Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E002105.703ON54454427610.0
Smik_9.195.703ON57255412871e-172
Suva_9.385.703ON56955412861e-172
TDEL0B021705.703ON56754412841e-171
YIL150C (MCM10)5.703ON57155412781e-170
Kpol_1043.715.703ON58553712641e-168
ZYRO0G06578g5.703ON56954812491e-166
Skud_9.185.703ON57155312491e-166
NCAS0G002205.703ON59253812051e-159
CAGL0H06589g5.703ON58356111581e-152
NDAI0F002805.703ON61057311361e-149
KAFR0D022105.703ON58456311271e-148
TBLA0G010205.703ON59456611121e-145
KNAG0L021505.703ON6165949971e-128
KLTH0E01034g5.703ON5834709811e-126
SAKL0E14938g5.703ON5745539631e-123
Kwal_55.196915.703ON4664829351e-120
AFR287W5.703ON6114948971e-113
KLLA0A00572g5.703ON5775417458e-91
CAGL0L02629g8.67ON79590840.13
TBLA0H005608.442ON221634733.1
Smik_4.7713.87ON36132697.9
AAL013W1.403ON49064689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00210
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...  1068   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   500   e-172
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   499   e-172
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   499   e-171
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   496   e-170
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   491   e-168
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   485   e-166
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   485   e-166
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   468   e-159
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   450   e-152
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   442   e-149
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   438   e-148
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   432   e-145
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   388   e-128
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   382   e-126
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   375   e-123
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   364   e-120
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   350   e-113
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   291   8e-91
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    37   0.13 
TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {...    33   3.1  
Smik_4.771 Chr4 (1358284..1359369) [1086 bp, 361 aa] {ON} YDR494...    31   7.9  
AAL013W Chr1 (318501..319973) [1473 bp, 490 aa] {ON} Syntenic ho...    31   9.2  

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score = 1068 bits (2761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/544 (95%), Positives = 521/544 (95%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVSN 60
           MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVSN
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVSN 60

Query: 61  ANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEY 120
           ANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEY
Sbjct: 61  ANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEY 120

Query: 121 SRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIK 180
           SRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIK
Sbjct: 121 SRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIK 180

Query: 181 LTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKG 240
           LTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKG
Sbjct: 181 LTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKG 240

Query: 241 NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQF 300
           NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQF
Sbjct: 241 NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQF 300

Query: 301 RSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPI 360
           RSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPI
Sbjct: 301 RSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPI 360

Query: 361 NSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVGNSKLL 420
           NSKRHHFSSSNSAKAFFDEDFQNPDMLVNLEN           VMLQRALRESVGNSKLL
Sbjct: 361 NSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNSKLL 420

Query: 421 LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXXXXXXXXNA 480
           LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSAD            NA
Sbjct: 421 LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKSTQSKLQKQKSNA 480

Query: 481 MENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDD 540
           MENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDD
Sbjct: 481 MENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDD 540

Query: 541 LEII 544
           LEII
Sbjct: 541 LEII 544

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  500 bits (1287), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 265/554 (47%), Positives = 349/554 (62%), Gaps = 32/554 (5%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEA---KV 57
           M+RLK K+  +K  DPNF  I++ +SP K +    +  N +     +E  N NE+   ++
Sbjct: 41  MERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQ-NAVKQVTRLETSNANESNLSQI 99

Query: 58  VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117
                LP NTT+YFMQ F  AKK+E +Q+ +++  M +RVH+F   N  KKY+ II  EL
Sbjct: 100 QKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDN--KKYKPIIANEL 157

Query: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177
           E +S   + KRY+P++++ + LH IKILRL KLFAK+RPPKF  P+YANWA  G+I  K 
Sbjct: 158 EGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKS 217

Query: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237
           DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GDII ILNPEVLPWRP 
Sbjct: 218 DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS 277

Query: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N KT  KC +PIN S    CDYH+E
Sbjct: 278 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHRE 337

Query: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357
           +QFR  +AKR+EL+G YALGAPT+++S+P+LY++K        N FNI+ D R    +E 
Sbjct: 338 VQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGE------NRFNIIRDARKGLSEEE 391

Query: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRAL------R 411
           + +    H+F++SNSAKAFFDE FQNPDML NL+N             L R L      +
Sbjct: 392 ERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRK 451

Query: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DXXXX 470
           ES G     L+DKS+ E Q M+ TT+  LQ G IQ+LGFDPT G+I  VL+ S       
Sbjct: 452 ESSG-----LEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESK 506

Query: 471 XXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530
                     + +L+ +KK  V L PS+    +K +HRE+ + ++      AE     SA
Sbjct: 507 NNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASA 566

Query: 531 STKNDTDSDDLEII 544
           S        DLEII
Sbjct: 567 S--------DLEII 572

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  499 bits (1286), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 263/554 (47%), Positives = 349/554 (62%), Gaps = 35/554 (6%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV--NPNEAKVV 58
           M+RLK K++ +K  DPNF  +++ +SP KK        +   LK+ +  V  N NE+ + 
Sbjct: 41  MERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI---VKKSQDALKQAIRPVASNINESMLS 97

Query: 59  SNAN-LPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117
             +   P+NTT+YFMQ F  AK+ E KQ+ +Y+  M++RVH+F   N  K+Y+ II  EL
Sbjct: 98  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNEL 155

Query: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177
           E +S   + KRY+P+E++ + LH IKILRLNKLFAKIRPPKF EPDYANWA  G+I  K 
Sbjct: 156 ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 215

Query: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237
           DIK TSS+ PVKFF FTIT+FQH+LD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 216 DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 275

Query: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT   C +PIN +    CDYH+E
Sbjct: 276 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHRE 335

Query: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357
           +QFR   AKR+EL+G YALGAPT++DS+P+LYR+K        N FNIV   R    +E 
Sbjct: 336 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGE------NQFNIVRSTRKGLSEEE 389

Query: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRAL------R 411
           + +    H+F++SNSAKAFFDE FQNPDML NL++             L R L      +
Sbjct: 390 ERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRK 449

Query: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DXXXX 470
           +S G     L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S       
Sbjct: 450 DSSG-----LEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504

Query: 471 XXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530
                     + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K  
Sbjct: 505 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGS---------KET 555

Query: 531 STKNDTDSDDLEII 544
              +D    DLEI+
Sbjct: 556 EVASDASGSDLEIV 569

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  499 bits (1284), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/544 (46%), Positives = 369/544 (67%), Gaps = 17/544 (3%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVSN 60
           ++RLK+K++ + K DPNF  IQ++ SP KK +  +  V P   KR+++  N NE KV S 
Sbjct: 41  VERLKSKRQLKSK-DPNFDAIQVESSPVKKPAE-SIKVEPSRTKRVLDIENLNEKKVESR 98

Query: 61  ANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEY 120
           + +PANTTSYF+ NF  +KKEE K  +E Q+ +S RVH+F G + + K++++ VEE+EEY
Sbjct: 99  SQIPANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEY 158

Query: 121 SRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIK 180
           S   + +RY+ ++++ K LH +KILRL+KLFAKI+PPKF+EP Y+NWA  GII +K  +K
Sbjct: 159 SDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVK 218

Query: 181 LTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKG 240
            +SS  P+K+FKFT+T+FQ+ LD+++FG  GVE+YYNLRVGDI+ ILNPEVLPWRP  KG
Sbjct: 219 FSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKG 278

Query: 241 NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQF 300
           N IKSFNLRISH F CILEI +S+DI WC+  N+     C TPINK+K+  CD+H+E+QF
Sbjct: 279 NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQF 338

Query: 301 RSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPI 360
           RS +AKR+EL+G++ALGAPT++DS PALYR K+    +   NF ++ +       +N  +
Sbjct: 339 RSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHR---NFKVLPNHYQKSVGKNSDL 395

Query: 361 NSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVGNSKLL 420
                HFS+ N+AKAFF+++FQNPD+L NL++           ++LQ+ L+        +
Sbjct: 396 RG--IHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAI 453

Query: 421 LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXXXXXXXXNA 480
             +K +++ + +  TT+ATLQ+G IQ LGFDPT G+I  VL+++A               
Sbjct: 454 EIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKE 513

Query: 481 MENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDD 540
           + +L+ FKK  V LKP++EVLL++   RE+++          EN   KS +  +D+DS D
Sbjct: 514 VSSLLKFKKEHVELKPAKEVLLQRKRDRERAW---------QENFGDKSVNLSSDSDS-D 563

Query: 541 LEII 544
           +EI+
Sbjct: 564 IEIV 567

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  496 bits (1278), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 263/554 (47%), Positives = 347/554 (62%), Gaps = 33/554 (5%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKVVS- 59
           ++RLK K+E +K  DPNF  I++ +SP K +    +  N        E  N NE ++   
Sbjct: 41  VERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSH-NATQQGTKFEGSNINEVRLSQL 99

Query: 60  --NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117
                 PA+TT+YFM+ F  AKK E KQ+ +++  M++RVH+F+     KKY  II  EL
Sbjct: 100 QQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTD--EKKYVPIITNEL 157

Query: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177
           E +S   + KRY+P++++ + LH IKILRL KLFAKIRPPKF EP+YANWA  G+I  K 
Sbjct: 158 ESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKS 217

Query: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237
           DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 218 DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 277

Query: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT  KC +PIN S    CDYH+E
Sbjct: 278 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHRE 337

Query: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357
           +QFR  +AKR+EL+G YALGAPT++DS+P+LY++K        N FNI+   R    +E 
Sbjct: 338 VQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGE------NGFNIIKGTRKRLSEEE 391

Query: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRAL------R 411
           + +    H+F++SNSAKAFFDE FQNPDML NL+N             L R L      R
Sbjct: 392 ERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRR 451

Query: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS-ADXXXX 470
           ES G     L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S +     
Sbjct: 452 ESSG-----LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPK 506

Query: 471 XXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530
                     + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K  
Sbjct: 507 NNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS---------KET 557

Query: 531 STKNDTDSDDLEII 544
              +D  + DLEII
Sbjct: 558 KETSDGSASDLEII 571

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  491 bits (1264), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 253/537 (47%), Positives = 359/537 (66%), Gaps = 25/537 (4%)

Query: 15  DPNFTDIQIQRSPEKKKS-NPNTTVNPIPLKRLVEDVNPNEAKVVSNANLPANTTSYFMQ 73
           DPNF  +Q+  SP+K +      T  PI      E+ NPNE  +++  +    TTSYFM+
Sbjct: 55  DPNF--VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFME 112

Query: 74  NFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRYLPKE 133
            F  +KK+  ++V  Y   MSSRVH+F+G    K+++   V+EL++YS   +  RY+P +
Sbjct: 113 KFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVD 172

Query: 134 EVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVKFFKF 193
           E++  L +IKILRL KLFAK+RPPKF+EP Y+NW VTGII SK+DIK TSS  P K+FKF
Sbjct: 173 ELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKF 232

Query: 194 TITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE----FKGNSIKSFNLR 249
           TI++FQH LD+FIFG  GVEKYYNLRVGD++ ILNPE+LPWRP       G++IKSFNLR
Sbjct: 233 TISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLR 292

Query: 250 ISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANAKRVE 309
           ISHKFDCILEI  S+D+ WC   N      C TPINKSK+D C YH+E+QFR   + RVE
Sbjct: 293 ISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVE 352

Query: 310 LSGTYALGAPTQIDSRPALYRSKNTS-NLKPGNNFNIVADRRYMKKKENDPINSKRHHFS 368
           LSGTYALGAPT++D+RPALY+++ TS N +   ++N+V+D  Y K+K+++ + ++ HHFS
Sbjct: 353 LSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFS 412

Query: 369 SSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVGNSKLLLKDKSNQE 428
           + NSAKAFFDEDFQNPD+L NL++             L +AL+ +V        DK ++ 
Sbjct: 413 TMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTV--------DKESKN 464

Query: 429 IQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS-ADXXXXXXXXXXXXNAMENLVTF 487
            ++++N T ATLQ G +Q+LGFDPTGG++  V+  S ++             A+++L+TF
Sbjct: 465 FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTF 524

Query: 488 KKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDDLEII 544
           +K +VNLKPS++ L+++   R++++    K +   +    +S+   ND    DL+I+
Sbjct: 525 RKDTVNLKPSKDDLIKRRIDRQRNW----KKLFGKQ----QSSIDNNDDSGSDLKIL 573

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  485 bits (1249), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 256/548 (46%), Positives = 362/548 (66%), Gaps = 24/548 (4%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSN--PNTTVNPIPLKRLVEDVNPNEAKVV 58
           ++RL  KK + K LDPN + IQ++ SP+K  ++  P T     P +  V + N NE K  
Sbjct: 41  LQRLNVKKTNPKPLDPNLSHIQVESSPKKVTNSVLPPTVQQQEP-RGEVRNENLNELKAQ 99

Query: 59  SNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELE 118
           S   +PANTTS+F++ +  +K+++  +V+  +  +S+RVH+F GA    +Y+ I   ELE
Sbjct: 100 SQEQIPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELE 159

Query: 119 EYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKED 178
           E+S   ISKRY+PKEE      NIKILRL+KLFAK++PPKF+EP Y+NWAV G+I +K +
Sbjct: 160 EFSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGE 219

Query: 179 IKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEF 238
           +K TS+ +P K+FKFT+TNFQ+++D +IFG  GVE+YYNLRVGDII ILNP+VLPWRP  
Sbjct: 220 VKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG 279

Query: 239 KGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEM 298
               IKSFNLRISHKF+CILEI  S+D+ WC   N+     C  PINK K+D C+YH+E+
Sbjct: 280 TKAHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHREL 339

Query: 299 QFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS-NLKPGNNFNIVADRR-YMKKKE 356
           +FRS NAKRVELSGTYALGAPT+ID++PALYR  ++  NL    N+NI+ +       KE
Sbjct: 340 KFRSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQKNL----NYNIITNGADGGSNKE 395

Query: 357 NDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVGN 416
            +P++    HFS+ N+AKAFFDE FQNP+ L NLEN            +L R L++   N
Sbjct: 396 INPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK---N 452

Query: 417 SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXXXXXX 476
           S+L +K KS +EI  ++ TT++T+ +G ++ LGFDPT G+I  V  K             
Sbjct: 453 SELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVF-KHQRSDSDKKPLTE 511

Query: 477 XXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDT 536
             +++ +L++FKK +V LKPS+E+L+++   RE+ + ++  S              K+D+
Sbjct: 512 KDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGS----------GGDEKDDS 561

Query: 537 DSDDLEII 544
           DS DLEI+
Sbjct: 562 DS-DLEIV 568

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  485 bits (1249), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 256/553 (46%), Positives = 347/553 (62%), Gaps = 31/553 (5%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV--NPNEAKVV 58
           ++RLK K+E ++  DPNF  I++ +SP K   N N   +   +KR +     N N+ K+ 
Sbjct: 41  VERLKRKQEFKRAEDPNFEAIEVPQSPAK---NRNIMKSQNTMKRDMRPAASNINDLKLS 97

Query: 59  S---NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVE 115
                  LP+NTT YFMQ F  AK+ E KQ  +Y+  M++RVH+F      K+Y++ I  
Sbjct: 98  QLQQKQELPSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTD--KKEYRATIAN 155

Query: 116 ELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICS 175
           ELEE+S   + KRY+P++++ + LH IKILRL KLFAKIRPPKF EPDYANWAV G+I  
Sbjct: 156 ELEEFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISH 215

Query: 176 KEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWR 235
           K D+K TSS  P KFF FTIT+FQHTLD++IFG   VE+YYNLR+GD+I ILNPEVLPWR
Sbjct: 216 KSDVKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWR 275

Query: 236 PEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYH 295
           P  +GN IKSFNLRISH F CILEI  S+D+ WC  +NRK    C +PIN +    CDYH
Sbjct: 276 PSGQGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYH 335

Query: 296 KEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKK 355
           +E+QFR  +AKR+EL+G YALGAPT++D++P LYR+K        NNFN+V   R    +
Sbjct: 336 REVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYRAKGE------NNFNLVRSIRKTLSE 389

Query: 356 ENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESV- 414
           E + +    H+F +SNSAKAFFDE FQNPDML NL++             L R L + + 
Sbjct: 390 EEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMR 449

Query: 415 --GNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DXXXXX 471
             G+S   L+DK ++E Q ++ TT++ LQ G +Q+LGFDPT G+I  VL+ S        
Sbjct: 450 RKGSSG--LEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRN 507

Query: 472 XXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSAS 531
                    +++L+ +KK  V L PS+    +K  HRE+ + ++  S         K   
Sbjct: 508 KVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS---------KDTD 558

Query: 532 TKNDTDSDDLEII 544
             +D  + DLEI+
Sbjct: 559 EVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 246/538 (45%), Positives = 351/538 (65%), Gaps = 25/538 (4%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV-----NPNEA 55
           + R+K K+E +K LDPNF  +Q+  SP KK      T  P+ +K+   ++     NPNE 
Sbjct: 41  LNRIKEKQESKKLLDPNFQQLQVPCSPVKK----TETNVPVAMKKSTNEMEIPHENPNEL 96

Query: 56  KVVS-NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIV 114
           ++   +  LP+NTT+YFM+ F K+KKEE  ++++ +  M++RVH+F      ++++ I V
Sbjct: 97  RIREKSGQLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQV 156

Query: 115 EELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIIC 174
            E+EEYS   + KRY+P+ E+ K LHNIKILRL+KLFAK+RPPKFSEP Y+NWA  GII 
Sbjct: 157 NEIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIIS 216

Query: 175 SKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPW 234
           +K D K T++  P K+ KFT+T+FQH LD++IFG  GVE+YYNLRVGD+I ILNPEV PW
Sbjct: 217 AKGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPW 276

Query: 235 RPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDY 294
           RP  KG  IKSFNLRI+H F CILEI  SKD+ +C ++  + G  CNTPIN SK+D CDY
Sbjct: 277 RPSGKGQFIKSFNLRINHDFKCILEIGSSKDLGFC-KVTSRNGTLCNTPINMSKEDRCDY 335

Query: 295 HKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS---NLKPGNNFNIVADRRY 351
           H+E++FR  N+KR+EL+G++ALGAPT++++ P LYR KN     + K   NF++ A    
Sbjct: 336 HQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGS 395

Query: 352 MKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALR 411
           + K   D  + +  HFS++NSAKAFFDE FQNPDML NL +             + + L 
Sbjct: 396 INK---DQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELS 452

Query: 412 ESVGN-SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS---ADX 467
           +++GN +   L ++S  E++ M+  T+ TLQ+G IQ+LGFDPT G+I  VL  +    + 
Sbjct: 453 KAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEK 512

Query: 468 XXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHR----EQSFAQYKKSIIA 521
                      + + +L+ F+KS V L P+R  L+E+   R    +++F Q +K I A
Sbjct: 513 DTLSEQMSGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQKRKPISA 570

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/561 (44%), Positives = 339/561 (60%), Gaps = 41/561 (7%)

Query: 1   MKRLKAKKED--QKKLDPNFTDI------QIQRSPEKK----KSNPNTTVNPIPLKRLVE 48
           + RLK  K     K+LDPN  +I      ++ RSP+++    + N    V  +   +   
Sbjct: 47  ISRLKENKRKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAAN 106

Query: 49  D--VNPNEAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLS 106
           +   NPNE  +V        TTSYF   F  +K +E + V  YQQ MS+R H+F G+   
Sbjct: 107 NKKANPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSL 166

Query: 107 KKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYAN 166
              ++I  +ELE YS F+I KRY+PK+EV K LH IKILRLNKLFAK+RPP FSEP Y+N
Sbjct: 167 SDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSN 226

Query: 167 WAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFI 226
           W   G I SKED+KLT++  PVK+FKFT+T+F+H LD+++FG   VE+YYNLRVGDII +
Sbjct: 227 WVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAV 286

Query: 227 LNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINK 286
           LNPE+LPWRP    N IKSFNLRI H F+CILEI  S+D+ WCQ +N      CN+PIN 
Sbjct: 287 LNPEILPWRPSGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINT 346

Query: 287 SKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS-NLKPGNN--F 343
                C++H+E+Q RS  +KR+ELSG+YALGAPT++ ++P++Y+  N S N  P  +  F
Sbjct: 347 KTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMF 406

Query: 344 NIVADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXX 403
           +I       K++E +    + HHFS+  +AKAFFD+ FQ+P +L NLE+           
Sbjct: 407 SITG-HGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMD 465

Query: 404 VMLQRALRESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEK 463
             L +AL     N +   + K+ Q+++ +   T+ TLQ G IQ+LGFDP+GGQI  VL+K
Sbjct: 466 RNLLKAL-----NGEDASQSKNKQQVKEI---TEKTLQTGVIQRLGFDPSGGQIAKVLDK 517

Query: 464 SADXXXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAE 523
           S                + +L+ FKK  + LKPSRE+ LEK H RE   A +KK      
Sbjct: 518 SRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRRE---AIWKKHF---- 570

Query: 524 NRDRKSASTKNDTDSDDLEII 544
                     ND+DS DLEI+
Sbjct: 571 -------QDTNDSDS-DLEIV 583

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  442 bits (1136), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 246/573 (42%), Positives = 342/573 (59%), Gaps = 32/573 (5%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV---------- 50
           + RLK  KE QK+ DPNF ++QI  +PE+K +N  T+   I   R  ++           
Sbjct: 41  LGRLKELKERQKRRDPNFDEVQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGE 100

Query: 51  ---NPNEAKVVSNAN----LPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGA 103
              NPNE KV         LP+NTTSYFM+ F   KK+E  +    ++ + +RVH F G 
Sbjct: 101 RLPNPNELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGL 160

Query: 104 NLSKK-----YQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPK 158
           N S K     YQ     E+EEYS   I KRY+PK+E++    NIKILRLNKLFAK+RPPK
Sbjct: 161 NKSSKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPK 220

Query: 159 FSEPDYANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNL 218
           F EP Y+NW   GII  K  IK TSS  P K+FKFTI++F++ +DIFIF    VE+YYNL
Sbjct: 221 FEEPQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNL 280

Query: 219 RVGDIIFILNPEVLPWRPEF--KGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINR-K 275
           R+GDII ILNPEVLPWRP     G  IKSFNLRI+H + CI+E+ +SKD+ +C   N+  
Sbjct: 281 RIGDIIAILNPEVLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKIN 340

Query: 276 TGAKCNTPINKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKN-- 333
               C+TPI+ SK+D C YH+E++FR+  +KR+EL+G++ALGAP ++ ++P LYR+ N  
Sbjct: 341 ESGTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVP 400

Query: 334 TSNLKPGNNFNIVADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENX 393
              +  GN FN+V      K +       +R +FSS+NSAKAFFDE FQNPDML NL+  
Sbjct: 401 VRGVYHGNRFNVVKGSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTK 460

Query: 394 XXXXXXXXXXVMLQRALRESVGN--SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFD 451
                       L + L +++ N  S  L  +K+ +E   M++ T+ TLQ G IQ+LGFD
Sbjct: 461 RRKIADDKRSNYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFD 520

Query: 452 PTGGQIKVVLEKSADXXXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQS 511
           PT G+I  VL+   D              +++L+ FKK  V L P++E L+++ + RE+ 
Sbjct: 521 PTHGKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEV 580

Query: 512 FAQYKKSIIAAENRDRKSASTKNDTDSDDLEII 544
              ++K   + +    +  +   DT   DLEI+
Sbjct: 581 ---WQKHFGSGKRLAEQPLNDDVDTSESDLEIV 610

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  438 bits (1127), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 336/563 (59%), Gaps = 38/563 (6%)

Query: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLK---RLVE-DVNPNE-- 54
           ++RL  KK + ++ DPNFT +Q+  SP KK            LK   R  E + NPNE  
Sbjct: 41  LERLHRKKIEIERRDPNFTGVQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELC 100

Query: 55  -----AKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKY 109
                 K  +  N    +T YFM+ F  AK++E   +++++  M SRVH+F G     +Y
Sbjct: 101 LQQRFQKQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEY 160

Query: 110 QSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAV 169
           Q +IV+ELE+YS   I+KRY P   +   LH +KILRLNKLFAK+RPPKF EP Y+NW V
Sbjct: 161 QHVIVDELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVV 220

Query: 170 TGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNP 229
            GI+  K DIK T+S  P K+ KFT+T+F+H +D +IFG  GVE+YYNLR+GDII +LNP
Sbjct: 221 VGIVSDKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNP 280

Query: 230 EVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQ 289
           E+LPWRP  K N IKSFNLRISH + CILEI +S+D+A C  + R T  +C  PINK   
Sbjct: 281 EILPWRPSGKQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVD 340

Query: 290 DVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADR 349
             C+YH+EM+ R   +KR++LSG YALGAPT+++S+PALYR     N+K   NF +    
Sbjct: 341 RCCEYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKI-QNFKLTPSY 399

Query: 350 RYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRA 409
                   D    K   FS+ N+AKAFFD++FQNPDM+ NL+N            +L R 
Sbjct: 400 SQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRE 459

Query: 410 LRESVGNSKLLLKD-----KSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVL--- 461
           L       +LL KD     K+ +E++ M+ TT  TLQ+G  QK+GFDPTGG+I  +L   
Sbjct: 460 L------DRLLRKDQDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNK 513

Query: 462 EKSADXXXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIA 521
           E+S D              +++L+ FKK  + L PS+  LL K + RE+         + 
Sbjct: 514 ERSKDGEPKFLSQKDR--TVDDLMAFKKEYIILAPSKVDLLNKKNKREK---------VW 562

Query: 522 AENRDRKSASTKNDTDSDDLEII 544
            EN  +  ++  +++DS DLEI+
Sbjct: 563 QENFGQNKSNDNSESDS-DLEIV 584

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  432 bits (1112), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/566 (43%), Positives = 349/566 (61%), Gaps = 36/566 (6%)

Query: 2   KRLKAKKEDQKKLDPNF------------TDIQIQRSPEK-KKSNPNTTVNPIPLKRLVE 48
           +RL+ K++  + +DPNF            + IQ+  SPEK K+ +      P+  K    
Sbjct: 42  ERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGI 101

Query: 49  DVNPNEAKV---VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAG-AN 104
             NPNE K+   +  A++PA +T+YFM NF  +KK E +++++Y+  MS+RVHSF    N
Sbjct: 102 QDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTN 161

Query: 105 LSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDY 164
           L K+ Q I VEE E+YS   IS+RYL +E + + L +IKILRLNKLFAKIRPPKF  P Y
Sbjct: 162 LQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQY 221

Query: 165 ANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDII 224
           +NW   G+I  K   KLTSS TP K+FKFTI +FQ  + IF+F    + KYYNLRVGDII
Sbjct: 222 SNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDII 281

Query: 225 FILNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQ-QINRKTGAKCNTP 283
            ILNP + PWRP  +   IKSFNL I  K+DCI+EI +S+D+ WC   +  K G  C TP
Sbjct: 282 CILNPVIAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTP 341

Query: 284 INKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNF 343
           INK+K   C++H+E +FR+A AKR+EL+G++ALGAPT+ D+ P+LY+ K T+N+   N F
Sbjct: 342 INKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK-TNNIYSKNQF 400

Query: 344 NIVADRRYMKKKENDPINSKRH--HFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXX 401
           N+V  RR   +KE D   SK H  +F S+N AKAFF+++FQNPD++ NL++         
Sbjct: 401 NVV--RRRNARKEGD---SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK 455

Query: 402 XXVMLQRALRESV---GNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIK 458
               L + L +++    N    L+ KS ++++ MRN T+  +Q G ++ +G+DPT G++K
Sbjct: 456 RDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMK 515

Query: 459 VVLEKSADXXXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKS 518
            +++KS              NA+ +L+ FKK  VNLKP +  LL K   R++ + +Y   
Sbjct: 516 YLMKKS--NGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGD 573

Query: 519 IIAAENRDRKSASTKNDTDSDDLEII 544
             +  NRD   +S     D  DLEI+
Sbjct: 574 -QSKSNRDIILSS----GDDSDLEIV 594

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  388 bits (997), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/594 (37%), Positives = 333/594 (56%), Gaps = 71/594 (11%)

Query: 2   KRLKAKKEDQKKLDPNFT-DIQIQRSPEKKKSNPNTTVNPIPLKR--------------- 45
           KRLK K+   K  D N   D+Q+  SP+K+      +V+ I + R               
Sbjct: 43  KRLKLKRAHVKPTDLNLQLDVQVPSSPQKR------SVSAIDVARKRREEAEAIKKRNLS 96

Query: 46  ----LVEDVNPNEAKVVSNANLPAN--------TTSYFMQNFLKAKKEETKQVKEYQQKM 93
                 + VN NEA+    A L  +        TTSYF++ F ++KK E  +++  +  +
Sbjct: 97  LALNTAQKVNLNEARF---AQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETML 153

Query: 94  SSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAK 153
           S+RVH+F G +  K++Q   V ELE++S   ISKRY+PK+ + + L ++K+LRLNKLFAK
Sbjct: 154 SARVHTFQGVD--KEFQLEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAK 211

Query: 154 IRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVE 213
           +RPPKF EP Y+NWAV  II  K ++K T+SK P KF +FT+TNFQ  LD+F+FG AGV+
Sbjct: 212 VRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVK 271

Query: 214 KYYNLRVGDIIFILNPEVLPWRPEF---KGNSIKSFNLRISHKFDCILEIARSKDIAWCQ 270
           +YYNLR GDI+ +LNPE+LPWRP     +  SIKSFNL+I+HKF CILEI +S+D+ +C 
Sbjct: 272 RYYNLREGDIVAVLNPEILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCP 331

Query: 271 QINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYR 330
              + +  KC + IN ++   C+YH+E+Q R  ++KR++L+G +ALGAPT++ ++P L+R
Sbjct: 332 VTKKFSNEKCGSAINLARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFR 391

Query: 331 SKNTSNLKPGNNFNIVADRRYMKKKENDPINSKRHH---------------FSSSNSAKA 375
             +    +   +      +R+      +P  + RH                F+SSN+AKA
Sbjct: 392 EASGRFKQSARSLPRDQGKRFY----TEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKA 447

Query: 376 FFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVG-NSKLLLKDKSNQEIQSMRN 434
           FFD++FQNPDML NL+              L R L+  +  +      DK+  E+ +++ 
Sbjct: 448 FFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRKLKRLLSKDEDRATLDKNTAEMAALKR 507

Query: 435 TTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXXXXXXXXNAMENLVT----FKKS 490
           TT+  L  G IQ+LGFDPT G+   V++K               +  EN+V     +K+ 
Sbjct: 508 TTETALHTGLIQRLGFDPTHGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRD 567

Query: 491 SVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDDLEII 544
             NL PS      +L HR+Q   +  +     +     S    ND DSDDLEI+
Sbjct: 568 KCNLLPSE----TQLAHRKQHRREVWRETFGKKGTPVDSQPVDND-DSDDLEIV 616

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 295/470 (62%), Gaps = 17/470 (3%)

Query: 53  NEAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSI 112
           N++  V   N P+NTTSYF++NF+ A+K E ++++     +S RVH+F G +  K  Q +
Sbjct: 97  NDSIEVPWKNGPSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPV 156

Query: 113 IVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGI 172
            V+E E YS FNIS+RY+   E+ + +  IK+LRL KLF+K+RPPKF+EPDYANW   GI
Sbjct: 157 NVDEKELYSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGI 216

Query: 173 ICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVL 232
           I  K ++KLTSS  P K+FK T+T+F H LDI+IF    VEKYYNLRVGDII ILNP++L
Sbjct: 217 ISFKSEVKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDIL 276

Query: 233 PWRP------EFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINK 286
           PWRP      EF G  +KSFNL I H FDC+LEI  SKD+ +C+  N+ T   C  PIN+
Sbjct: 277 PWRPSQVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINR 336

Query: 287 SKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIV 346
           +  D C+YH++++FR  NA+RVEL+G+ +L +P +   + ALY    TS +K      ++
Sbjct: 337 AATDRCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALY---GTSGVK--RKLQLL 391

Query: 347 ADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVML 406
            D+   + ++ +  N+    FS+ N AKAFFD+ +QNPDML NLEN             L
Sbjct: 392 PDKHAPQAQDGESQNT--LFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTL 449

Query: 407 QRALRESVGNSKLL-LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA 465
           Q  L  ++G +      +KS +E + M++ T+  L +G ++ +GFDP  G+++ VL+   
Sbjct: 450 QNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGK 509

Query: 466 DXXXXXXXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQY 515
           +            + ++ +++FKKS+V+L PS+    ++L  REQ + ++
Sbjct: 510 N---VNSGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREH 556

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  375 bits (963), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/553 (38%), Positives = 326/553 (58%), Gaps = 28/553 (5%)

Query: 2   KRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKR---LVEDVNPNEAKVV 58
           +RL+   + +KK+DPNF+ +++ RSP K K       +     R        N NE +V 
Sbjct: 40  QRLQDISQRKKKIDPNFSGVEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQ 99

Query: 59  SNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELE 118
             A+L + +T YF QNF  +KK +  + +   + ++ RVH+F G +  ++Y  I V E E
Sbjct: 100 KKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEE 159

Query: 119 EYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKED 178
           E+S   ISKRY+  E+  K L   K+LRL KLFAK+RPP F+EP Y+NW   GII +K  
Sbjct: 160 EFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSS 219

Query: 179 IKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRP-- 236
           +K+T+   P ++F  T+T+F+HT++I++FG   VEKYYNL+VGDII +LNPE+ PWRP  
Sbjct: 220 VKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSK 279

Query: 237 -EFKGNS---IKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVC 292
            E + +S   IKSFNL I H F+ ILEI  S+D  +C   N+  G  C TPINKS +D C
Sbjct: 280 VEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRC 339

Query: 293 DYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYM 352
            YH+E+QFR  NAKR+EL+G  +L +PT+   +  LY  KN S       ++++ DR   
Sbjct: 340 YYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILY-GKNKS-----GKYDLLPDRYAP 393

Query: 353 KKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRE 412
           + +  D  N    +FS+ N+A+AFFD+D+QNPD L NL++            +LQ+ L++
Sbjct: 394 QTQSKDSQNV--LYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQ 451

Query: 413 SVGNSKL-LLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXX 471
            +G S   L K++++ +   +R  T   L++G I+K+GFDPT G++  VL+ ++      
Sbjct: 452 VIGKSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNS----KG 507

Query: 472 XXXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSAS 531
                  +A+E ++  KK  + LKPS+E L +K   RE+ +  + K     EN +    S
Sbjct: 508 LKEQAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFK---KEENPNPGVES 564

Query: 532 TKNDTDSDDLEII 544
           +  D+   +LEI+
Sbjct: 565 SDGDS---ELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  364 bits (935), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/482 (39%), Positives = 292/482 (60%), Gaps = 25/482 (5%)

Query: 72  MQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRYLP 131
           M+NF  ++K E  ++K   + + SRVH+F G   +K  + I VEE E  S   +S+RY+ 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 132 KEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVKFF 191
            +E+++ L +IKILRL KLF+K+RPPKF+EPDYANW   GI+C K  +K+TSS  P K+F
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 192 KFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRP------EFKGNSIKS 245
           K TIT+F H+LD+++F    VEKYYNLRVGDII ILN ++LPWRP      EF G S+KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 246 FNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANA 305
           FNL I   +DC+LEI  S+D+ +CQ  N+  G  C  PIN++  D CDYH+E++FR  NA
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 306 KRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPINSKRH 365
           +RVEL+G+ +L +P +   + ALY S            N++ D+   ++++ +  N+   
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVK-----RKLNLLPDKHAPQQQDRESQNT--L 293

Query: 366 HFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVG-NSKLLLKDK 424
           +FS+ N AKAFFD+ +QNPD+L NL++             LQ  L  ++G + +    +K
Sbjct: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEK 353

Query: 425 SNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXXXXXXXXNAMENL 484
           + QE + M+  T+ T+ +G ++ +GFDPT G+++ VL+   +              +  +
Sbjct: 354 TKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQ---VREI 410

Query: 485 VTFKKSSVNLKPSREVLLEKLHHREQSFAQY--KKSIIAAENRDRKSASTKNDTDSDDLE 542
           +  +K++V+L PS+    ++L  REQ + ++   K+   A N+        +D+   DLE
Sbjct: 411 IETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQ------IPSDSSDSDLE 464

Query: 543 II 544
           I+
Sbjct: 465 IV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  350 bits (897), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/494 (37%), Positives = 287/494 (58%), Gaps = 21/494 (4%)

Query: 60  NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEE 119
           +AN P  TTSYF + F +A+      ++  Q+ +  RV++F+  + + +Y +  V+E+E 
Sbjct: 129 SANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVET 186

Query: 120 YSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDI 179
           YS   I+KRY+P+E++ + LH+IK+LRL KLFAK+RPPKFSEPDYANW   G I  K D+
Sbjct: 187 YSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDV 246

Query: 180 KLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFK 239
           K TS + P K+F   IT+F + + I +FG   VEKYY LRVGD+I ILNPE+ PW+   K
Sbjct: 247 KSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAK 306

Query: 240 G------NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCD 293
                   + +SF L I H  +CILEI  SK++ +C  +N+  GA C  PINK K+ VC 
Sbjct: 307 TTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCS 366

Query: 294 YHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMK 353
           YH+E   RS NAKRVEL+G  +L APT+   + A Y ++N+   K G   ++ A R    
Sbjct: 367 YHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGA 426

Query: 354 KKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRES 413
           +++       R HF+S+N+ +A+FD D+ NPD+L NLE+             + + L   
Sbjct: 427 EQKF------REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480

Query: 414 VGNSKLLLKDKSNQE-IQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADXXXXXX 472
           +G +   +KD+ ++E +Q     T   ++ G ++ +GFDPTGG++  VL +         
Sbjct: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTV 540

Query: 473 XXXXXXNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSF-AQYKKSIIAAENRDRKSAS 531
                   + N    KK +++LKPS+E   +++  R + + + +K+  +A      ++A 
Sbjct: 541 REPSISEILAN----KKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQ 596

Query: 532 -TKNDTDSDDLEII 544
            +  D+  ++LEI+
Sbjct: 597 LSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  291 bits (745), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 192/541 (35%), Positives = 294/541 (54%), Gaps = 33/541 (6%)

Query: 15  DPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV-----NPNEAKVVSNANLPANTTS 69
           DPNF  I +  SP KK  N    +  I     V D+     N NE  V         TTS
Sbjct: 59  DPNFDSIDVPESP-KKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK-KLGTTS 116

Query: 70  YFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRY 129
           YF +        E + +K  ++ ++ RV++F G ++  +Y+ I V+E ++ S   I +RY
Sbjct: 117 YFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRY 175

Query: 130 LPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVK 189
           +P   + K   NIK+LRL KLF+K+R PKFSEPDY NW V GII  K + ++T+S  PVK
Sbjct: 176 VPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVK 235

Query: 190 FFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFKGN--SIKSFN 247
           FF  TI++FQ  L++  FG + VEKYY LR+GD+I ILNPE++P +    G   S  +F+
Sbjct: 236 FFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFS 295

Query: 248 LRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANAKR 307
           L++S   + ILE+  SK+   CQ   +  G  C  PINK   + C YHKE + R  +++R
Sbjct: 296 LKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRR 355

Query: 308 VELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPINSKRHHF 367
           VE+S + A+ AP     +  + +S++ +N K    +    D+ ++  +E     + R  F
Sbjct: 356 VEISSSVAMRAPVVKGYQQTIVKSQH-NNGKTSIRYQQNPDKPFV--REPAAAETNRFLF 412

Query: 368 SSSNSAKAFFDEDFQNPDMLVNLENXXXXXXXXXXXVMLQRALRESVGNSKLLL---KDK 424
           SS+N++ AFFD+D++NPD+L NL+N             L++ L+   G S  LL   +D+
Sbjct: 413 SSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLK---GLSDKLLSKKEDR 469

Query: 425 SNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKV-VLEKSADXXXXXXXXXXXXNAMEN 483
            NQE +  +  T +  Q+G   ++G+DPT G+  + +LE S +             A+ +
Sbjct: 470 VNQEAK--KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQL---AITD 524

Query: 484 LVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKNDTDSDDLEI 543
           +   KK +V+LKPS++ L EK+  R   F +  K   + E  D+   S      SDDLEI
Sbjct: 525 ICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKG--SQERLDKDEGS------SDDLEI 576

Query: 544 I 544
           I
Sbjct: 577 I 577

>CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa]
           {ON} similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009w CDC4 cell division control
          Length = 795

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 195 ITNFQHTLDIFIFGAAGVEKYYNLRVGDIIF--ILNPEVLPWRPEFKGNSIKSFNLRISH 252
           IT F  T +I + G+ G    YNLR G +I   ILN     W   FKGN + +   +   
Sbjct: 668 ITTFYMTDNILVSGSEGQFNIYNLRTGKLIHSNILNDADQIWSVNFKGNILVAAVEKDGQ 727

Query: 253 KFDCILEIARSKDIAWCQQINRKTGAKCNT 282
            F  IL+ ++ K + +   ++ +   +C T
Sbjct: 728 SFVEILDFSK-KQVTFSSALHNENQVECVT 756

>TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {ON}
            Anc_8.442 YDR227W
          Length = 2216

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 483  NLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYK 516
            N V  K S++N++ +R +LL ++H  EQS + YK
Sbjct: 1233 NKVYTKTSTINIEGNRRILLSQIHGPEQSLSNYK 1266

>Smik_4.771 Chr4 (1358284..1359369) [1086 bp, 361 aa] {ON} YDR494W
           (REAL)
          Length = 361

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 117 LEEYSRFNISKRYLPKEEVSKCLHNIKILRLN 148
           LE Y R +  K    KE VSK LHN +I+RL+
Sbjct: 301 LEPYGRTDFEKLTKSKEAVSKLLHNSQIVRLS 332

>AAL013W Chr1 (318501..319973) [1473 bp, 490 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL017C (NFS1)
          Length = 490

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 334 TSNLKPGNNFNIVADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQ------NPDML 387
           TS     NN  +    R+ KK++N  I ++  H     +A++  DE F       N D L
Sbjct: 158 TSGATESNNMALKGVARFYKKRKNHIITTRTEHKCVLEAARSMKDEGFDVTFLNVNEDGL 217

Query: 388 VNLE 391
           V+LE
Sbjct: 218 VSLE 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,374,385
Number of extensions: 2675261
Number of successful extensions: 10903
Number of sequences better than 10.0: 75
Number of HSP's gapped: 11323
Number of HSP's successfully gapped: 75
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)