Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E002305.702ON1284128460640.0
SAKL0E14916g5.702ON17797143573e-33
Smik_11.3585.702ON18787253475e-32
Suva_11.3315.702ON18987373172e-28
YKR095W (MLP1)5.702ON18757363144e-28
Kwal_55.196975.702ON17607343118e-28
KLTH0E01056g5.702ON17716983021e-26
Skud_11.3345.702ON18857332965e-26
Kpol_1043.705.702ON13214512804e-24
TDEL0B021905.702ON18107192672e-22
NCAS0A032005.702ON17887272625e-22
ZYRO0G06600g5.702ON18206432572e-21
AFR286W5.702ON17586102455e-20
Ecym_40185.702ON17697192242e-17
KNAG0C065905.702ON16513882196e-17
KLLA0A00594g5.702ON17487352189e-17
CAGL0G02497g5.702ON17804951936e-14
KAFR0H002105.702ON14547331614e-10
KAFR0D022205.702ON16747041444e-08
TBLA0E017305.702ON18201281435e-08
NCAS0G002305.702ON17351731346e-07
Kpol_2001.755.702ON1006711060.001
YIL149C (MLP2)5.702ON16791531030.003
NDAI0E050405.702ON1973751030.003
KNAG0L021405.702ON160848960.015
NDAI0F002905.702ON155498910.072
TPHA0D046105.702ON118350870.18
Suva_9.395.702ON168250850.29
Smik_9.205.702ON1682133850.36
Skud_9.195.702ON168057830.55
KAFR0B062208.408ON539120820.62
NCAS0F008402.539ON128080820.62
TPHA0O004601.485ON63259791.3
KLLA0D06875g8.636ON46261791.4
Suva_9.532.219ON393143771.9
NDAI0B041502.186ON1089101781.9
Suva_2.5285.414ON944169772.5
NCAS0A092702.563ON33558753.0
ADL037W4.46ON887197763.1
Smik_11.511.162ON671247763.3
KLTH0B08316g2.16ON95098754.6
TBLA0F021407.310ON130068745.4
NCAS0C010108.736ON148244745.7
NDAI0E014508.636ON518153736.3
Suva_10.410na 1ON52852737.1
Suva_10.4094.39ON65052738.1
Skud_9.312.219ON393143728.9
TDEL0F035603.471ON68873729.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00230
         (1284 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...  2340   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   142   3e-33
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   138   5e-32
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   126   2e-28
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   125   4e-28
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   124   8e-28
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   120   1e-26
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   118   5e-26
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   112   4e-24
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   107   2e-22
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   105   5e-22
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   103   2e-21
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    99   5e-20
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    91   2e-17
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    89   6e-17
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    89   9e-17
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    79   6e-14
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    67   4e-10
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    60   4e-08
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    60   5e-08
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    56   6e-07
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    45   0.001
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    44   0.003
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    44   0.003
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    42   0.015
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    40   0.072
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    38   0.18 
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    37   0.29 
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    37   0.36 
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    37   0.55 
KAFR0B06220 Chr2 complement(1279469..1281088) [1620 bp, 539 aa] ...    36   0.62 
NCAS0F00840 Chr6 (170473..174315) [3843 bp, 1280 aa] {ON} Anc_2....    36   0.62 
TPHA0O00460 Chr15 complement(81615..83513) [1899 bp, 632 aa] {ON...    35   1.3  
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    35   1.4  
Suva_9.53 Chr9 (88356..89537) [1182 bp, 393 aa] {ON} YIL136W (REAL)    34   1.9  
NDAI0B04150 Chr2 complement(1047061..1050330) [3270 bp, 1089 aa]...    35   1.9  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    34   2.5  
NCAS0A09270 Chr1 complement(1831820..1832827) [1008 bp, 335 aa] ...    33   3.0  
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    34   3.1  
Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}...    34   3.3  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    33   4.6  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    33   5.4  
NCAS0C01010 Chr3 complement(183823..188271) [4449 bp, 1482 aa] {...    33   5.7  
NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.6...    33   6.3  
Suva_10.410 Chr10 complement(721801..723384) [1584 bp, 528 aa] {...    33   7.1  
Suva_10.409 Chr10 complement(721432..723384) [1953 bp, 650 aa] {...    33   8.1  
Skud_9.31 Chr9 (70769..71950) [1182 bp, 393 aa] {ON} YIL136W (REAL)    32   8.9  
TDEL0F03560 Chr6 complement(652087..654153) [2067 bp, 688 aa] {O...    32   9.7  

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score = 2340 bits (6064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1189/1284 (92%), Positives = 1189/1284 (92%)

Query: 1    MATGYDLFKLSSYYNIPTXXXXXXXXXXXXXXKSKVDGDKIVLRHDENADNDSTDLQTLH 60
            MATGYDLFKLSSYYNIPT              KSKVDGDKIVLRHDENADNDSTDLQTLH
Sbjct: 1    MATGYDLFKLSSYYNIPTSELLSLNENILEQLKSKVDGDKIVLRHDENADNDSTDLQTLH 60

Query: 61   EQLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNR 120
            EQLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNR
Sbjct: 61   EQLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNR 120

Query: 121  ELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLK 180
            ELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLK
Sbjct: 121  ELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLK 180

Query: 181  EKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKN 240
            EKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKN
Sbjct: 181  EKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKN 240

Query: 241  SSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFII 300
            SSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFII
Sbjct: 241  SSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFII 300

Query: 301  LKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXX 360
            LKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKI               HF   
Sbjct: 301  LKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKTT 360

Query: 361  XXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKF 420
                        SRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKF
Sbjct: 361  IKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKF 420

Query: 421  IKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHE 480
            IKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNME            DNQEHE
Sbjct: 421  IKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHE 480

Query: 481  LRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE 540
            LRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE
Sbjct: 481  LRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE 540

Query: 541  NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDI 600
            NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDI
Sbjct: 541  NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDI 600

Query: 601  TXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTND 660
            T              SISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTND
Sbjct: 601  TQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTND 660

Query: 661  MNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASK 720
            MNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASK
Sbjct: 661  MNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASK 720

Query: 721  INDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDI 780
            INDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDI
Sbjct: 721  INDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDI 780

Query: 781  PVKTENINSSDSFVLDNFSEQVEGDDTSSKERSPSCNNISVFRVKDPMKPLXXXXXXXXX 840
            PVKTENINSSDSFVLDNFSEQVEGDDTSSKERSPSCNNISVFRVKDPMKPL         
Sbjct: 781  PVKTENINSSDSFVLDNFSEQVEGDDTSSKERSPSCNNISVFRVKDPMKPLSNNNTDNVT 840

Query: 841  XXXXXFKTSSDLNNDFELLFNEYKVIEKELEKAKNEIMRTSGDAQXXXXXXXXXXXRDQE 900
                 FKTSSDLNNDFELLFNEYKVIEKELEKAKNEIMRTSGDAQ           RDQE
Sbjct: 841  SSNINFKTSSDLNNDFELLFNEYKVIEKELEKAKNEIMRTSGDAQELEKLSELLLSRDQE 900

Query: 901  HSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKEL 960
            HSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKEL
Sbjct: 901  HSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKEL 960

Query: 961  ENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020
            ENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK
Sbjct: 961  ENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020

Query: 1021 KDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLITDEDSN 1080
            KDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLITDEDSN
Sbjct: 1021 KDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLITDEDSN 1080

Query: 1081 VIPQSTQEEDIKIKDVKTLDSEVSGSGVNLKNNAPEEKIIPVISNEHICTMESHTINNNP 1140
            VIPQSTQEEDIKIKDVKTLDSEVSGSGVNLKNNAPEEKIIPVISNEHICTMESHTINNNP
Sbjct: 1081 VIPQSTQEEDIKIKDVKTLDSEVSGSGVNLKNNAPEEKIIPVISNEHICTMESHTINNNP 1140

Query: 1141 VKESVDMLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNA 1200
            VKESVDMLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNA
Sbjct: 1141 VKESVDMLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNA 1200

Query: 1201 KTPTSSFGMKPAFSFGSNPFTSNTNSLGTKMSTPDSNSTGGLFSQKNDESKDTASQESSA 1260
            KTPTSSFGMKPAFSFGSNPFTSNTNSLGTKMSTPDSNSTGGLFSQKNDESKDTASQESSA
Sbjct: 1201 KTPTSSFGMKPAFSFGSNPFTSNTNSLGTKMSTPDSNSTGGLFSQKNDESKDTASQESSA 1260

Query: 1261 IDTNAGKRNSESEDNSSETKKTKF 1284
            IDTNAGKRNSESEDNSSETKKTKF
Sbjct: 1261 IDTNAGKRNSESEDNSSETKKTKF 1284

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1779

 Score =  142 bits (357), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 173/714 (24%), Positives = 347/714 (48%), Gaps = 44/714 (6%)

Query: 73  VTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDN 132
           + N KT L  ++ ELE +++  K N+L  K E+++++   N L+S N+ LE +L++ ++ 
Sbjct: 163 LQNTKT-LRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEE 221

Query: 133 ENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISELLALDTS 192
             +       + Q    E+ ++++++ I  +    L    ND    L++K++EL +L  S
Sbjct: 222 FGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDS 281

Query: 193 -------FKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIV 245
                  F  E  LK  +I+  +  I +   E+ES +N+ ++             +S  V
Sbjct: 282 SSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNKSVS-------------NSDHV 328

Query: 246 DKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTG------INFVSTDD----- 294
           D  E ++++ E +   +K++  + K  +L  TV+E  S  G       + VS D      
Sbjct: 329 DA-EREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAGNTSKVSLDSKNSIV 387

Query: 295 ---FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXX 351
                D  +LKK + +   Q++ LQ ++E  + ELE+  P LN+  ++            
Sbjct: 388 PKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVA 447

Query: 352 XXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYG 411
                                S++   + +I +L  + +DL +Q+Q +LI  S++ND  G
Sbjct: 448 LMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNG 507

Query: 412 ELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXX 471
            LT  E  FIK +    +E+   +  ++Q IIS+RL+RFES++ LQ+KNME         
Sbjct: 508 PLTPEETNFIKKII-NSSESPVEQ--DAQRIISERLVRFESMVELQEKNMELLNSIRNLA 564

Query: 472 XXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEK 531
              + +E E ++K +    + + EAKE IL +   +  L+ ++  + ++ +A + ++ +K
Sbjct: 565 DKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDAFKILASDK 624

Query: 532 ---NGHESV-LAENKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLEL 587
              NG  +V  +EN+     +  I  EL+N++   T++++  I +  +++ SLY    + 
Sbjct: 625 GTSNGPSNVNSSENRHLVLAEEKI-KELENHLSSLTEESAKNIKLLNEEIHSLYRAQADT 683

Query: 588 TADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANH 647
           + +  K   SR +                + N++L++    +++ I ++D     TI + 
Sbjct: 684 SVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESL 743

Query: 648 VDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSD 707
           + CK+ L ++ + +N+  ++ D L+ +++   +    L  ER  +++ +  ++T+Q + +
Sbjct: 744 ISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILITQLQTLQTERE 803

Query: 708 LESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761
               E + +   K N LE   S+  + L  K +E+ D+ISTK+ +  WYQ+KFD
Sbjct: 804 SLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFD 857

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 52/83 (62%)

Query: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKL 1030
            S+ +++ + KS EN+E   RF RLK+QA+ +L+++K  Q+ L  Q++ LK    ++++ L
Sbjct: 1323 SELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDL 1382

Query: 1031 EVQSKTVQELETQIKSTEADSRS 1053
              Q + V+ LE++I   E +  S
Sbjct: 1383 GSQKEEVKNLESKITDIEKNKSS 1405

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
           (REAL)
          Length = 1878

 Score =  138 bits (347), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 172/725 (23%), Positives = 354/725 (48%), Gaps = 29/725 (4%)

Query: 51  NDSTDLQTLHEQLNNITLKY---NRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEK 107
           N    L+ L E+L  + +     NR  NE  +L   I +LE K +    ++L+++ ELE+
Sbjct: 140 NQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELER 199

Query: 108 MSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDK 167
            +   N L+S N  LE +L + N+   +   +       +  E+ +L++D  + +TK D 
Sbjct: 200 KAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDV 259

Query: 168 LLKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREIN 227
           L +  ++   +L+EK+ E+ +L     SE +     I  K  L+  L +++ ++K     
Sbjct: 260 LTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKE---- 315

Query: 228 EHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGI 287
           E  S   +E   +S   + ++E   L+ E  +  E++ +   +  RL++ + E   ++G 
Sbjct: 316 ELDSTRGLETSNDSKKHMSEKE--DLVKELQLTKEELAQCKSECIRLSSIIGETDEESGS 373

Query: 288 NFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXX 347
           +   +    DFI+LKK++ K +  ++ LQ ++E  I ELE+  P +N+  ++        
Sbjct: 374 STSRSSS--DFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENEL 431

Query: 348 XXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQN 407
                   H                 +LK  ++ I+TL ++  DL  Q+Q++LI+NS+  
Sbjct: 432 NNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSK 491

Query: 408 DKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXX 467
           D  G L + EI FI+ + +  ++T+     +SQ I+++RL+ F S+I LQ+KN E     
Sbjct: 492 DSKGPLRKEEIMFIQNILQNDSDTATE--TDSQKIVTERLVEFRSIIELQEKNTELLKIV 549

Query: 468 XXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQL-NANRP 526
                  ++ E+E +   +    + +NEAKE IL + +E ++L+ K+ EL+++  N+   
Sbjct: 550 RNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSKAL 609

Query: 527 VSHEKNGHESV----LAENKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYN 582
           +S+E+  H +     L E K   E     + +L++NI + T++++  +S+   ++  LY+
Sbjct: 610 LSNEETSHLNSTIQQLNETKRNLECQ---IQDLQSNISQITRESTENMSLLNKEIQDLYD 666

Query: 583 KNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNS 642
              +++    K   SR +                  N++L++  + ++ TI ++D     
Sbjct: 667 SKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQE 726

Query: 643 TIANHVDCKASLLSVTNDMNSL----MTKYDELKYLKDQQSRITNELKMEREQLKMELLN 698
           T+  ++ CK+ L     ++ +L      K D  + LK +  ++++    E+  L++ +  
Sbjct: 727 TLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSS----EKTGLRIMVTQ 782

Query: 699 IKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQK 758
           ++T+Q + +    E + S  +KI++LE  ++ L  +   K+Q ++      N  ++WYQ 
Sbjct: 783 LQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQN 842

Query: 759 KFDIF 763
           K ++ 
Sbjct: 843 KIEVL 847

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%)

Query: 973  FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEV 1032
             K K + K+++  E  +RFNRL++QA  RL +SK   + L EQ++ LK    +++  L+ 
Sbjct: 1307 LKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDD 1366

Query: 1033 QSKTVQELE 1041
             +  ++ELE
Sbjct: 1367 ANTKIEELE 1375

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
           (REAL)
          Length = 1898

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 185/737 (25%), Positives = 348/737 (47%), Gaps = 59/737 (8%)

Query: 56  LQTLHEQLNNITL---KYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITY 112
           L+ L E+L  + +     N   +E  +L   I ELE K +    N+L++K +LE+ +   
Sbjct: 145 LKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQEL 204

Query: 113 NSLESKNRELESDLSAMNDNENTLHDEEQY-----KNQCLNREVIN----LKNDILILET 163
           N L+S    LE +LS+ N         +QY     K   +  E+ N    ++ND  + +T
Sbjct: 205 NLLQSNKDWLEKELSSKN---------QQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKT 255

Query: 164 KYDKLLKGYNDTKDNLKEKISELLALDTS-------FKSETKLKDEIIEEKDYLIANLTN 216
             D L +  N+   +L+EK+ ++  L  S       F +E  LK  +I   D L + L  
Sbjct: 256 NNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLI---DLLESQLNA 312

Query: 217 EIESLKN-REINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLT 275
             E L N RE N   SD+N +  K   +I    E ++LL +  +   K+ + + +  RL+
Sbjct: 313 VKEELNNTRESN--YSDVNSDDSK--QLI---SENEKLLKDLQLTKHKLVQCENECLRLS 365

Query: 276 ATVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNN 335
           +   E   + GI  +++    DFI+LKK++ K +  ++ LQ ++E  I ELE+  P +N+
Sbjct: 366 SITEEAGKEDGI--LTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINS 423

Query: 336 QYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQ 395
             ++                H                 +L    D+I  L ++  DL  Q
Sbjct: 424 FKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQ 483

Query: 396 IQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVIS 455
           IQ++L++NS+ ND  G L + EIKFI+ + +   + S     +SQ I+++RL+ F  +I 
Sbjct: 484 IQYLLVTNSVSNDSKGPLRKEEIKFIQNILQ--NDDSATTESDSQKIVTERLVEFRDIIQ 541

Query: 456 LQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKIS 515
           LQ+KN E            ++ E++ +   +   ++ +NEAKE IL + S+  +L+ KI 
Sbjct: 542 LQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIH 601

Query: 516 ELQQQLNA--NRPVSHEKNGHESVLAENKLYTEGDRLI---LDELKNNIPEFTKQASNII 570
           EL+++     N  +  E + + SV+ +    TE  R +     +L+  I + T++++  +
Sbjct: 602 ELEKEREKFKNWTMDQETSPNNSVIQQ---LTETKRELESQTQDLQARISQVTRESTENM 658

Query: 571 SMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIK 630
           S+   +L  LY+    L+ +  +   SR +                  N++L++    ++
Sbjct: 659 SLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQ 718

Query: 631 DTIRRKDETLNSTIANHVDCKASLLSVTNDMNSL----MTKYDELKYLKDQQSRITNELK 686
           + I ++D     T+ ++V CK+ L ++  ++++L      K +  K LK + S    EL 
Sbjct: 719 NAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELS----ELS 774

Query: 687 MEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFI 746
            E+  L + +  ++T+Q + +    E K S  +KI+ L+   + L  +   K+Q ++   
Sbjct: 775 SEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLE 834

Query: 747 STKNRELDWYQKKFDIF 763
              + +++WYQ K +  
Sbjct: 835 EDNDSKIEWYQNKIETL 851

 Score = 36.2 bits (82), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 76/143 (53%), Gaps = 9/143 (6%)

Query: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967
            N++LQ +L     +I  ++ E+  L  SI E ++       E+   + R +++  K ++ 
Sbjct: 1238 NKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQL 1297

Query: 968  S------LQSD---FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018
            S      L+++    K + E K+++  ++ ++FNRL++QA  +L +SK  Q++  EQ++ 
Sbjct: 1298 SSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNE 1357

Query: 1019 LKKDLAEVQSKLEVQSKTVQELE 1041
            LK     ++  L   +  +QELE
Sbjct: 1358 LKDAKLALEKSLNNANARIQELE 1380

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
           MLP1Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved with Tel1p in telomere length
           control; involved with Pml1p and Pml39p in nuclear
           retention of unspliced mRNAs
          Length = 1875

 Score =  125 bits (314), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 179/736 (24%), Positives = 346/736 (47%), Gaps = 39/736 (5%)

Query: 47  ENADNDSTDLQTLHEQLNNITL---KYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKL 103
           E   N    L+ L E+L  I L   + NR  +E  +L   I +LE K +    N+L+++ 
Sbjct: 136 ETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRT 195

Query: 104 ELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILET 163
           ELE+ +     L+S N  LE +L + N+   +   +       +  E+  L+ND  +  T
Sbjct: 196 ELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERT 255

Query: 164 KYDKLLKGYNDTKDNLKEKISELLALDTS-------FKSETKLKDEIIEEKDYLIANLTN 216
             D L +  N+   +L+EK+ E+  L  S       F +E  LK  +++  +  +  +  
Sbjct: 256 NNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKE 315

Query: 217 EIESLKNREINEHSSDINIEYGKNSSIIVD---KQ--EYQRLLNEALINNEKIDEYDLKV 271
           E+ S+  RE+N             + +I D   KQ  E + LL E  +  EK+ + + + 
Sbjct: 316 ELNSI--RELN------------TAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKEC 361

Query: 272 ARLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAP 331
            RL++  +E         +S     DFI LKK++ K    ++ LQ ++E  I ELE+  P
Sbjct: 362 LRLSSITDEADEDN--ENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVP 419

Query: 332 ELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENND 391
            +N+  ++                H                 +L   ++ ++TL ++  D
Sbjct: 420 IINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLD 479

Query: 392 LTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFE 451
           L  QIQ++LI+NS+ ND  G L + EI+FI+ + ++   T      +SQ ++++RL+ F+
Sbjct: 480 LCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITE--SDSQKVVTERLVEFK 537

Query: 452 SVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLK 511
           ++I LQ+KN E            +++E + +   +    + +NEAKE I+ + SE   L+
Sbjct: 538 NIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLE 597

Query: 512 EKISELQQQLNANR-PVSHEKNGHESVLAENKLYTEGDRLI---LDELKNNIPEFTKQAS 567
            +I ELQ++L   +  V +E   + +V    K  TE  R +   + +L+  I + T++++
Sbjct: 598 SRIEELQKELEELKTSVPNEDASYSNVTI--KQLTETKRDLESQVQDLQTRISQITREST 655

Query: 568 NIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHME 627
             +S+   ++  LY+   +++    K   SR +                  N++L++  +
Sbjct: 656 ENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFD 715

Query: 628 VIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKM 687
            +++TI ++D   + T+  +V CK+ L  V  ++ +L  +     +L+    +  N+L  
Sbjct: 716 YLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSP 775

Query: 688 EREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFIS 747
           E++ L++ +  ++T+Q + +    E + S   KI++LE   S L K+   K+  ++    
Sbjct: 776 EKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEE 835

Query: 748 TKNRELDWYQKKFDIF 763
             N  ++WYQ K +  
Sbjct: 836 DNNSNIEWYQNKIEAL 851

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 35/49 (71%)

Query: 972  DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020
            + KE+ E K ++  E  ++FNRL++QA  RL +SK  Q++L EQ++SL+
Sbjct: 1310 NLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLR 1358

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  124 bits (311), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 180/734 (24%), Positives = 333/734 (45%), Gaps = 44/734 (5%)

Query: 57  QTLHEQLNNI-TLKYN--RVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYN 113
           Q L+E++ +I TL+    R+  E   L  +  ELE +    K   L  K +  ++S   +
Sbjct: 143 QLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQKVS 202

Query: 114 SLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYN 173
            L + N  LES L+  N   N      Q +   +++ +   + D L   TK  K L+  N
Sbjct: 203 LLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGD-LQAATKTIKTLREQN 261

Query: 174 DTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNR-------EI 226
             K++          L+  F++  KL DE+   K       T E+ SLK R       ++
Sbjct: 262 GQKES---------ELEGQFQAVKKLTDELTSAKQ----EFTREM-SLKQRLVELLEGQV 307

Query: 227 NEHSSDINIEYGKNSSIIVDKQEYQRLLNEALIN-NEKIDEYDLKVARLTATVNEFQS-- 283
           +   S++  +    +S      E Q  + + L++  ++++E +LK+ +L  TV +  S  
Sbjct: 308 SALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSAD 367

Query: 284 -KTGINFVSTDD-FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIX 341
            KT     S  D + D  ILKK++     Q++ LQ ++E  + ELEN  P L++  D+  
Sbjct: 368 EKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRND 427

Query: 342 XXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLI 401
                                          S+++  + +I  L ++ +DL  Q+Q++LI
Sbjct: 428 VLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLI 487

Query: 402 SNSIQNDKYGELTENEIKFIK-ALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKN 460
             +++ D +G L+  E  F+K  +  + T+   +    +Q IIS+RL+ F++++ LQ KN
Sbjct: 488 QVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGD----AQGIISERLVEFKNIVELQAKN 543

Query: 461 MEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ 520
            +            + +E ++++K EA  +D + EAKE I+ +     +L+ +I  + ++
Sbjct: 544 ADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRE 603

Query: 521 LNANRPV----SHEKNGHESVLAE-NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFD 575
            +A + +    SHE  G    L + N   +E   L + EL+  +    ++A   + +   
Sbjct: 604 RDAYKAIQSQTSHE--GSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMT 661

Query: 576 QLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRR 635
           +   L     EL  +  K   SR +                  NE+L +   V+++ + +
Sbjct: 662 ENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAK 721

Query: 636 KDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNE-LKMEREQLKM 694
           +D     TI+  +DCK+ L +++ ++ + + K + L     Q+ + TNE L  ER +L +
Sbjct: 722 QDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNT-SHQKLKETNEQLTKERNELTI 780

Query: 695 ELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELD 754
            +  ++T+Q + D    +   +   KI+ LE   S L   L  K  EL DF+ST +    
Sbjct: 781 LVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR 840

Query: 755 WYQKKFDIFSTMLK 768
           WYQ+K D  +  LK
Sbjct: 841 WYQEKIDALNECLK 854

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%)

Query: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQIKSTE 1048
            DRF RLKKQA  RL +++  QN LN +++  ++    ++  L+ + +  + L+  IK+TE
Sbjct: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATE 1387

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score =  120 bits (302), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 158/698 (22%), Positives = 316/698 (45%), Gaps = 43/698 (6%)

Query: 95  KCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINL 154
           K  +L  K EL ++S   +   S +  LES L   N   N      Q +   L +++  L
Sbjct: 182 KSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETL 241

Query: 155 KNDILILETKYDKLLKGYNDTKDN-LKEKISELLALDTSFKSETKLKDEIIEE---KDYL 210
           + + L   T+ +K L+ +N    N L+ ++  +  L  +  SE   K E   E   K+ L
Sbjct: 242 EQE-LQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSE---KQEFTREMSLKERL 297

Query: 211 IANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLN----EALINNEKIDE 266
           +  L  +++SLK        SD+ +   ++++   D   +   LN    E     ++++E
Sbjct: 298 VDLLEGQVQSLK--------SDLEL---RSTAGEGDDGSFSNPLNALSEELAQKTQQLEE 346

Query: 267 YDLKVARLTATVNEFQS--------KTGINFVS--TDDFCDFIILKKEIQKLEGQRDLLQ 316
            + KV +L  TV +  S         +   + +  TD + D  +LK+++   + Q++ LQ
Sbjct: 347 SEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQ 406

Query: 317 EKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLK 376
            ++E  + ELE+  P L++  D+                                 +++ 
Sbjct: 407 NQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIH 466

Query: 377 LSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNEL 436
             + +I  L  + +DL  Q+Q++LI  S+++D  G LT  EI F++ + E+G + S    
Sbjct: 467 DFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG-DLSLE-- 523

Query: 437 YNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEA 496
            ++Q +IS+RL+ F  ++ LQ KN +            +++E + + + +   +D + EA
Sbjct: 524 RDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREA 583

Query: 497 KEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGH----ESVLAENKLYTEGDRLIL 552
           KE I+ +   + +L+ +I  L ++ +A + +    N      E  LA +K         +
Sbjct: 584 KEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSAR---V 640

Query: 553 DELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXX 612
           D+L+ ++    ++A   + M   ++  L  +  +L  +  K   S+ +            
Sbjct: 641 DDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSL 700

Query: 613 XXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELK 672
                 NE+L +   +I+D + ++D     T++  ++C++ L ++ +++ S + K + L 
Sbjct: 701 KLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLS 760

Query: 673 YLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLS 732
             + + +    +L  ER  L + +  ++T+Q + D   AE + S   K++ LE+  S L 
Sbjct: 761 SCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLR 820

Query: 733 KDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRV 770
             L  K++E  DFI T +    WYQ+K D  +  LK V
Sbjct: 821 TQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVV 858

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 8/93 (8%)

Query: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKL 1030
            S  K +   K+ +N E  DRF RLKKQA  RL ++K  QN L+ +++  +    E QS +
Sbjct: 1314 SQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAR----EAQSNM 1369

Query: 1031 EVQSKTVQE----LETQIKSTEADSRSRSTSIP 1059
            E+Q +  Q+    L+  ++  E+++++ ST+ P
Sbjct: 1370 ELQLRKEQDVNKALQESLQRVESEAKADSTTQP 1402

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
           (REAL)
          Length = 1885

 Score =  118 bits (296), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 171/733 (23%), Positives = 344/733 (46%), Gaps = 41/733 (5%)

Query: 51  NDSTDLQTLHEQLNNITLKY---NRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEK 107
           N    L+ L E+L  + +     NR  NE   L   + ELE K +    N+L+++ ELE+
Sbjct: 140 NQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELER 199

Query: 108 MSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDK 167
            +   N L+S    LE +LS+ ++   +           +  E+  LKND  + +T  D 
Sbjct: 200 KTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDV 259

Query: 168 LLKGYNDTKDNLKEKISELLALDTS-------FKSETKLKDEIIEEKDYLIANLTNEIES 220
           L +  N+  ++L+EK+ +L  L  S       F +E  LK  +I+  +  +  +  E++S
Sbjct: 260 LKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKS 319

Query: 221 LKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNE 280
           ++  + +  +SD       +S  ++   E + LL +  +  EK+ + + +  RL++   E
Sbjct: 320 IRKSDSSNVTSD-------DSRKLIS--ENESLLKDLRLTKEKLAQCESECLRLSSITEE 370

Query: 281 FQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKI 340
              ++G   +++    DFI+LKK+  K +  ++ LQ ++E  I ELE+  P +N+  ++ 
Sbjct: 371 TGEESGT--LTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERT 428

Query: 341 XXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFML 400
                          H                 ++   ++ I  L  +  DL  Q+Q++L
Sbjct: 429 DMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLL 488

Query: 401 ISNSIQNDKYGELTENEIKFIKALRE---KGTETSFNELYNSQDIISDRLIRFESVISLQ 457
           I+NS+ ND  G L + EIKFI+ + +    GT  S     +SQ I++ RL+ F +VI LQ
Sbjct: 489 ITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTES-----DSQKILTGRLVEFRNVIELQ 543

Query: 458 QKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISEL 517
           +KN E            ++ E + +       +  +NEAKE IL + SE   L+ K+ EL
Sbjct: 544 EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEEL 603

Query: 518 QQQLNANR-PVSHEKNG-HESVLAE-NKLYTEGDRLILDELKNNIPEFTKQASNIISMNF 574
           +++    +  +S + +  + SV+ +  K   E +  + D L+  I + T++++  +S+  
Sbjct: 604 ERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQD-LQARISQITRESTQNMSLLN 662

Query: 575 DQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIR 634
            ++  +Y+   +++ +  K   SR +                  N++L++  + ++ +I 
Sbjct: 663 KEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSIS 722

Query: 635 RKDETLNSTIANHVDCKASLLSVTNDMNSL----MTKYDELKYLKDQQSRITNELKMERE 690
           ++D   + T+  ++ CK+ L      +++L      K D  K LK +  ++++    E+ 
Sbjct: 723 KQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSS----EKT 778

Query: 691 QLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKN 750
            L++ +  ++T+Q + +    E + S  +KIN++E   + L  +   K+Q +        
Sbjct: 779 SLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNT 838

Query: 751 RELDWYQKKFDIF 763
            +++WYQ K +  
Sbjct: 839 SKIEWYQNKIETL 851

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 85/166 (51%), Gaps = 12/166 (7%)

Query: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLK 965
            K N++LQ +L   ++ I  ++ E+  L  S+ E ++       E+   + R +++  K +
Sbjct: 1236 KKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQ 1295

Query: 966  EAS------LQSD---FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQI 1016
            + S      L+S+    K + E K ++  E  +RFNRL++QA  +L +SK  Q  L EQ+
Sbjct: 1296 QLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQL 1355

Query: 1017 SSLKKDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQ 1062
            + LK     ++  L   +  +QELE +     A+  +RS  I +SQ
Sbjct: 1356 NELKDAKVALERSLNDANTRIQELEGE---KVAEDNNRSEMIKRSQ 1398

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 125/451 (27%), Positives = 230/451 (50%), Gaps = 42/451 (9%)

Query: 382 IETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQD 441
           IE L  +  DL +Q+Q++LI +SIQND  G L+++EI F++ L  K  +   +++   Q 
Sbjct: 281 IEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDV---QS 337

Query: 442 IISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEIL 501
           +ISDRLI+F+ ++SLQ+KNME            +++E E++   E  ++D +NEAKE IL
Sbjct: 338 VISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETIL 397

Query: 502 KVVSESDKLKEKISELQ---QQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNN 558
            +   ++ LK +I  LQ    +L ++ P S E        +E + +     L+ D L++ 
Sbjct: 398 SLQEYNNVLKLEIGTLQSKISELQSSIPNSKE--------SEKQHFNYHSNLVKD-LESK 448

Query: 559 IPEFTKQA-SNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSI 617
           + + +  + S I ++N D + +LYN+  ++  +  K   S  +               ++
Sbjct: 449 LSKLSAYSQSTIENLNKD-IQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTL 507

Query: 618 SNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQ 677
            NE+L     +++  +  +++ LNS + +++ CK +LL  TN +  L    ++L  L+++
Sbjct: 508 ENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNN--NKLG-LEEE 564

Query: 678 QSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLS----- 732
            + +  E+K   EQ+K   L+ K+  ++  LE+   K +   K+ +LE+  S L+     
Sbjct: 565 NNSLKQEIKSNYEQIKD--LDSKSKHLEQSLENEISKYT--DKVKELELNISKLNEQKLI 620

Query: 733 --KDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVKTENINSS 790
             + L+ K  E+ D  S+   ++ WYQKK D +   +K +         +P  T+N   S
Sbjct: 621 LERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESR------LPADTQN---S 671

Query: 791 DSFVLDNFSEQVEGDDTSSKERSPSCNNISV 821
            + V D   E  +  D S    S SCN I++
Sbjct: 672 KALVEDKALE--DSRDASPVSSSASCNEITI 700

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 101/217 (46%), Gaps = 27/217 (12%)

Query: 1016 ISSLKKDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLIT 1075
            I+ L++ L + +S+L+++ K  +EL+      E D + R     ++      K+  +L +
Sbjct: 1070 IAELEEKLNKTKSELDLKHK--EELKVLKTEYEGDIQKRVAEAEEAL-----KRKIRLPS 1122

Query: 1076 DEDSNVIPQSTQ---EEDIKIK---------DVKTLDSEVSGSGVNLKNNAPEEKIIPVI 1123
            +E  N I +S     EED K K         D++ +  E   + VN K  A EE      
Sbjct: 1123 EEKINTIIESKVADLEEDYKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEE------ 1176

Query: 1124 SNEHICTMESHTINNNPVKESVDMLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVTSSF 1183
              +   +M++  + N   K    + +NE   +  E++  TT      N  L +     SF
Sbjct: 1177 -GKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEK-SNPELDKQEAKPSF 1234

Query: 1184 TFSPLAMENPFTSPNNAKTPTSSFGMKPAFSFGSNPF 1220
            TFSP    NPFT+  +  +P S FG+KP FS G+NPF
Sbjct: 1235 TFSPPPNSNPFTTTQDTDSPVSVFGIKPTFSLGANPF 1271

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 90/155 (58%), Gaps = 16/155 (10%)

Query: 899  QEHSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCK 958
            QE  +L ++N  L+ +L +S + ++ ++ +I +LN  ++E + N +N+++E      + +
Sbjct: 845  QEIHALNENNIALKCQLEESLERLKPLETKISELN-ILIEDKDNIINVSNE------KAE 897

Query: 959  ELENKLKEASLQS---------DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQ 1009
              + +  E +L +         + +++ E KSKEN+E  DRFNRLKKQAN RLH+SK  Q
Sbjct: 898  NWKTRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQ 957

Query: 1010 NALNEQISSLKKDLAEVQSKLEVQSKTVQELETQI 1044
            N L EQ + LK    +++  L  Q +  +ELE  I
Sbjct: 958  NNLTEQSNELKARNTDLERNLSEQMERFKELENSI 992

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1810

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 154/719 (21%), Positives = 310/719 (43%), Gaps = 57/719 (7%)

Query: 95  KCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINL 154
           KCN L  K ELE +      L   N  LE ++++  +       E   + Q   +EV  L
Sbjct: 185 KCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARL 244

Query: 155 KNDILILETKYDKLLKGYNDTKDNLKEKISELLALD-------TSFKSETKLKDEIIEEK 207
           KND  + ++  + LLK   +   +L+ K+ E+  L          F  E  LK ++++ +
Sbjct: 245 KNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQ 304

Query: 208 DYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEY 267
           D  + +   E+  L   + N   +D N++  + +  + D  + ++ L E+  N+E++   
Sbjct: 305 DEQLQSFKEEL-RLTEEKHNSTEAD-NLQSTQQARFMDDLAQVRQQLEES--NHERL--- 357

Query: 268 DLKVARLTATVNE-------FQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLE 320
                RL A VNE       F   +  N      + D  +LKK++ K   Q++ LQ ++E
Sbjct: 358 -----RLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIE 412

Query: 321 YLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDD 380
             + ELE   P +N+  ++                H                 ++K  + 
Sbjct: 413 SFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEI 472

Query: 381 KIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQ 440
              TL  + +DL  Q+QF+L + ++QND  G LT +E+ FIK + E   E   NE  +SQ
Sbjct: 473 NTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIE--NENPSNE-SDSQ 529

Query: 441 DIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEI 500
            II++RL+ F+ + +LQ++N E            + +E     + ++     ++EAKE I
Sbjct: 530 SIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAI 589

Query: 501 LKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKL----YTEGDRL------ 550
           + +   + +++ K+S           +  E++ ++++L++         + DR+      
Sbjct: 590 ITLQERNSEIESKVS----------TIEKERDAYKAILSQTSQSFDNLGDADRMKDSQEN 639

Query: 551 --ILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXX 608
             ++  L++ +   T + S    +   ++ +LY    +LT    K   SR +        
Sbjct: 640 QELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLL 699

Query: 609 XXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKY 668
                     N +L      ++  + +++     T+  ++ C++ L  +     +L  + 
Sbjct: 700 QSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEK 759

Query: 669 DELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITN 728
             L+   D   R   ++ +ER  L + +  ++T+Q + +    E +AS  + I  LE+  
Sbjct: 760 SLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQT 819

Query: 729 SNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVKTENI 787
           S L  ++ +K+ E++     K  +  W+Q+K D  S+   ++       D++  KT  +
Sbjct: 820 SELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKI------RDELATKTATV 872

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 27/158 (17%)

Query: 1137 NNNPVKESVDMLSNEESPSKMESDTT----TTKPSFLPNQNLTQPSVTSSFTFSPLAMEN 1192
            +NNP  E     S    P+K++   T    T  P+F   + + + S   +F+F P +  N
Sbjct: 1642 SNNPTPEKAAATSVG-LPTKIDESRTENMATGTPAF--GEKVLKLSDKPAFSFQPSSKSN 1698

Query: 1193 PFTS--PNNAKTPTSSFGMKPAFSFGSNPFTSNTNSLGTKMST-------PDSNSTGGLF 1243
            PFTS  P N     + FGMKP FSF   P +S   S  T  ST       P+SN +    
Sbjct: 1699 PFTSALPGN----NNVFGMKPTFSF--TPGSSQPESRPTFGSTGFNTTAEPESNRS---- 1748

Query: 1244 SQKNDESKDTASQESSAIDTNAGKRNSESEDNSSETKK 1281
            S +++ES     QES+++    GK   E+  N + T+K
Sbjct: 1749 SSQSEES-IPEKQESASVQGQNGKVAEEAGSNVTTTQK 1785

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1788

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 157/727 (21%), Positives = 331/727 (45%), Gaps = 78/727 (10%)

Query: 66  ITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESD 125
           +TLK   +TN+  +   K  +LE +++  K N+  T+  + K+S    S+      LE++
Sbjct: 153 LTLK---LTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETE 209

Query: 126 LSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISE 185
           L   +   +  +   Q + Q L +++  L+N+  I++++ D L K       NL EK S+
Sbjct: 210 LENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSK 269

Query: 186 LLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIV 245
           +  L   + +E +   + +  K  +I  L  +++ L++                      
Sbjct: 270 VQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQD---------------------- 307

Query: 246 DKQEYQRLLN--EALINNEKIDEYDLKVARL--------TATVNEFQSKTGINF------ 289
              +Y R+LN  + ++ N+  +E +L+V  L        T    E + +  I        
Sbjct: 308 ---DYTRILNTKQPIVQND--EERNLEVEELKQKLIETETQLNKELEERRNITMQTESST 362

Query: 290 VSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXX 349
           +S     D   +KKE+ +   Q++ LQ ++E  I ELE   P +N+   +          
Sbjct: 363 LSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTD 422

Query: 350 XXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDK 409
                 +                   K    + ++L ++ NDL +Q+Q++LI  S+QND 
Sbjct: 423 ATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDS 482

Query: 410 YGELTENEIKFIKAL--REKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXX 467
            G L+  E++FI+ +   E   E+S     +SQ +IS+RL+ F++++ LQQKN++     
Sbjct: 483 NGPLSAEEVRFIQDILDNESNEESS-----DSQQVISERLVTFQNIVELQQKNIDLLKSV 537

Query: 468 XXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPV 527
                  + QE   ++  +      ++EAKE I+ + S + KL++KI  L  +L+  + +
Sbjct: 538 RELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSL 597

Query: 528 SHEKNGHESVLAENKLYTEGDRL------ILDELKNNIPEFTKQASNIISMNFDQLTSLY 581
                       + K+ TE  RL      ++ EL+  +    ++++   +   +++  + 
Sbjct: 598 PK---------PDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIR 648

Query: 582 NKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLN 641
             + +   +      SR++                + NE+L++ +E+++D   ++D+   
Sbjct: 649 RNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQ 708

Query: 642 STIANHVDCKASLLSVTNDMNSL-----MTKYDELKYLKDQQSRITNELKMEREQLKMEL 696
            T+  +V CK +L +  N++N +     ++K +E K LKD  + ++     ER +LK  +
Sbjct: 709 ETLKEYVSCKVALSNSQNELNYIQSQLNISKTNE-KSLKDDITIVSK----ERNELKELV 763

Query: 697 LNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWY 756
             ++++Q + +      K    ++++ +E    ++S+ L+ K++E+++  S +  E++WY
Sbjct: 764 SQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWY 823

Query: 757 QKKFDIF 763
           Q K D  
Sbjct: 824 QNKIDAI 830

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 980  KSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQE 1039
            K KEN+E  DRFNR+KKQA+ RL+SSK  Q  L +QI  L+ + A +QS LE +   +Q 
Sbjct: 1301 KKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQN 1360

Query: 1040 LETQIK 1045
             E + +
Sbjct: 1361 TEEKFR 1366

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 160/643 (24%), Positives = 296/643 (46%), Gaps = 46/643 (7%)

Query: 147 LNREVINLKNDILILETKYDKLLKGYND--TKDNLKEKISELLALDTSFKSETKLKDEII 204
           L  E ++ KN+ L LE   ++++   N+  TK +L+EK+ E+  L  S   E   K E  
Sbjct: 241 LTSESLSCKNE-LQLEKSRNQVITTKNEELTK-SLQEKLMEMKDLSDSLYRE---KQEFA 295

Query: 205 EE---KDYLIANLTNEIESLKNREINEHSSDINIEY---GKNSSIIVDKQEYQRLLNEAL 258
            E   K  LI  L N+++SL+  E+N      N+E    G+ ++      E ++L+ E +
Sbjct: 296 HEMSMKQKLIDLLENQVKSLQG-ELNASLDKDNVELLASGERNT------ENEKLIQELI 348

Query: 259 INNEKIDEYDLKVARLTATVNEF----QSKTGIN----FVSTDD----FCDFIILKKEIQ 306
              E  +E + +  RL A V E      S+  IN    F+S  +      D  ILKKE+ 
Sbjct: 349 TLKENFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELI 408

Query: 307 KLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXX 366
           K   Q++ LQ ++E  I ELE   P +N+  ++                H          
Sbjct: 409 KERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKRER 468

Query: 367 XXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALRE 426
                  ++K S+  I TL  +  DL +Q+QF+L++ S+Q D  G L+  E+ FIK +  
Sbjct: 469 EFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVN 528

Query: 427 KGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWE 486
                S +   +SQ +IS+RL+ F ++ +LQ+KNME            +++E ++  K +
Sbjct: 529 NDDPNSES---DSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQ 585

Query: 487 AENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYTE 546
              +D + EAKE I+ +   +  L+ K+  L ++ +A + +   +NG +   + +   T+
Sbjct: 586 TFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICS-RNGSDQNGSLSANGTQ 644

Query: 547 GDR------LILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDI 600
           G+R        L  L+  +   T ++S    M  +++  LY    +++ +  K   S+ +
Sbjct: 645 GNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTL 704

Query: 601 TXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTND 660
           T                 N++L +  + ++    R+D     T+   + C + L  +   
Sbjct: 705 TEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETK 764

Query: 661 MNSLMTKYDELKYLKDQQSRITNELKM--EREQLKMELLNIKTVQIQSDLESAEYKASVA 718
           + +L T+  EL    ++ SR  N LK+  ER  L++ +  ++T+Q + +    E + +  
Sbjct: 765 VANLETE-KELLQSSERTSR-ENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYK 822

Query: 719 SKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761
             ++ LE   ++    L  K +E +D  ++K  ++ WYQ K D
Sbjct: 823 ENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLD 865

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 85/152 (55%), Gaps = 17/152 (11%)

Query: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLK 965
            K NR+LQE+LN   + I  ++ E+  L+ S+LE  +  LN+  E     NR KE   ++ 
Sbjct: 1254 KKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQ-LNLYKEEA---NRWKERSQEIL 1309

Query: 966  EASLQSDFKEKYEMK-------------SKENDENIDRFNRLKKQANARLHSSKEEQNAL 1012
                + D ++  E+K             +KEN E  DRFNRLKKQA+ +L+SSK  Q  L
Sbjct: 1310 HKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTL 1369

Query: 1013 NEQISSLKKDLAEVQSKLEVQSKTVQELETQI 1044
            + Q++ L++  +E++ K E + + V EL+ ++
Sbjct: 1370 SNQLNELREAKSELEGKFEAEERKVHELQERL 1401

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 75/166 (45%), Gaps = 39/166 (23%)

Query: 1153 SPSKMESDTTTTKPSFLP----------NQNLTQPSVTS-----------SFTFSPLAME 1191
            SP K  S+T++     LP          NQ++  P V+            +F FS  +  
Sbjct: 1655 SPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGG 1714

Query: 1192 NPFTSP--NNAKTPTSSFGMKPAFSFGSNPFTSNTNSLGTKM-STPDSNSTGGLFSQKND 1248
            NPFTS   NN    TS+FG KP F+  +N   SN +S GTK+ S+   N     FS   +
Sbjct: 1715 NPFTSSPQNNDTMGTSAFGFKPTFTLSNN---SNKSS-GTKIDSSSTENKPANPFSSFTE 1770

Query: 1249 ESKDTASQESS--AIDTNAG-------KRNSESEDN--SSETKKTK 1283
                +  +ESS  A+    G       KR +E +DN   SE+KK +
Sbjct: 1771 TGASSPERESSNTAMTPTPGEGASTPSKRAAEDDDNEVGSESKKPR 1816

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
           YIL149C (MLP2)
          Length = 1758

 Score = 99.0 bits (245), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 135/610 (22%), Positives = 261/610 (42%), Gaps = 80/610 (13%)

Query: 193 FKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQR 252
           F  E  LK  +IE  +  +A +  ++E          + D+    G + S      E +R
Sbjct: 283 FAREMALKQRLIELLNGQVATMKQDLEK---------AYDVAKNGGMSDS------ERER 327

Query: 253 LLNEALINNEKIDEYDLKVARLTATVNEF-------------------QSKTGINFVSTD 293
           LLN+     +K++     V+RL  T+ E                     S +G + +ST 
Sbjct: 328 LLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTV 387

Query: 294 DFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXX 353
            + D   L+K++ +    ++ LQ ++E  + ELE+  P LN+   +I             
Sbjct: 388 -YGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLL 446

Query: 354 XXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGEL 413
                              +++   + ++  L ++ +DL  Q+Q +LI  S+++D  G L
Sbjct: 447 LEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPL 506

Query: 414 TENEIKFIKAL---REKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXX 470
           T  E++F+K L   R+  T +      ++Q IIS+RL+ F+SV+ LQQKN E        
Sbjct: 507 TAEEVEFVKKLQSCRDSATGS------DTQAIISNRLVEFKSVVELQQKNAELLNAIRQL 560

Query: 471 XXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHE 530
               + +EH+ ++K ++   + +NEAKE IL        L+E +  L+ QL     V+ E
Sbjct: 561 AQKLEQEEHKTQSKVKSLEQNTVNEAKEAILS-------LQEHVQMLEDQLET---VTTE 610

Query: 531 KNGHESVLAENK------------LYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLT 578
           ++  + +++E K            L  +     +  L+  +    +++     M  +++ 
Sbjct: 611 RDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIK 670

Query: 579 SLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDE 638
           +LY  N +L  +  +   SR++                  N  L+     ++  +  +D 
Sbjct: 671 ALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDT 730

Query: 639 TLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQL------ 692
              STI   V  K+ L S+++ +  L ++ D L+       ++  +LK E E L      
Sbjct: 731 RRQSTIEEFVSAKSELFSISSQLTILQSERDFLR-------KVEADLKKENESLNKDNND 783

Query: 693 -KMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNR 751
            ++ +L +KT Q + D    E +    ++I +L+   S   + L  K++E  +  S+ + 
Sbjct: 784 SQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843

Query: 752 ELDWYQKKFD 761
           +  W+Q K D
Sbjct: 844 QCKWFQSKLD 853

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 170/719 (23%), Positives = 316/719 (43%), Gaps = 82/719 (11%)

Query: 87  LEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQC 146
           LE  ++  K   L  K E++++    N ++S    L  +L + N+  N+  ++   + Q 
Sbjct: 173 LEFIIQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQN 232

Query: 147 LNREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEE 206
              +V +LK+ +         L     +  + L+EK+ E   L     +E   K+E   E
Sbjct: 233 GYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTE---KEEFTRE 289

Query: 207 ---KDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEK 263
              K  LI  L +++ S+K        SD+   Y   +   +   E  +LL+E +   + 
Sbjct: 290 MSLKQRLIDLLESQVSSMK--------SDLENAYQSANQNGMSTPEKDQLLDELIDTKKN 341

Query: 264 IDEYDLKVARLTATVNEFQSKTGINFVST-----------------DDFC-DFIILKKEI 305
           ++    +  +L ATVNE  S  G N V+                     C D  ILKK++
Sbjct: 342 LEATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQL 401

Query: 306 QKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXX 365
            +   Q++ LQ ++E  + ELE+  P LN+  ++                          
Sbjct: 402 VQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKT 461

Query: 366 XXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALR 425
                  +++   + ++ +L  + +DL +Q+Q++L+  S+++D +G LTE E++F+K + 
Sbjct: 462 IELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRII 521

Query: 426 EKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKW 485
               E   +   ++Q IIS+RL++F+SVI LQ KN E            +++E + R + 
Sbjct: 522 SSEDEAPKS---DTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRL 578

Query: 486 EAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYT 545
           ++     + EAKE IL        L+E +  L+ QL   + VS E++  +   + NK   
Sbjct: 579 KSVETQTVKEAKEAIL-------SLQEHVQRLEDQL---KIVSKERDAFKLANSANK--- 625

Query: 546 EGDRLI--------LD----ELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLK 593
           +GD           LD    EL+  +    +Q+ + I +  D++ +LY    E+T    +
Sbjct: 626 QGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQ 685

Query: 594 AYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKAS 653
              S+ +                  N +L +  + ++  + ++DE   STI   +  K+ 
Sbjct: 686 ERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQ 745

Query: 654 LLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQL-------KMELLNIKTVQIQS 706
           L ++T+ +  L ++ D L+       +I  ELK E E L       K+ +  ++T+Q + 
Sbjct: 746 LSNLTSKLAILTSERDFLR-------KIEAELKNENEALTKENTTSKILVSQLQTLQRER 798

Query: 707 D--LESAE--YKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761
           D  LE A+  Y+ ++    +DL  T  +L +  RT+E E Q    T   +  W+Q K D
Sbjct: 799 DILLEEAQTNYRKNIEKLESDLHETREHLVR--RTREYEEQRVSDTS--QYKWFQAKVD 853

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 26/113 (23%)

Query: 916  NDSEKHIEQ---MDMEIKKLNDSI--LEYQKNTLNIT-----SEITLLR-------NRCK 958
            N+S+K++EQ      EI KL + +  LE Q  +L IT      +I+LL+        R +
Sbjct: 1238 NESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQ 1297

Query: 959  ELENKL---------KEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARL 1002
            ++ +K          K A   ++ K + E KS EN E+ +RF +L+KQAN RL
Sbjct: 1298 DILHKYERIDPVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERL 1350

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score = 89.0 bits (219), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 175/388 (45%), Gaps = 18/388 (4%)

Query: 380 DKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNS 439
           DKI  LR E  DL  Q+Q++L+ N    D    LT +E  +IK +     E       +S
Sbjct: 376 DKI--LRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDS 432

Query: 440 QDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEE 499
           Q IIS R+++F+S++ LQQ+N+             +  E +L +    ++ + +NEAK+ 
Sbjct: 433 QLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLES---GDSIEAINEAKQT 489

Query: 500 ILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNI 559
           +L +   +  L+ K+  L  +L AN   +   +G       N   ++G+ +    LKN  
Sbjct: 490 LLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFG----NSDLSDGNNI--QALKNKY 543

Query: 560 PEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISN 619
                ++S  I   + Q+ +L     +L  +      S+ +                  N
Sbjct: 544 DSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNEN 603

Query: 620 EKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQS 679
             L+  ++     ++ ++   + TI  ++DC A L  +   + + + + D    L++ QS
Sbjct: 604 STLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKD---ILQNAQS 660

Query: 680 RITNELKM---EREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLR 736
            I N+L     ER   +  +  ++ +Q   D +  + + S+ +KI+DLE+ N+ L   + 
Sbjct: 661 SIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKID 720

Query: 737 TKEQELQDFISTKNRELDWYQKKFDIFS 764
           TKE      ++    EL+WYQ KFD  S
Sbjct: 721 TKETSPSSALTNPKAELEWYQTKFDSLS 748

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 176/735 (23%), Positives = 340/735 (46%), Gaps = 121/735 (16%)

Query: 62  QLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMS--ITYNSLESKN 119
           QLN  T++ N    E T     ISEL+    Q K +N+ ++LE+ + S      S+ S +
Sbjct: 203 QLNTKTVQLNEF-REST-----ISELQDS--QLKVSNMESELEIARTSNQKLKQSVHSLH 254

Query: 120 RELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDIL-ILETKYDKLLKGYNDTKDN 178
            +LE  LS   +    + DE  +  Q L +E ++LK  ++  LE   + L K  + TK+N
Sbjct: 255 EQLEQKLSENKE----IKDEYNFSKQELTKE-MSLKQRMIDALEKHMESLKKEMDATKNN 309

Query: 179 LKEKISELLALDTSFKSETKLKDEIIEEKDYLIANL-TNEIESLKNRE-INEHSSDINIE 236
           +          D+S+ +E K +DE+IEE + +   L  +E   +K +E I+E +S+I +E
Sbjct: 310 M----------DSSYFTE-KERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLE 358

Query: 237 YGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFC 296
                                          D +V   TA+     S+  ++ +    + 
Sbjct: 359 -------------------------------DSEVGNTTAS-----SEKSVSVIPKL-YG 381

Query: 297 DFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXH 356
           D  +LKK++   + Q+D L+ ++E  + ELE+  P LN+  ++                 
Sbjct: 382 DLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLES 441

Query: 357 FXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTEN 416
                           + +K  + +I +L ++  DL +QIQ++L++ SI+++  G L+  
Sbjct: 442 TGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAE 501

Query: 417 EIKFIKAL--REKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXX 474
           E++F+K L   ++ T+TS     ++Q II+DRL+ F SV+ LQQKN E            
Sbjct: 502 ELQFVKNLTNSQEITKTS-----DTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADEL 556

Query: 475 DNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVS-HEKNG 533
           + +E E +++ +   D+ + EAKE IL +   +  L+ ++  L ++ +A + +S +  +G
Sbjct: 557 ERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSG 616

Query: 534 HESVLA--------ENKLYTEGDRL--ILDELKNNIPEFTKQASNI------ISMNFDQL 577
             +  A        ++K+     RL  ++ E +NN  E++ + SN+      IS+NF+  
Sbjct: 617 TNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESE 676

Query: 578 TSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDTIRRKD 637
            +       L  DRL   QS                      E+L++    ++D + ++D
Sbjct: 677 KTSRT----LAEDRLNLLQS-------------TLELSKRQCEELQKRSSDLQDILTKQD 719

Query: 638 ETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQL----- 692
           +    T+ + +  K++L S+ ++++ L +   E +++    +++  ELK E E+      
Sbjct: 720 KRTQETVDSLIKTKSTLSSIQSELSILKS---EKQFM----AKVQKELKAENERFSKESV 772

Query: 693 --KMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKN 750
             K+ +  ++T+Q + ++   E + S   K+  LEI  S   + L   E+      S K 
Sbjct: 773 EYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKE 832

Query: 751 RELDWYQKKFDIFST 765
            + +W+Q+K D  ++
Sbjct: 833 HQYNWFQEKIDKLTS 847

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar
           to uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 118/495 (23%), Positives = 232/495 (46%), Gaps = 54/495 (10%)

Query: 296 CDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXX 355
            D  ILK+++ + + Q++ LQ ++E  + ELE+  P +N+  ++                
Sbjct: 393 GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLE 452

Query: 356 HFXXXXXXXXXXXXXXXSRLKLSDD--KIETLREENNDLTNQIQFMLISNSIQNDKYGEL 413
           H                   K+SDD  ++E L  +  DL +Q+Q++LI+ SI ND    L
Sbjct: 453 HATKENELKTNELQSLKK--KISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLL 510

Query: 414 TENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXX 473
            E+EIKFIK L       S N   +SQ +IS+ LI+F+ +  LQ+KNME           
Sbjct: 511 NEDEIKFIKNLVSNDNMASTN---DSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQ 567

Query: 474 XDNQEHELRAKWEA-----ENDDVLNEAKEEILKVVSESDKLKEKISE-LQQQLNANRPV 527
            +  E+E + K  +     E++++  EAKE IL +        EK++E L++ L   + V
Sbjct: 568 LE--ENEEKKKSTSNNTVDEDNEIFAEAKEAILTL--------EKVNENLEKNL---QIV 614

Query: 528 SHEKNGHESVLAEN-----------------KLYTEGDRLILDELKNNIPEFTKQASNII 570
           + E++  + +++E+                 K Y E    ++ +L+N + + T   SN  
Sbjct: 615 TKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNET---VVKDLENRLTQLTND-SNAH 670

Query: 571 SMNFDQLTSLYNKNLELTADRLKAYQS-RDITXXXXXXXXXXXXXXSISNEKLKEHMEVI 629
           S    +  +L +K +     +++ Y+S + +               S  NE+L+     +
Sbjct: 671 SKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRL 730

Query: 630 KDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELK--- 686
           +D++ ++D+    T +++V+  +   S+   + +L T   E+  LKD++  + +EL    
Sbjct: 731 EDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLET---EVTLLKDREISLKSELSNTT 787

Query: 687 MEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFI 746
            E+ +L++ +  ++++Q + +      ++    +I+++   N  L K L  +  E+    
Sbjct: 788 EEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIE 847

Query: 747 STKNRELDWYQKKFD 761
             +N + +WYQKK D
Sbjct: 848 KERNAQYEWYQKKID 862

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 46/61 (75%)

Query: 980  KSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQE 1039
            K +E +E  DRFNRLKKQA+ +L++SKE Q++L EQIS+L  +  +++ +L+V+++   E
Sbjct: 1337 KVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSE 1396

Query: 1040 L 1040
            L
Sbjct: 1397 L 1397

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 156/733 (21%), Positives = 316/733 (43%), Gaps = 53/733 (7%)

Query: 56  LQTLHEQLNNI-TLK--YNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITY 112
           L+ L E++N I TLK   N+V  E   L +   +L  ++E  K   L  + +L+K++ T 
Sbjct: 78  LKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTL 137

Query: 113 NSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGY 172
           +    + +  ES+  +   +  +  D ++ + Q +   +  + N++ +   K  +L K  
Sbjct: 138 SLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRN 197

Query: 173 NDTKDNLKEKISELLALDTSFK-------SETKLKDEIIEEKDYLIANLTNEIESLKNRE 225
            +   +L+ KISE+ +L+ S K       SE +L+D++I      I  L  ++ESL + +
Sbjct: 198 EELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEK 257

Query: 226 INEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQS-- 283
            ++  +             +DK E  R +      NEK++  + +   L  ++ EFQ+  
Sbjct: 258 FDDPGTQ-----------KLDKHELLRQIKNL---NEKLEISERERLSLVHSMEEFQNIP 303

Query: 284 ----------KTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPEL 333
                      +G N  +     D  IL+K   K   Q+  L+E++  ++ ELE + P L
Sbjct: 304 EEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSL 363

Query: 334 NNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSRLKLSDDKIETLREENNDLT 393
           ++  ++                H                S        I +L  +   L 
Sbjct: 364 SSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLA 423

Query: 394 NQIQFMLISNSIQNDKY--GELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFE 451
            Q++++L+   IQN++     L   +++ +       T  + +   +S+ I+ +RL +F+
Sbjct: 424 RQVKYLLL--IIQNNETLGSSLGRKDLELLGQYLAANTAEAMS---DSEKILLERLAQFK 478

Query: 452 SVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLK 511
           +V  LQ +NM+            +  E     +  +E D+ +N+AKE IL +   S KL+
Sbjct: 479 NVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLE 538

Query: 512 EKISELQQQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQASNIIS 571
            +I EL  +L   +    EK   ES+ A +K+  +     +D L   +    K + +II 
Sbjct: 539 SQIKELSDELAVQKK---EKTEKESISAMSKIEDDASSHTID-LGKQLSANLKHSKDIID 594

Query: 572 MNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKD 631
               ++ +L+  N ++     K   +R +                   E+L+E +  ++ 
Sbjct: 595 ALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQ 654

Query: 632 TIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKM-ERE 690
            I  K++  + +  +++ CK+ L +   ++ SL  + +EL        R   E  + ER 
Sbjct: 655 NILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAE-NELSIETQTTLRTKKEALLNERN 713

Query: 691 QLKMELLNIKTV--QIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFIST 748
            L+M +  + ++  ++Q+ L+  +       KI+ L+ T +N    L+  +Q + +  S 
Sbjct: 714 NLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTN--NQLQLVQQRMSELKSQ 771

Query: 749 KNRELDWYQKKFD 761
            + E+ WY+   D
Sbjct: 772 NDSEIKWYKATID 784

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 165/704 (23%), Positives = 321/704 (45%), Gaps = 74/704 (10%)

Query: 82  DKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDL-----SAMNDNENTL 136
           D+I  L+ +LE+ K  +L ++ E E+       +   N+ LE  L       M   ++ L
Sbjct: 101 DEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSIL 160

Query: 137 HDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISELL--ALDTSFK 194
             EE+      ++E+ NL++++ IL+   D LL    +  +N++EK+ E+   + D S K
Sbjct: 161 KMEEK------DQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTK 214

Query: 195 SETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLL 254
            +  L +  I  KD + ++L  ++     +EI +  S   I+   N+S    + E Q+++
Sbjct: 215 QQEFLHE--IGLKDRINSSLETQL-----KEIQQEKS---IQNEDNTS----RAESQKIM 260

Query: 255 NEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDL 314
            + +   +++ +   +  RL + VNEF     IN V+ +      +LKKE+ K++ Q+D 
Sbjct: 261 EQLIDTRKQLKDSRNECTRLKSYVNEF-----INDVNGEYSSSSSLLKKELLKVKEQKDY 315

Query: 315 LQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXXXXXXXXXXXXXXXSR 374
           L+ ++E  I ELE   P +++   K                                  +
Sbjct: 316 LETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRK 375

Query: 375 LKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFN 434
            + +D  I+TL  + +DL +QIQF+L+    Q      L+++E  FI+ L E  T    N
Sbjct: 376 SEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNN 435

Query: 435 ELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLN 494
              +SQ IIS+RL++F  +  LQ++NM+            + QE   +A         L 
Sbjct: 436 ---DSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLE 492

Query: 495 EAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE-NKL--YTEGDRLI 551
           EAK+ +L +   ++ L+ K+   +++ +  + +S  K+   +  +E N +  +T G   +
Sbjct: 493 EAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGK--L 550

Query: 552 LDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITXXXXXXXXXX 611
            +EL+      TK+   +   N D    + NK  EL     K   +++            
Sbjct: 551 QNELQQTREYLTKEIEKLTRTNKD----ILNKKKELEYSMKKMESAKEYAEGKAEL---- 602

Query: 612 XXXXSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDEL 671
                I N  L   ++  + ++  +++ L   ++     +A L  +T D++ L ++Y+ L
Sbjct: 603 -----IENNLL--MLQENRKSVLEQNDHLQQLLSQK---EAKLAELTQDLHELTSQYNLL 652

Query: 672 KY-LKDQQSRITNELKMEREQLKMEL---------LNIKTVQIQ-SDLESAEYKASVASK 720
           +    D QS+ +N L+ + +  + EL         L +K  +++ S  E    +A+V  K
Sbjct: 653 QIRFTDTQSQ-SNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELK 711

Query: 721 IN----DLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKF 760
           +N    + ++   +L K +  +E +++D    +  EL+WYQK F
Sbjct: 712 LNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNF 755

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 73/128 (57%), Gaps = 9/128 (7%)

Query: 902  SSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELE 961
            S L + N+ LQ KLN+    +  + ME+K + +S+ + + + + I  E    R R +EL 
Sbjct: 1208 SELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELS 1267

Query: 962  NKLKEASLQS---------DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNAL 1012
             ++ +  L S           K+  E K K+N E  +RFN LKKQA+ RL++SKE Q++L
Sbjct: 1268 VQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSL 1327

Query: 1013 NEQISSLK 1020
            N+QI+ LK
Sbjct: 1328 NKQINELK 1335

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 113/492 (22%), Positives = 215/492 (43%), Gaps = 59/492 (11%)

Query: 300 ILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIXXXXXXXXXXXXXXXHFXX 359
           +LKK++ + + ++  LQ ++E  I ELEN  P +++  +K                    
Sbjct: 367 LLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSN 426

Query: 360 XXXXXXXXXXXXXSRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIK 419
                        S+L      I+ L  +  DL NQ++ +L+  +++ND  G LT  EI+
Sbjct: 427 EKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIE 486

Query: 420 FIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEH 479
           FI  +     + + +EL  SQ +IS+RL+ F ++  LQ KNME            +N E+
Sbjct: 487 FINKISNNSEDLNGSEL-TSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIEN 545

Query: 480 ELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ-------LNAN-------- 524
               K E +N  +  +AKE IL +   +D L+ K+  L+ +       LN N        
Sbjct: 546 ANSHK-EFQNKTIA-DAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIK 603

Query: 525 --------RPVSHEKNGH--ESVLAENKLYTEGDRLILDELKNNIPEFTKQASNI-ISMN 573
                    P ++EK+    ++++ E K   + ++   D L++ I  FT   SN+ IS+ 
Sbjct: 604 NDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNK---DALESQIASFTADKSNLTISLE 660

Query: 574 FDQLT-SLYNKNLELTADRLKAYQSRDITXXXXXXXXXXXXXXSISNEKLKEHMEVIKDT 632
            ++ + +L  + + LT       ++                     N++L +  E +++ 
Sbjct: 661 KEKSSNTLMAEKISLTESAFDMLKTE--------------------NKELNKRFENLQNI 700

Query: 633 IRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNEL---KMER 689
           I +++  L   I  ++  +     ++N    L     E  +L   Q  + +EL     E+
Sbjct: 701 IIKQESKLGDIINKYITGET---EISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEK 757

Query: 690 EQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTK 749
            +L++ L  ++++Q +      + +    SKI++LE  N +L K+L +K  E+Q    + 
Sbjct: 758 NKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISN 817

Query: 750 NRELDWYQKKFD 761
             +  WYQ   D
Sbjct: 818 ESQCTWYQNTID 829

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 96/173 (55%), Gaps = 31/173 (17%)

Query: 900  EHSSLMKSNRQLQEKL--NDSEKHIEQMDME------------IKKLNDSILEYQKNTLN 945
            E ++L ++N QLQ+KL  ND E +I    +E            +++L +SI+E  +    
Sbjct: 1168 ELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTL 1227

Query: 946  ITSEITLLRNRCKELENKLKEASLQ---------SDFKEKYEMKSKENDENIDRFNRLKK 996
            ++ E    + R +E+  K ++  L+         S  K + + K+K+N++  DRFNRLKK
Sbjct: 1228 LSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKK 1287

Query: 997  QANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEV----QSKTVQELETQIK 1045
            QA+ +L ++K +  +L  +I+    DL + +SKLE+    + K +QE+E+Q+K
Sbjct: 1288 QAHEKLDAAKAQNASLTAEIT----DLIDAKSKLEIDLDEERKRIQEVESQLK 1336

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 6/71 (8%)

Query: 968  SLQSDF---KEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSL---KK 1021
            +L++D+   K+ +E KSKE +E  D+F+RLK+QAN RL++SK  Q  L++ + SL   + 
Sbjct: 645  ALKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERT 704

Query: 1022 DLAEVQSKLEV 1032
            +  E  SKLEV
Sbjct: 705  NFKEHISKLEV 715

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 82/153 (53%), Gaps = 9/153 (5%)

Query: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967
            NR++ ++LND ++ I ++  ++ +  + +       L   SE+   + R ++L  + K+A
Sbjct: 1194 NREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDA 1253

Query: 968  SLQ---------SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018
              +         SD K K       N +  ++FNRLKKQA+ +L +SK++Q AL  +++ 
Sbjct: 1254 QKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNE 1313

Query: 1019 LKKDLAEVQSKLEVQSKTVQELETQIKSTEADS 1051
            LK    +++  L  ++  V +L+T++K+ E  S
Sbjct: 1314 LKAIKDKLEQDLHFENAKVIDLDTKLKAHELQS 1346

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%)

Query: 973  FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEV 1032
             + + E KSKEN+E  +RF +LKKQA+ +L++SK  QN+L  QI+ L+    E+ S+LE 
Sbjct: 1326 LQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLET 1385

Query: 1033 QSKTVQELETQIKST 1047
            + +    LE +++ T
Sbjct: 1386 EKEGKLSLEKRLEVT 1400

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 35/48 (72%)

Query: 973  FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020
            FK   ++K++END+  DRF RLKKQA+ +L++SK   ++L  ++S LK
Sbjct: 1158 FKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELK 1205

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 14/84 (16%)

Query: 716 SVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTM--------- 766
           +++SKI  L   N +L  DL  KE+E++ FI    +++ WYQ+  D  S           
Sbjct: 682 TLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKII 741

Query: 767 -----LKRVAEGNDNNDDIPVKTE 785
                L+ ++E + +N   PV TE
Sbjct: 742 ELNDKLRLLSEKSLSNKPYPVGTE 765

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 46/113 (40%), Gaps = 33/113 (29%)

Query: 1131 MESHTINNNPVKESVDMLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVT----SSFTFS 1186
            M +  + N PV +        E P+     TTTT         ++QP+ T    S+  FS
Sbjct: 1477 MVAGPLTNEPVLD--------EKPNAFAGATTTT---------ISQPTSTTAKDSANAFS 1519

Query: 1187 PLAMENPFTSPNNAKTPTSSFGMKPAFSFGS---NPFT--SNTNSLGTKMSTP 1234
                   F +      P  S   +PAFSFGS     F+  S+ NS+G    TP
Sbjct: 1520 -------FNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGTP 1565

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score = 39.7 bits (91), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 49/98 (50%), Gaps = 8/98 (8%)

Query: 383 ETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDI 442
           E LR+  +DL +Q+Q++L+      D     TE E   +K +     E + N+  +S  I
Sbjct: 453 ELLRQ-RSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIV--SNENTEND-TDSHKI 504

Query: 443 ISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHE 480
           IS RL+ F++V  LQQKNME            + QE E
Sbjct: 505 ISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQE 542

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNIT----------SEITLLRN 955
            K N  L  +L D +  +E ++ EI +L   + E +++ LNI           S+  L + 
Sbjct: 1088 KVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQH-LNICQEELERWKLRSQTILQQG 1146

Query: 956  RCKELENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQ 1015
            +  E E  +K        +E+ E    EN +  DRF+RLKKQA+ +L ++K  Q  L  Q
Sbjct: 1147 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 1206

Query: 1016 ISSL 1019
            I+ L
Sbjct: 1207 INEL 1210

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%)

Query: 972  DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKK 1021
            + K++ E KSKE  E++DRF RLKKQA  +L+  K  +N L E    L+K
Sbjct: 755  ELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEK 804

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020
            SD K K       N +  D+FNRLKKQA+ +L +SK++Q AL  ++  LK
Sbjct: 1268 SDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELK 1317

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 55/106 (51%)

Query: 656 SVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKA 715
           S+  ++++L  K  +L+ +K+  +R       E+ QL+M+L   +T   +  L+S   + 
Sbjct: 716 SLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQV 775

Query: 716 SVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFD 761
              +KI +LE     L+  L +K QE++   ++KN +L W Q   D
Sbjct: 776 QYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTID 821

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 13/133 (9%)

Query: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967
            NR++ E+L   ++ + Q+  ++ K  + +       L   SE+   + R  +L  + +E 
Sbjct: 1195 NREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREV 1254

Query: 968  SLQ---------SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018
              +         SDFK K         E  ++FNRLKKQA+ +L +SK++Q AL  ++  
Sbjct: 1255 QKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNEL-- 1312

Query: 1019 LKKDLAEVQSKLE 1031
              K+L  V+ KLE
Sbjct: 1313 --KELKAVRDKLE 1323

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%)

Query: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQIK 1045
            ++FNRLKKQA+ +L +SK++Q AL  +++ LK+   +++  L  +   V +LE ++K
Sbjct: 1285 NKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLK 1341

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 67/133 (50%), Gaps = 3/133 (2%)

Query: 382 IETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQD 441
           I +L  +  DL  Q++ +L + S        L+ +E+  ++ L E  +E + NE  +SQ 
Sbjct: 451 IHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLE--SENTVNE-RDSQI 507

Query: 442 IISDRLIRFESVISLQQKNMEXXXXXXXXXXXXDNQEHELRAKWEAENDDVLNEAKEEIL 501
           II+++L+ F+++  LQ+KNME            +  E E         +  + EAKE I+
Sbjct: 508 IITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAII 567

Query: 502 KVVSESDKLKEKI 514
           ++ S + KL  ++
Sbjct: 568 EMESINSKLALRV 580

>KAFR0B06220 Chr2 complement(1279469..1281088) [1620 bp, 539 aa] {ON}
            Anc_8.408 YDR200C
          Length = 539

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 968  SLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQ 1027
            +L+  F EK+E+  KE  E  +RF   K+   AR+    E++   N Q+  L+ ++ +++
Sbjct: 403  TLKKSFNEKHEIYIKETKEKFERFKTDKELLKARMD---EKETVYNNQLKKLEMEIDDMK 459

Query: 1028 SKLEVQ-----------SKTVQ-ELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLIT 1075
            ++LEV+           SKTV+ E E    + E +S     S+ K QN    K+  K + 
Sbjct: 460  TRLEVEKYKNSKFNQKDSKTVKDESEATSDTDEMESFQEDGSVKKGQNYGNRKKTGKFVA 519

>NCAS0F00840 Chr6 (170473..174315) [3843 bp, 1280 aa] {ON} Anc_2.539
           YMR076C
          Length = 1280

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 8/80 (10%)

Query: 904 LMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITL--LRNRCKELE 961
           L K+   L   L D  K  E ++  ++KLND  L Y   T  I++E+T   L+N  KEL 
Sbjct: 556 LQKTITWLAAGLADPTKGTEALN-TLRKLNDPRLYYLVKTC-ISNEVTFSTLKNSYKELS 613

Query: 962 NKLKEASLQSDFKEKYEMKS 981
           NKL++  L   F+ KY MKS
Sbjct: 614 NKLQDPGL---FR-KYNMKS 629

>TPHA0O00460 Chr15 complement(81615..83513) [1899 bp, 632 aa] {ON}
            Anc_1.485 YEL042W
          Length = 632

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 6/59 (10%)

Query: 1218 NPFTSNTNSLGTKMSTPDSNSTGGLFSQKNDESKDTASQ---ESSAIDTNAGKRNSESE 1273
             P ++   ++G+ ++ PD     GLFSQ  ++ KDT+S    +S+++  N G  + E+E
Sbjct: 57   GPSSAGLQTMGSSIAAPDFL---GLFSQAQEQFKDTSSGPGDQSASVGANGGPESREAE 112

>KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q12234 YOR216C Saccharomyces
           cerevisiae RUD3 Golgi matrix protein that is involved in
           the structural organization of the cis-Golgi
          Length = 462

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 908 NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967
           N  L++KL  ++  I++    I  LND I+   K   N+++E +  +++ KELE+KL EA
Sbjct: 157 NINLKQKLKSADSEIQEDKQTISILNDEIVNLNKECENLSNECSEFKSKIKELESKLNEA 216

Query: 968 S 968
           S
Sbjct: 217 S 217

>Suva_9.53 Chr9 (88356..89537) [1182 bp, 393 aa] {ON} YIL136W (REAL)
          Length = 393

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 14/143 (9%)

Query: 48  NADNDSTDLQTLHEQLNNI----TLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKL 103
           NA +  ++ Q   ++L  I       YN+    + Q+A++++   ++   E  + L +K 
Sbjct: 241 NASSQPSEAQRRLDELKKIKEKGWFGYNKGEQSEQQIAERVAR-SLEGWGETASQL-SKD 298

Query: 104 ELEKMSITYNSLESKNRELESDLS-AMNDNENTLHDEEQYKNQCLNREVINLKNDILIL- 161
           E++ +   Y   E+  ++L+ ++S AM        D +QY +   +     + ND   L 
Sbjct: 299 EMDDLRWNY---ENSKKQLDKNVSDAMGSLSKAKEDLKQYGSHWWSGWTAKVDNDKEALK 355

Query: 162 ---ETKYDKLLKGYNDTKDNLKE 181
              + KYD  LK Y+D KD  KE
Sbjct: 356 DEAQKKYDDALKKYDDAKDKFKE 378

>NDAI0B04150 Chr2 complement(1047061..1050330) [3270 bp, 1089 aa] {ON}
            Anc_2.186 YOR098C
          Length = 1089

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 50/101 (49%), Gaps = 27/101 (26%)

Query: 1159 SDTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNAKTPTSSFG---------M 1209
            S TTT+KPSF             SF    LA ++   SPN + +P  +FG          
Sbjct: 788  STTTTSKPSF-------------SFKNPSLAGKSSTASPNLSPSPGFAFGKPAEEAQQPT 834

Query: 1210 KPAFSFGSNPFTSNTNS--LGTKMSTPDSNSTG---GLFSQ 1245
            KP+FSFG+   T+N ++  LG  ++ P +++TG    LF Q
Sbjct: 835  KPSFSFGATASTTNNDAKKLGISLTNPTASATGSQTSLFGQ 875

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 84/169 (49%), Gaps = 23/169 (13%)

Query: 860  FNEYKVIEKELEKAKNEIMRTSGDAQXXXXXXXXXXXRDQEHSSLMKSNRQLQEKLNDSE 919
             N Y  +E+E++  +N++     D             ++++HS+ ++   +++ KLNDSE
Sbjct: 183  LNNYDNLEQEMDDLRNKLQELEKDL--AAKNKLVDSRKEEDHSACIEERERIERKLNDSE 240

Query: 920  KHIEQMDMEIKKLND------SILEYQKNTLNITSEITLLRNRCKELENKLKEASLQSDF 973
              ++ M  ++ +L +      S+LE ++N      E+  ++++ KELENK      Q D 
Sbjct: 241  SKLKTMKGQVHELENSANRKSSLLESKEN------ELRKVKDQLKELENKADATCSQLDS 294

Query: 974  KEKYEMKSKENDENIDRFNRLKKQAN---ARLHSSKEEQNALNEQISSL 1019
            K K E++        D+ N L+ QAN   ++L S + E   L  Q++ L
Sbjct: 295  K-KNELRKL-----TDQLNELENQANEKDSQLKSKESELKKLTNQLNEL 337

>NCAS0A09270 Chr1 complement(1831820..1832827) [1008 bp, 335 aa]
           {ON} 
          Length = 335

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%)

Query: 904 LMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELE 961
           L++ NR L+E+L   ++ +E++ +    L + +++Y   T N   EI +L+ R ++LE
Sbjct: 75  LVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDEIEILKRRIEDLE 132

>ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YLR309C (IMH1)
          Length = 887

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 99/197 (50%), Gaps = 22/197 (11%)

Query: 904  LMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENK 963
            L KS    +  L+  EK IE ++ ++++ N   +E +K   +  +E+   +     LE +
Sbjct: 477  LKKSEATTRMSLSQKEKTIEYLEEQVRQYNSKEIEDKKAFADSKTELERWQRTAANLEKQ 536

Query: 964  LKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNAL-------NEQI 1016
            L          E+  +++K +D+N++ + +   + + RL   +E+ ++L        +Q+
Sbjct: 537  L----------ERIRLETKRHDDNLESYIKENGKLSERLEVLQEKYDSLQNLKSNSGDQV 586

Query: 1017 SSLKKDLAEVQSKLEVQSKTVQELETQI--KSTEADSRSR-STSIPKSQNQSLDKQDTKL 1073
            S+++K   E+ SKL+  +K V  LE ++   ST    R+R +T++ +  N     +DTK+
Sbjct: 587  SAIRKQCEELNSKLKEATKRVMSLEDELNETSTVLQERTREATTMRRMINSDRSSKDTKI 646

Query: 1074 ITDEDSNVIPQSTQEED 1090
               ED   +  +++E D
Sbjct: 647  RELEDR--VAAASEERD 661

>Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}
           YKL179C (REAL)
          Length = 671

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 117/247 (47%), Gaps = 44/247 (17%)

Query: 98  NLHTKLELEKMSITYNSLESKNRELESDLSAMN---DNENTLHDEEQYKNQCLNREVINL 154
           NL T+ ELE        LE +N EL   L+      + E  LH +E   NQ        L
Sbjct: 236 NLVTQ-ELETTQARVYQLEKRNEELSGALAKATSEAERETELHAKELKLNQ--------L 286

Query: 155 KNDILILETKYDKLLKGYNDTKDNLKEKISELLALDTSFKSETK-LKDEIIEEKDYLIAN 213
           +++  +L   Y++  K    +   LKE+++  +A   S++SE + ++ ++    DY  + 
Sbjct: 287 ESENALLSASYEQERKSTTHSISELKEQLNGAIAESESYRSELETVRRKLSNYSDY--ST 344

Query: 214 LTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVA- 272
           +  E+ +LK            IE+G N     D  + +    ++  N++K  E  L  A 
Sbjct: 345 IKEELSALK-----------KIEFGVNE----DDSDNE---TDSKYNDDKTVESSLLSAN 386

Query: 273 -RLTATVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQ---EKLEYLIHELEN 328
            +L AT+ E++SK+     + ++ C  I LKK + +L+ Q  +L+   EKLE  + ++EN
Sbjct: 387 KKLQATLAEYRSKS----TAQEETC--IQLKKSVDQLKQQIAVLEEANEKLEMDLEKVEN 440

Query: 329 HAPELNN 335
             P  N+
Sbjct: 441 VGPHFND 447

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
           similarities with uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport coiled-coil protein necessary for protein
           transport from ER to Golgi Integrin analogue gene
          Length = 950

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 14/98 (14%)

Query: 732 SKDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVKTENINSSD 791
           SK L  K + LQD I  KN EL+  +++ + F + LK V+       D+ V        +
Sbjct: 550 SKQLEEKVRHLQDVIVAKNSELEMQKQELNQFESYLKSVSLFQIQAGDLIV--------E 601

Query: 792 SFVLDNFSEQVEGDDTSSKERSPSCNNISVFRVKDPMK 829
            + L+ ++ Q+   D + KER+P   +I  F  +D ++
Sbjct: 602 QYRLNKYATQM---DAAFKERNP---DILGFFTQDQLQ 633

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
            Anc_7.310 YDL195W
          Length = 1300

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 1164 TKPSFLPNQNLTQPSVTSSFTFSPLAMENPFT-SPNNAKTPT-SSFGMKPAFSFGSNPFT 1221
            T+P  +P Q  T P       ++P A  NP    P N   P+ SS    P  +   NP+ 
Sbjct: 1068 TRP-IMPTQPYTNP-------YAPSAAANPLPQPPTNPYAPSASSNAATPGVAIPVNPYA 1119

Query: 1222 SNTNSLGT 1229
            +N+N +G+
Sbjct: 1120 TNSNGMGS 1127

>NCAS0C01010 Chr3 complement(183823..188271) [4449 bp, 1482 aa] {ON}
            Anc_8.736 YMR219W
          Length = 1482

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 1160 DTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNAKTP 1203
            ++ TTKP   P+ + T  SV +S T     +ENPF+S  + K+P
Sbjct: 1392 ESPTTKPYTPPHGDETDVSVIASPTIGEEKIENPFSSVRSGKSP 1435

>NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.636
           YOR216C
          Length = 518

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 79/153 (51%), Gaps = 17/153 (11%)

Query: 50  DNDSTDLQTLHEQLNNITLKYNRVTNEKTQLADKISELEVKLEQEK---CNNLHTKL-EL 105
           DN+  D+  L ++   +    +   NEKT   + + +L  KLE+++     +L  K  E+
Sbjct: 298 DNNKQDIVNLKDEKEEMKQALHASENEKTAFEESLQQLSSKLEEQENDYAQSLREKAQEI 357

Query: 106 EKMSITYNSLESKNRELESDLSAMNDNENTLHD--------EEQYKNQCLNREVINLKND 157
           + +S+   S   KN+ L+++L ++ D+  +L +        E++ K Q L  ++  L+++
Sbjct: 358 KALSVQLESSADKNKALQTELQSLKDDIQSLKENSSLKDKLEQETKEQAL--QIGKLRHE 415

Query: 158 ILILE---TKYDKLLKGYNDTKDNLKEKISELL 187
            ++L    TK   +LK  +D++   KE IS LL
Sbjct: 416 SIVLNEHLTKAMAMLKRSSDSESVDKELISNLL 448

>Suva_10.410 Chr10 complement(721801..723384) [1584 bp, 528 aa] {ON}
            YLR313C (REAL)
          Length = 528

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 6/52 (11%)

Query: 1109 NLKNNAPEEKIIPVI--SNEH--ICTMESHTINNNPVKES--VDMLSNEESP 1154
            NLK  +P +K +P+I  S +H  +  + SHTIN +PV+ +   D+L++ + P
Sbjct: 410  NLKVPSPPDKALPLIGQSRQHHRLSPLNSHTINKSPVETTKQTDILTSSDVP 461

>Suva_10.409 Chr10 complement(721432..723384) [1953 bp, 650 aa] {ON}
            YLR313C (REAL)
          Length = 650

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 6/52 (11%)

Query: 1109 NLKNNAPEEKIIPVI--SNEH--ICTMESHTINNNPVKES--VDMLSNEESP 1154
            NLK  +P +K +P+I  S +H  +  + SHTIN +PV+ +   D+L++ + P
Sbjct: 410  NLKVPSPPDKALPLIGQSRQHHRLSPLNSHTINKSPVETTKQTDILTSSDVP 461

>Skud_9.31 Chr9 (70769..71950) [1182 bp, 393 aa] {ON} YIL136W (REAL)
          Length = 393

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 14/143 (9%)

Query: 48  NADNDSTDLQTLHEQLNNI----TLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKL 103
           NA ++ +D Q   ++L  I      +YN+    + Q+A++++        E       +L
Sbjct: 241 NASSEPSDAQKRLDELKKIKEKGWFRYNKGEQSEEQIAERVARG-----LEGWGETAAQL 295

Query: 104 ELEKMSITYNSLESKNRELESDLS-AMNDNENTLHDEEQYKNQCLNREVINLKNDILIL- 161
             ++M     + E+  ++L+ ++S AM+       D +QY +         + +D   L 
Sbjct: 296 SRDEMDDLRWNYENSKKQLDKNMSDAMDSLSKAKEDLKQYGSHWWAGWTSKVDSDKQALK 355

Query: 162 ---ETKYDKLLKGYNDTKDNLKE 181
              + KYD  LK Y+D K+  KE
Sbjct: 356 DEAQKKYDDALKKYDDAKNKFKE 378

>TDEL0F03560 Chr6 complement(652087..654153) [2067 bp, 688 aa] {ON}
            Anc_3.471 YGR119C
          Length = 688

 Score = 32.3 bits (72), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 13/73 (17%)

Query: 1175 TQPSVTSSFTFSPLAMENPFTSPNNAKTPTSSFGMKPAFSFGSNPFTSNTNSLGTKM--- 1231
            ++P+  S+F+F   A  N  T P   +T T        FSFGSN   +NT   GT +   
Sbjct: 23   SKPAGNSTFSFGQGAANN--TQPQQ-QTGT-------GFSFGSNNQQNNTTGAGTGLFGG 72

Query: 1232 STPDSNSTGGLFS 1244
            S P+++++GGLF 
Sbjct: 73   SQPNNSTSGGLFG 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,818,248
Number of extensions: 6812263
Number of successful extensions: 54616
Number of sequences better than 10.0: 3704
Number of HSP's gapped: 51318
Number of HSP's successfully gapped: 7195
Length of query: 1284
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1163
Effective length of database: 39,606,813
Effective search space: 46062723519
Effective search space used: 46062723519
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 72 (32.3 bits)