Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E002005.705ON85854274e-56
TBLA0G010305.705ON89742894e-35
Skud_11.3355.705ON94792704e-32
TDEL0B021505.705ON91742688e-32
Suva_11.3325.705ON111782645e-31
Kpol_YGOB_1043.725.705ON88712601e-30
KLTH0E00990g5.705ON89732592e-30
KAFR0H001905.705ON82742582e-30
NCAS0A031805.705ON88732574e-30
YKR095W-A (PCC1)5.705ON88742504e-29
ZYRO0B16368g5.705ON85742471e-28
Kwal_YGOB_Anc_5.7055.705ON88732471e-28
Smik_11.3595.705ON88742452e-28
KLLA0A00539g5.705ON87742444e-28
KNAG0C066205.705ON101732436e-28
SAKL0E14982g5.705ON89732411e-27
Ecym_40165.705ON125732413e-27
NDAI0E050605.705ON86782236e-25
AFR289W5.705ON81772062e-22
CAGL0G02535g5.705ON140531685e-16
KAFR0A028508.844ON104251650.67
CAGL0I01474g1.475ON59343594.4
NDAI0E046207.442ON103131586.4
NDAI0B036302.271ON51050578.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00200
         (85 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   169   4e-56
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   115   4e-35
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   108   4e-32
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   107   8e-32
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   106   5e-31
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   104   1e-30
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   104   2e-30
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   103   2e-30
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   103   4e-30
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   100   4e-29
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   100   1e-28
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   100   1e-28
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...    99   2e-28
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    99   4e-28
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    98   6e-28
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...    97   1e-27
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    97   3e-27
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    91   6e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    84   2e-22
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    69   5e-16
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...    30   0.67 
CAGL0I01474g Chr9 complement(117899..119680) [1782 bp, 593 aa] {...    27   4.4  
NDAI0E04620 Chr5 (1046665..1049760) [3096 bp, 1031 aa] {ON} Anc_...    27   6.4  
NDAI0B03630 Chr2 (910631..912163) [1533 bp, 510 aa] {ON} Anc_2.2...    27   8.7  

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  169 bits (427), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MFKKQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRV 60
          MFKKQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRV
Sbjct: 1  MFKKQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRV 60

Query: 61 LRVGVSNVIDSIKTIIETIDELQDF 85
          LRVGVSNVIDSIKTIIETIDELQDF
Sbjct: 61 LRVGVSNVIDSIKTIIETIDELQDF 85

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/74 (72%), Positives = 67/74 (90%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          LNIPF TSKQA IA QVL+PDP LRP++F+V Y+S+G++LV+ FQS+DDRVLRVGVS+VI
Sbjct: 16 LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRVGVSSVI 75

Query: 70 DSIKTIIETIDELQ 83
          DS+KTIIET DEL+
Sbjct: 76 DSVKTIIETFDELE 89

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 68/79 (86%)

Query: 4  KQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRV 63
          +Q  ++L IPFET  QASIA +VL PDP L+P++F+VDYSS+ + ++V F+S+DDRVLRV
Sbjct: 15 EQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRV 74

Query: 64 GVSNVIDSIKTIIETIDEL 82
          GVS+VIDSIKTI+ETIDEL
Sbjct: 75 GVSSVIDSIKTIVETIDEL 93

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  107 bits (268), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (87%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
          KL IPF+T+ QA+IA QVL PDP L+P++F+VDY++  + LVV FQS+DDRVLRVGVS+V
Sbjct: 8  KLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRVGVSSV 67

Query: 69 IDSIKTIIETIDEL 82
          IDSIKTI+ETIDEL
Sbjct: 68 IDSIKTIVETIDEL 81

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  106 bits (264), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (84%)

Query: 5   QSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVG 64
           Q+  +L IPFET KQA+IA +VL PDP L+P++F+ DYSS+ + ++  F+S+DDRVLRVG
Sbjct: 33  QNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVG 92

Query: 65  VSNVIDSIKTIIETIDEL 82
           VS+VIDSIKTIIET+DEL
Sbjct: 93  VSSVIDSIKTIIETMDEL 110

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  104 bits (260), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 63/71 (88%)

Query: 12 IPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVIDS 71
          IPFET++QA IA QVLKPDP L+P++F+V YSS  + L++ F+S+DDRVLRVGVS+VIDS
Sbjct: 17 IPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVIDS 76

Query: 72 IKTIIETIDEL 82
          +KTIIET+DEL
Sbjct: 77 VKTIIETMDEL 87

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 62/73 (84%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          L +PF+T+KQA  A +VLKPDP L+P++F V+YSS+  +L V+F+ VDDRVLRVGVS+VI
Sbjct: 15 LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVSSVI 74

Query: 70 DSIKTIIETIDEL 82
          +SIKTIIETIDE 
Sbjct: 75 ESIKTIIETIDEF 87

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  103 bits (258), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 62/74 (83%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
          KL IPFE +KQA+IA  VLKPDP LRP++F+V Y ++ +  V  F+S+DDRVLRVGVSNV
Sbjct: 8  KLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRVGVSNV 67

Query: 69 IDSIKTIIETIDEL 82
          IDS+KTIIET+DEL
Sbjct: 68 IDSLKTIIETMDEL 81

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  103 bits (257), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 63/73 (86%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          L IPF TS+QA IAA+VL PDP L+P++F+V+Y SQ + L V+F+ +DDRVLRVGVS+VI
Sbjct: 15 LEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVI 74

Query: 70 DSIKTIIETIDEL 82
          DSIKTIIETIDEL
Sbjct: 75 DSIKTIIETIDEL 87

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  100 bits (250), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 64/74 (86%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
          +L IPFET +QA+IA +VL PDP L+P++F+VDYSS+ + ++V F+S+DDRVLRVGVS++
Sbjct: 14 ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSI 73

Query: 69 IDSIKTIIETIDEL 82
          IDSIKTI+E +D L
Sbjct: 74 IDSIKTIVEAMDVL 87

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 62/74 (83%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
           L IPF   + + +A +VL+PDP LRPE+F+V+Y S+G+ L ++F+SVDDRVLRVGVS+V
Sbjct: 9  HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVSSV 68

Query: 69 IDSIKTIIETIDEL 82
          IDS+KTI+ETIDEL
Sbjct: 69 IDSVKTIVETIDEL 82

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          L +PF+  KQA+ A QVLKPDP L+P++F V+Y+S  ++L V F+ VDDRVLRVGVS+VI
Sbjct: 15 LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVSSVI 74

Query: 70 DSIKTIIETIDEL 82
          +SIKTI+ETIDE 
Sbjct: 75 ESIKTIVETIDEF 87

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score = 99.0 bits (245), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 64/74 (86%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
          +L +PF+T +QA IA +VL PDP L+P++F++DYSS+ + ++V F+S+DDRVLRVGVS+V
Sbjct: 14 ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSV 73

Query: 69 IDSIKTIIETIDEL 82
          IDSIKT++E +DEL
Sbjct: 74 IDSIKTVVEAMDEL 87

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 98.6 bits (244), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 63/74 (85%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
           L IPFE+ KQA +A +VL PDP ++PE+F+V YS+Q + L+ +F+SVD+R+LRVGV++V
Sbjct: 13 HLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSV 72

Query: 69 IDSIKTIIETIDEL 82
          I+SIKTI+ETIDEL
Sbjct: 73 IESIKTIVETIDEL 86

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 98.2 bits (243), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          LN+PFET +QA IA+QVL+PDP L+P++F V Y++QG  L   F   D RVLRVGVS+VI
Sbjct: 17 LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRVGVSSVI 76

Query: 70 DSIKTIIETIDEL 82
          DS+KTIIE++DEL
Sbjct: 77 DSLKTIIESLDEL 89

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score = 97.4 bits (241), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
          L IP ET  QA IA + LKPDP L+PE+F+V+YS+    L V+F+S+DDRVLRVGVS+VI
Sbjct: 15 LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVI 74

Query: 70 DSIKTIIETIDEL 82
          +S+KTIIET+DE 
Sbjct: 75 ESVKTIIETMDEF 87

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 97.4 bits (241), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 57/73 (78%)

Query: 10  LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69
           L +PFE  KQA IA +VL  DP LRPE+F+VDY+ Q   L+VNF S+D R LRVGVS+VI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 70  DSIKTIIETIDEL 82
           +SIKT++ET+DE 
Sbjct: 111 ESIKTVVETMDEF 123

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 90.5 bits (223), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 4/78 (5%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDY----SSQGSDLVVNFQSVDDRVLRVG 64
          ++ IPF   + A+IA QVL PDP L+PE+F+V+Y    +   + L+V FQS+D+RVLRVG
Sbjct: 9  EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVG 68

Query: 65 VSNVIDSIKTIIETIDEL 82
          VS+V+DSIKTI+ET+DEL
Sbjct: 69 VSSVLDSIKTILETMDEL 86

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 84.0 bits (206), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 56/77 (72%), Gaps = 1/77 (1%)

Query: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68
           L++PFE+++ A IAA+ L PDP LRPEE  V ++S G+ L +   ++D RVLRV  +++
Sbjct: 6  HLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVATNSI 65

Query: 69 IDSIKTIIETIDELQDF 85
           +++KT++ET DEL DF
Sbjct: 66 FEALKTVVETADEL-DF 81

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 69.3 bits (168), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 45/53 (84%)

Query: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLR 62
          L++PFET++ A IA +VL+PDP LRPE+F+V+Y ++ + L ++F+++DDRVLR
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score = 29.6 bits (65), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 35  PEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVIDSIKTIIETIDELQDF 85
           PE+ ++D+SS G    +N+ S D     V   N+  +IK + E  ++   F
Sbjct: 733 PEQLRIDFSSYGPTEQINYLS-DSHCCWVNFMNISSAIKLVEEATNDFDRF 782

>CAGL0I01474g Chr9 complement(117899..119680) [1782 bp, 593 aa] {ON}
           similar to uniprot|P47112 Saccharomyces cerevisiae
           YJR046w TAH11
          Length = 593

 Score = 27.3 bits (59), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 35  PEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVIDSIKTIIE 77
           P+ +KVDY+S G +L+VN    D   +    S  +D +K + E
Sbjct: 355 PQAYKVDYNSNG-ELMVNLPKKDPLAMLTNNSRKLDFVKKLEE 396

>NDAI0E04620 Chr5 (1046665..1049760) [3096 bp, 1031 aa] {ON}
          Anc_7.442 YBL106C
          Length = 1031

 Score = 26.9 bits (58), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 1  MFKKQSLEKLNIPFETSKQASIAAQVLKPDP 31
          MFK+  L+K++ PF++SK+A  A+      P
Sbjct: 1  MFKRTKLKKVSNPFKSSKKAEPASSSTTNSP 31

>NDAI0B03630 Chr2 (910631..912163) [1533 bp, 510 aa] {ON} Anc_2.271
           YIL104C
          Length = 510

 Score = 26.6 bits (57), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 7   LEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDY----SSQGSDLVVN 52
           + +L+ P  T+    +  ++LK D +  PE +  DY       G DLV+N
Sbjct: 187 INELDDPEHTNANDRVKERLLKEDSKFDPEYYVSDYMINKYGSGEDLVMN 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,232,290
Number of extensions: 284052
Number of successful extensions: 773
Number of sequences better than 10.0: 30
Number of HSP's gapped: 772
Number of HSP's successfully gapped: 30
Length of query: 85
Length of database: 53,481,399
Length adjustment: 57
Effective length of query: 28
Effective length of database: 46,945,437
Effective search space: 1314472236
Effective search space used: 1314472236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)