  +   PI+A+T   DD +       GMN  LAKP 
Sbjct: 373  FDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPF 431

Query: 1050 KRFELKEII 1058
             + +L  ++
Sbjct: 432  TKDDLHSML 440

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+ ++  + L+     T++   DG  AI I+     EK +FD++ MDI M
Sbjct: 382  FHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISIL-----EKFRFDLVLMDIVM 435

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT +IRN  +   PI+A+T   +  +       GMN  LAKP  R +L  I+
Sbjct: 436  PNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSIL 493

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+  +  + L+     T+E   DG  AI  +     EK ++D++ MDI M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTL-----EKFRYDLVLMDIVM 434

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT +IRN  N   PI+A+T   +D +       GMN  LAKP  + +L  ++ 
Sbjct: 435  PNLDGATATSIIRNFDNQ-TPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1060 EF 1061
             +
Sbjct: 494  RY 495

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (56%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ ++ ++  + L+     T+E   DG  AI  +     EK ++D++ MDI M
Sbjct: 353  FHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTL-----EKFRYDLVLMDIVM 406

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT +IR+  +   PI+A+T   +D +       GMN  LAKP  R +L  ++ 
Sbjct: 407  PNLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1060 EF 1061
             +
Sbjct: 466  RY 467

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 72/129 (55%), Gaps = 7/129 (5%)

Query: 933  DNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDI 992
            D I +  F VL+VED+ V+ ++  + L ++   T++   DG  AI  +     EK +FD+
Sbjct: 343  DTILKKGFNVLLVEDDEVSIQLCSKFL-IKYGCTVQVVTDGLAAISTL-----EKYRFDL 396

Query: 993  IFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRF 1052
            + MDI MPN+DG TAT +IRN  +   PI+A+T   +  +       GMN  LAKP  R 
Sbjct: 397  VLMDIVMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRR 455

Query: 1053 ELKEIIKEF 1061
            +L  ++  +
Sbjct: 456  DLYSMLTRY 464

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (55%), Gaps = 13/127 (10%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+DI K+         +IFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 572

Query: 1002 VDGHTATRVIRN-------ELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFEL 1054
            + G  A + IR+         N P  IVALTA     +K++   SG N +L KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1055 KEIIKEF 1061
             + I E+
Sbjct: 633  SKKITEW 639

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V  ++  + L+     ++E   DG  AI+ V     EK ++D++ MDI M
Sbjct: 318  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETV-----EKFQYDLVLMDIVM 371

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT VIR+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++ 
Sbjct: 372  PNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLV 430

Query: 1060 EF 1061
             +
Sbjct: 431  RY 432

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ ++ ++  + L+     T++   DG  AI  +     E  ++D++ MDI M
Sbjct: 403  FHVLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAITTL-----ENSRYDLVLMDIVM 456

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT +IR+  +   PI+A+T   DD +       GMN  LAKP  R +L  ++
Sbjct: 457  PNLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSML 514

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+ ++  + L+     T++   DG  AI  +     EK ++D++ MDI M
Sbjct: 405  FHVLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISNL-----EKFRYDLVLMDIVM 458

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT ++R+  N   PI+A+T   +D +       GMN  LAKP  R +L  I+
Sbjct: 459  PNLDGATATSIVRSFDNQ-TPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSIL 516

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (56%), Gaps = 7/115 (6%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            + VL+VED+ V+ ++  + L+     T+E   DG  AI I+     E  ++D++ MDI M
Sbjct: 424  YHVLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISIL-----EAFRYDLVLMDIVM 477

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFEL 1054
            PN+DG TAT +IRN  +   PI+A+T   +D +       GM   LAKP  R +L
Sbjct: 478  PNLDGATATSIIRN-FDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDL 531

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ +  ++  + L ++   T+E   DG  AI  +     EK +FD++ MDI M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTL-----EKFRFDLVLMDIVM 355

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT ++R+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++
Sbjct: 356  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 413

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V  ++  + L+     ++E   DG  AI+ V     EK ++D++ MDI M
Sbjct: 329  FCVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETV-----EKFQYDLVLMDIVM 382

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT VIR+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++
Sbjct: 383  PNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 440

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V  ++  + L+     T+E   DG  AI  +     EK ++D++ MDI M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTL-----EKFRYDLVLMDIVM 429

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT ++R+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++ 
Sbjct: 430  PNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1060 EF 1061
             +
Sbjct: 489  RY 490

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (51%), Gaps = 20/149 (13%)

Query: 913  TLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVD 972
            T NA+A + TL+               F VL+VED++V+ ++  + L+     T++   D
Sbjct: 365  TPNAQANTVTLR-------------KGFHVLLVEDDVVSIQLCSKFLRKYGC-TVQVVTD 410

Query: 973  GQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSN 1032
            G  AI  +     EK ++D++ MDI MPN+DG TAT ++R   +   PI+A+T    + +
Sbjct: 411  GLSAISTL-----EKFRYDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQD 464

Query: 1033 KKECENSGMNAFLAKPIKRFELKEIIKEF 1061
                   GMN  LAKP  R +L  I+  +
Sbjct: 465  LITYLQHGMNDILAKPFTRDDLHSILIRY 493

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 73/140 (52%), Gaps = 26/140 (18%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ +++  LK  KI + + A +GQEA+D  K     +   D+IFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWK-----EGGIDLIFMDLQLPV 556

Query: 1002 VDGHTATRVIRN--ELN------------------YPYPIVALTAFADDSNKKECENSGM 1041
              G  A + IR+  +LN                   P  IVA TA    ++K+E   SG 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1042 NAFLAKPIKRFELKEIIKEF 1061
            N +L KP+    L + I E+
Sbjct: 617  NDYLTKPVNLHWLSKKINEW 636

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 71/146 (48%), Gaps = 32/146 (21%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI   + A +GQEAID+ ++         +IFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEAIDVWRE-----GGIHLIFMDLQLPV 620

Query: 1002 VDGHTATRVIR--------------------------NELNYPYPIVALTAFADDSNKKE 1035
            + G  A + IR                          +++N P  IVA TA    S+KKE
Sbjct: 621  LSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKE 680

Query: 1036 CENSGMNAFLAKPIKRFELKEIIKEF 1061
               SG N +L KP+    L   I E+
Sbjct: 681  ALISGCNDYLTKPVNLHWLSNKINEW 706

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+ ++  + L+     T++   DG  AI  +     EK ++D++ MDI M
Sbjct: 379  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTL-----EKFRYDLVLMDIVM 432

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT ++R   +   PI+A+T    + +       GMN  LAKP  R +L  I+ 
Sbjct: 433  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1060 EF 1061
             +
Sbjct: 492  RY 493

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V  ++  + L L+   ++E   DG  AI  +     EK ++D++ MDI M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFL-LKYGCSVEVVTDGLSAISTL-----EKFRYDLVLMDIVM 360

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT ++R+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++
Sbjct: 361  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSML 418

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+ ++  + L+     T++   DG  AI  +     EK ++D++ MDI M
Sbjct: 377  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVSDGLSAISTL-----EKYRYDLVLMDIVM 430

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT ++R   +   PI+A+T    + +       GMN  LAKP  R +L  I+ 
Sbjct: 431  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 489

Query: 1060 EF 1061
             +
Sbjct: 490  RY 491

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ V+ ++  + L+     T++   DG  AI  +     EK ++D++ MDI M
Sbjct: 378  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTL-----EKFRYDLVLMDIVM 431

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059
            PN+DG TAT ++R   +   PI+A+T    + +       GMN  LAKP  R +L  I+ 
Sbjct: 432  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 490

Query: 1060 EF 1061
             +
Sbjct: 491  RY 492

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999
            F VL+VED+ +  ++  + L ++   T+E   DG  AI  +     EK ++D++ MDI M
Sbjct: 305  FHVLLVEDDSICIQLCSKFL-MKYGCTVEVVTDGLSAISTL-----EKFRYDLVLMDIVM 358

Query: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEII 1058
            PN+DG TAT ++R+  +   PI+A+T   +D +       GMN  LAKP  + +L  ++
Sbjct: 359  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 416

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 70/139 (50%), Gaps = 25/139 (17%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+DI K+         +IFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 600

Query: 1002 VDGHTATRVIR-------------------NELNYPYPIVALTAFADDSNKKECENSGMN 1042
            + G  A R IR                   N+   P  IVALTA     +K+    SG N
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1043 AFLAKPIKRFELKEIIKEF 1061
             +L KP+    L + I E+
Sbjct: 661  DYLTKPVNLHWLSKKITEW 679

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 73/147 (49%), Gaps = 33/147 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +GQEA++I K+         +IFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPV 541

Query: 1002 VDGHTATRVIRN-----------ELNYPYP----------------IVALTAFADDSNKK 1034
            + G  A + IR+            LN  YP                IVALTA     +K+
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1035 ECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +   SG N +L KP+    L + I E+
Sbjct: 602  KALVSGCNDYLTKPVNLHWLSKKITEW 628

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 68/125 (54%), Gaps = 11/125 (8%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+++ K          +IFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVEMWKN-----GGLHLIFMDLQLPV 530

Query: 1002 VDGHTATRVIRN-----ELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKE 1056
            + G  A + IR+         P  IVALTA     +K+    SG N +L KP+    L +
Sbjct: 531  LSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLSK 590

Query: 1057 IIKEF 1061
             I E+
Sbjct: 591  KITEW 595

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + E A +G EA++  +K         +I MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWRK-----GGIHLILMDLQLPL 564

Query: 1002 VDGHTATRVIRN-----------------------ELNY-----PYPIVALTAFADDSNK 1033
            + G  A + IRN                       ELN      P  IVALTAF+  +++
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1034 KECENSGMNAFLAKPIKRFELKEIIKEF 1061
             E   +G N +L KP+    L   I E+
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEW 652

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (49%), Gaps = 29/143 (20%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+DI K+         +IFMD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 725

Query: 1002 VDGHTATRVIR------------NELNY-----------PYPIVALTAFADDSNKKECEN 1038
            + G  A R IR            N L             P  IVALTA     +K++   
Sbjct: 726  LSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKALL 785

Query: 1039 SGMNAFLAKPIKRFELKEIIKEF 1061
            SG N +L KP+    L + I E+
Sbjct: 786  SGCNDYLTKPVNLHWLSKKITEW 808

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 71/148 (47%), Gaps = 35/148 (23%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+D  K+         +IFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQLPV 518

Query: 1002 VDGHTATRVIRNEL----------------------------NYPYPIVALTAFADDSNK 1033
            + G  A + IR EL                            N P  IVALTA     +K
Sbjct: 519  LSGIEAAKKIR-ELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDK 577

Query: 1034 KECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +E   SG N +L KP+    L + I E+
Sbjct: 578  REALISGCNDYLTKPVNLLWLSKKITEW 605

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 33/147 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +GQEA++I K+         +IFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPV 559

Query: 1002 VDGHTATRVIRN-----------ELN----------------YPYPIVALTAFADDSNKK 1034
            + G  A + IR+            LN                 P  IVALTA     +K+
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1035 ECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +   SG N +L KP+    L + I E+
Sbjct: 620  KALLSGCNDYLTKPVNLHWLSKKITEW 646

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 33/147 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +GQEA++I K+         +IFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPV 558

Query: 1002 VDGHTATRVIR--------------NELNY-------------PYPIVALTAFADDSNKK 1034
            + G  A + IR              N  +Y             P  IVALTA     +K+
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1035 ECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +   SG N +L KP+    L + I E+
Sbjct: 619  KALLSGCNDYLTKPVNLHWLSKKITEW 645

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 35/170 (20%)

Query: 920  SKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDI 979
            S   +P+ I  + D +      VLIVEDN++NQ ++   LK  +I + E A +G EA++ 
Sbjct: 530  SPNYRPSPIKRTRDKVFP-KINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEK 587

Query: 980  VKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRN-------------------------- 1013
             +     +    +I MD+Q+P + G  AT+ IR+                          
Sbjct: 588  WR-----QGGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLD 642

Query: 1014 --ELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
              +   P  IVALTAF+  ++++E   +G N +L KP+    L   I E+
Sbjct: 643  RSKFRSPVIIVALTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 33/147 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +GQEA++I K+         +IFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPV 548

Query: 1002 VDGHTATRVIRN-----------ELN----------------YPYPIVALTAFADDSNKK 1034
            + G  A + IR+            LN                 P  IVALTA     +K+
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1035 ECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +   SG N +L KP+    L + I E+
Sbjct: 609  KALLSGCNDYLTKPVNLHWLSKKITEW 635

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 69/150 (46%), Gaps = 36/150 (24%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+D  K     +    +IFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWK-----EGGLHLIFMDLQLPV 566

Query: 1002 VDGHTATRVIR------------------------------NELNYPYPIVALTAFADDS 1031
            + G  A + IR                              N    P  IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1032 NKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +K+E   SG N +L KP+    L + I E+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 68/143 (47%), Gaps = 29/143 (20%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VL+VEDNM+NQ ++   L+  KI + + A +G EA+D  K     +    +I MD++MP 
Sbjct: 421  VLVVEDNMINQTILSSFLRKHKI-SYKVAKNGIEAVDRWK-----EGGMHLILMDLEMPL 474

Query: 1002 VDGHTATRVIRN--ELN---------------------YPYPIVALTAFADDSNKKECEN 1038
            + G  A + IR   +LN                      P  IVALTA    S+K E   
Sbjct: 475  LSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALL 534

Query: 1039 SGMNAFLAKPIKRFELKEIIKEF 1061
            +G N +L KP+    L   I E+
Sbjct: 535  AGCNDYLTKPVNLDWLTRKITEW 557

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 28/142 (19%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VL+VEDNM+NQ ++   L+  KI   + A +G EA+D  K     +    +I MD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWK-----EGGMHLILMDLEMPL 461

Query: 1002 VDGHTATRVIRN-----------------EL-----NYPYPIVALTAFADDSNKKECENS 1039
            + G  A + IR                  EL       P  IVALTA    ++K E   +
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1040 GMNAFLAKPIKRFELKEIIKEF 1061
            G N +L KP+    L   I E+
Sbjct: 522  GCNDYLTKPVNLDWLTRKITEW 543

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 68/148 (45%), Gaps = 34/148 (22%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI +   A +G+EA++  K+         +IFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWKEG-----GIHLIFMDLQLPV 526

Query: 1002 VDGHTATRVIRN----------------------------ELNYPYPIVALTAFADDSNK 1033
            + G  A + IR                              L  P  +VA TA    ++K
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1034 KECENSGMNAFLAKPIKRFELKEIIKEF 1061
            +E   SG N +L KP+    L + I E+
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 40/177 (22%)

Query: 917  EAKSKT--LKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQ 974
            E KS T  +KP   + SE+   +    +LIVEDN++NQ ++   L+  KI   + A +G+
Sbjct: 542  ELKSTTNPVKPKMRSTSENIFPR--INILIVEDNVINQTILGSFLRKNKI-FYKVAKNGR 598

Query: 975  EAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIR---------------------- 1012
            EA+D  K     +    +IFMD+Q+P + G  A + IR                      
Sbjct: 599  EAVDKWK-----EGGIHLIFMDLQLPVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSL 653

Query: 1013 --------NELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
                    +    P  IVA TA    ++K+    +G N +L KP+    L + I E+
Sbjct: 654  SESFLNTKSSACAPVIIVAFTASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 45/72 (62%), Gaps = 6/72 (8%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN++NQ ++   L+  KI + + A +G+EA+D  K     +    +I +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWK-----QGGIHLILLDLQLPI 517

Query: 1002 VDGHTATRVIRN 1013
            + G  AT+ IRN
Sbjct: 518  LSGIEATKEIRN 529

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001
            VLIVEDN +NQ ++   L+   I + + A DG EAI+    K  E D   +I MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIE----KWKEGDSH-LILMDLQLPL 449

Query: 1002 VDGHTATRVIR 1012
            + G  AT+ IR
Sbjct: 450  LSGLEATKKIR 460

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 781 ISVDVEDTGPGISPTLQKSVFE-------------PFVQGDQTLSR--QYGGTGLGLSIC 825
           +S+ V D G GI P  +  + +             P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 826 RQLASIMHGTMELDSTTGLGS 846
           R  A +  G++ + S  GLG+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 14/113 (12%)

Query: 955  IKRLLKLEKIKTIEYAV----DGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRV 1010
            I R    E +++I  +V    +G+E +    ++ +   KFD+I   +++P +      ++
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELV----RRATTGVKFDLIITAMKLPKLGAIDIAKL 1504

Query: 1011 IR--NELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
            IR  N +N   PIVALT +  D+     E+   +  L KP+   +L++++ ++
Sbjct: 1505 IRHTNSVNCTTPIVALTVYYHDAK----ESKVFDDVLEKPVSVEQLRKLVSKY 1553

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 17/82 (20%)

Query: 781 ISVDVEDTGPGISPTLQKSVFE----------------PFVQGDQTLSRQYGGTGLGLSI 824
           + + + D G GI P ++  VF+                 +V   Q + +   G G GL +
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEV-QNVAGMGFGLPM 383

Query: 825 CRQLASIMHGTMELDSTTGLGS 846
           C+    + +GT+++ S  G G+
Sbjct: 384 CKAYLELFNGTLDIQSLWGWGT 405

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
            YFL033C
          Length = 1450

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 82/180 (45%), Gaps = 14/180 (7%)

Query: 886  KTDKVTSR-GIPSKAAEKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLI 944
            +T +V S+   P + +  N+ +       L   +K  +L+    T + D    +D  +L+
Sbjct: 1258 RTSRVHSKMSTPVQMSSLNEFSTPEDSNRLQMISKMNSLRRKRSTNTPDGSISYDLDILL 1317

Query: 945  VEDNMVNQEVIKRLLKLEKIK-TIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVD 1003
             E   +++      + LE +  T+  A  G E +     K +   KFD+I   +++PNV 
Sbjct: 1318 CEPIPIHR--YSATMDLENLGCTVISAATGDELV----TKATSDIKFDLIVTTLRLPNVY 1371

Query: 1004 GHTATRVIR--NELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061
                 ++++  N +N   PIVA T +  D+          +  + KP+ R +L++++ ++
Sbjct: 1372 ATDIIKLVKRANCVNSDTPIVAATNYYQDA----VNTKFFDDVVEKPLSREKLRKLVSKY 1427

>NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {ON}
            Anc_8.34
          Length = 1707

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 955  IKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIR-- 1012
            I R   ++ ++++   V      D +  +   +  FD+I   +++PNV      R+++  
Sbjct: 1580 IHRYRIIKDLESLGCTVIAASGADELVSRADAEITFDLIITTLKLPNVSSTELIRLLKFT 1639

Query: 1013 NELNYPYPIVALTAFADDSNKKECENSGM-NAFLAKPIKRFELKEIIKEF 1061
            N  N   PIVALT++ +     E  NS + +  L KP++  +++ +I ++
Sbjct: 1640 NGTNSATPIVALTSYYE-----EAMNSNVFDYVLEKPLQMKDIRNLISKY 1684

>Smik_9.54 Chr9 complement(122052..123763,123794..126440) [4359 bp,
           1452 aa] {ON} YIL115C (REAL)
          Length = 1452

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 15/99 (15%)

Query: 137 NVSNNGTGAHIPDDIIRQ-----LTPLSSD-------ERLPASIGTIGFLTDPVLNTSNY 184
           N S+  +G  + D  + Q     LT +SSD       E +P S  +IG LT+ +  ++N 
Sbjct: 777 NNSSGLSGNDLTDSTVEQTPSTRLTEISSDVNSEAIEEEIPKS--SIGKLTETIKKSANI 834

Query: 185 LM-SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVF 222
            M SL  P+FGN     S+S    + T I+  SS    F
Sbjct: 835 DMNSLKNPVFGNQVKAKSESPFSAFATNISKPSSTTPAF 873

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 781 ISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 825
           + + + D G GI P ++  +F+       T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 826 RQLASIMHGTMELDSTTGLGS 846
           +    + +GT+++ S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON}
           YIL042C (REAL)
          Length = 393

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 18/98 (18%)

Query: 765 GQELLGVPIP----KPKKWVISVDVEDTGPGISPTLQKSVF---------EPFVQGDQTL 811
           GQE   VPI     KP    + + + D G GI+P ++  +F         +P  +     
Sbjct: 280 GQE--HVPIEINLLKPDDDELYIRIRDHGGGITPEVEALMFDYSYSTHSQQPSEEATDLP 337

Query: 812 SRQ---YGGTGLGLSICRQLASIMHGTMELDSTTGLGS 846
             Q     G G GL +C+    +  G M++ S  G G+
Sbjct: 338 GEQINNVSGMGFGLPMCKTYLELFGGKMDIQSLPGWGT 375

>KNAG0D02430 Chr4 (431696..432847) [1152 bp, 383 aa] {ON} Anc_8.90
            YPL001W
          Length = 383

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 9/78 (11%)

Query: 946  EDNMVNQ-EVIKRLLKL--EKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN- 1001
            E   VN+ E  +R+ +L  EK K  EY +DG++ + + K K+SE D F  +   IQ+   
Sbjct: 105  ESQWVNKIEAERRVFQLPDEKFKVCEYTLDGEQFV-VYKLKLSESDYFKRLHRRIQIFTL 163

Query: 1002 --VDGHTATRVIRNELNY 1017
              ++G  A+ +  NE N+
Sbjct: 164  LFIEG--ASYIDENEPNW 179

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 31.2 bits (69), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 701 NDAIPTEPISDKISFAGGSSSIHDYCSKTD-ENDNIKTEIKSDDSTISDYS---EENIMG 756
           +++   +P+S  +        + ++  + D E   I  +  S+D T + +    E++ +G
Sbjct: 2   SESAKVDPVSQDVDMTKDEQPVEEFEDEPDREKIKILPQATSEDGTCASFQIAEEDHTLG 61

Query: 757 S---YYENKNPGQELLGVPIPKPKKWVISVDVEDTG 789
           +   Y   KNP  E  G  IP P + ++++ V+  G
Sbjct: 62  NALRYMIMKNPDVEFCGYSIPHPSENLLNIRVQTYG 97

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 40/99 (40%), Gaps = 19/99 (19%)

Query: 771 VPIPKPKKWVISVDVEDTGPGISPTLQKSVFE-----------------PFVQGDQTLSR 813
           V + +P +  +++ V D G GI P ++  +F+                     G+    +
Sbjct: 303 VTLLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV--K 360

Query: 814 QYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTV 852
              G G GL +CR    +  G +++ S  G G+    T+
Sbjct: 361 SVAGMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>Ecym_3233 Chr3 complement(434815..436809) [1995 bp, 664 aa] {ON}
           similar to Ashbya gossypii AER090W
          Length = 664

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 7/104 (6%)

Query: 471 PVHSTYITDELTELKETFNIMADSLDEHS--NLLEERVKARTKELEAAKIVAEATNEAKT 528
           P+ ST   D+  EL+  ++++  S +     N L   VK     L A+      T +A+ 
Sbjct: 120 PMASTGNPDDTAELRGMYSMLQSSTNVTGTMNALSSLVKG---TLAASPETNSNTAQARG 176

Query: 529 VFIANISHELRTPLNGILGMTAIA-LEEDDNEKLQGSLKLIYRS 571
            ++  +  + R+P++ + GM A+A L E+D EKL G+  L+  S
Sbjct: 177 -YLQTLLLDSRSPVDTVGGMLALAKLTEEDKEKLVGTFGLLRNS 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,523,512
Number of extensions: 5436051
Number of successful extensions: 24052
Number of sequences better than 10.0: 218
Number of HSP's gapped: 24915
Number of HSP's successfully gapped: 256
Length of query: 1068
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 948
Effective length of database: 39,721,479
Effective search space: 37655962092
Effective search space used: 37655962092
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 71 (32.0 bits)