Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E001905.706ON136198950600.0
Kpol_1043.735.706ON126099231700.0
ZYRO0B16412g5.706ON1372100126300.0
TDEL0B021405.706ON114799325870.0
KNAG0C066305.706ON1281102024480.0
KAFR0H001805.706ON124198924420.0
NCAS0A031705.706ON1319106124120.0
Smik_11.3605.706ON118099023940.0
Suva_11.3335.706ON118798523820.0
SAKL0E15004g5.706ON1196101523660.0
Skud_11.3365.706ON118897522880.0
CAGL0G02541g5.706ON129598222960.0
YKR096W5.706ON119598822790.0
Kwal_55.196785.706ON117899222750.0
KLTH0E00968g5.706ON1148100022590.0
Skud_9.175.706ON1118100222260.0
YIL151C5.706ON1118100122180.0
AFR290W5.706ON1217101422200.0
Smik_9.185.706ON111899422020.0
Suva_9.375.706ON111799121830.0
Ecym_40155.706ON1257100221490.0
KLLA0A00528g5.706ON122999020730.0
CAGL0H06611g5.706ON128275017420.0
NDAI0E050705.706ON155638111211e-128
TBLA0E017105.706ON15264099861e-110
TPHA0D046405.706ON9625772171e-16
SAKL0G05610g5.558ON551138745.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00190
         (1361 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...  1953   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1225   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1017   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1001   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   947   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   945   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   933   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   926   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   922   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   915   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   885   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   889   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   882   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   880   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   874   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   862   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   858   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   859   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   852   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   845   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   832   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   803   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   675   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   436   e-128
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   384   e-110
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    88   1e-16
SAKL0G05610g Chr7 (458818..460473) [1656 bp, 551 aa] {ON} simila...    33   5.9  

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 1953 bits (5060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 939/989 (94%), Positives = 939/989 (94%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD
Sbjct: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NYITFITTAIHPTQPESDQQ            RRLWVYGTITFLDLLKNFSNFMDPEVCC
Sbjct: 433  NYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCC 492

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME
Sbjct: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN
Sbjct: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
            SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM
Sbjct: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFE                  T
Sbjct: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKT 732

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792
            MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ
Sbjct: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792

Query: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852
            YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR
Sbjct: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852

Query: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC 912
            RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC
Sbjct: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC 912

Query: 913  RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI 972
            RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI
Sbjct: 913  RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI 972

Query: 973  GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL 1032
            GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL
Sbjct: 973  GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL 1032

Query: 1033 NASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNG 1092
            NASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNG
Sbjct: 1033 NASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNG 1092

Query: 1093 DFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFNEC 1152
            DFISTSFFNSWSIKNLTNELSRNTCSSIT                    PMNELLVFNEC
Sbjct: 1093 DFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVFNEC 1152

Query: 1153 FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC 1212
            FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC
Sbjct: 1153 FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC 1212

Query: 1213 LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ 1272
            LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ
Sbjct: 1213 LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ 1272

Query: 1273 ITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRK 1332
            ITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRK
Sbjct: 1273 ITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRK 1332

Query: 1333 IKTFSTRFIFSMANYIRTMEEGHNKLAIN 1361
            IKTFSTRFIFSMANYIRTMEEGHNKLAIN
Sbjct: 1333 IKTFSTRFIFSMANYIRTMEEGHNKLAIN 1361

 Score =  555 bits (1431), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 276/294 (93%), Positives = 276/294 (93%)

Query: 1   MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDNVGQKRHGSNSYKYLQP 60
           MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDNVGQKRHGSNSYKYLQP
Sbjct: 1   MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDNVGQKRHGSNSYKYLQP 60

Query: 61  GIVKRRLAGNNNGDIHIQESSSNFDPKYSSFAYSRKDPINLTTVDAPFIDLRPYVTENTP 120
           GIVKRRLAGNNNGDIHIQESSSNFDPKYSSFAYSRKDPINLTTVDAPFIDLRPYVTENTP
Sbjct: 61  GIVKRRLAGNNNGDIHIQESSSNFDPKYSSFAYSRKDPINLTTVDAPFIDLRPYVTENTP 120

Query: 121 IASPKRNAIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVLSNPEILKATEPIIDDSMINN 180
           IASPKRNAIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVLSNPEILKATEPIIDDSMINN
Sbjct: 121 IASPKRNAIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVLSNPEILKATEPIIDDSMINN 180

Query: 181 ISLKNSLSRERSLNPGVNNIEDIFKIAASNFPSPXXXXXXXXXXXXXXXXXXGMAQNKIY 240
           ISLKNSLSRERSLNPGVNNIEDIFKIAASNFPSP                  GMAQNKIY
Sbjct: 181 ISLKNSLSRERSLNPGVNNIEDIFKIAASNFPSPENETMIMNNININSTTKNGMAQNKIY 240

Query: 241 SNESINKLNRKYNEELLPYSIIDNSSENQKSLNINNNDYRGNGSDSGQINNFDY 294
           SNESINKLNRKYNEELLPYSIIDNSSENQKSLNINNNDYRGNGSDSGQINNFDY
Sbjct: 241 SNESINKLNRKYNEELLPYSIIDNSSENQKSLNINNNDYRGNGSDSGQINNFDY 294

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1225 bits (3170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/992 (60%), Positives = 738/992 (74%), Gaps = 41/992 (4%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            VSVP RKSSQ LVQKLQDIYK I+KQE+ELQERC +LTNSQTTE+KNLW IY++N++L++
Sbjct: 307  VSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLIN 366

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY+TFITTA+ P+Q +SD              RRLWVYGTITFLD+LKNFSNFMDPEVCC
Sbjct: 367  NYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCC 426

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI HVFISIS+ML DIPQKY + W QKLGDLSRMA+AL+PS FIDWKLSAERWYMAAME
Sbjct: 427  QFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAME 486

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            ++YG+GKLYYHMSTVQQNTLEAFVNLGKS+FC+NTFVPSQQYLQLVI NIYQRA+AD N+
Sbjct: 487  YSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNS 546

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
            S+N RN QLLVDY+KH EV LLPNF ES +LQQVVL+YF++KFG+DYNN++  MF  R+M
Sbjct: 547  SSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQM 606

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            F+QNNDQ K ++R++ AFAE+QILQ+VGYGN K+PF+LLF                    
Sbjct: 607  FIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKN 666

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792
             ++ +      +    G         NVFL +E+FF NID +   +FMPNS+ +WN SL+
Sbjct: 667  QIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLK 726

Query: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852
            Y N  + KCSMIV +KFL+ P M+ALPH LPW YF+ISI LQ++K+++ AM EFW  F++
Sbjct: 727  YHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIK 786

Query: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC 912
            RIFPWNS+V+FLNVLLAYM+DNCW+ S LNELC  Y S++L+ELL  FN NE+LPEVWKC
Sbjct: 787  RIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKC 846

Query: 913  RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI 972
            RGSLWFD I EK N               N + Y   G+KDY+F DFP+DG +FDE+DEI
Sbjct: 847  RGSLWFDIIDEKRNSQ-------------NCDSYTECGIKDYQFLDFPVDGIEFDENDEI 893

Query: 973  GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL 1032
            G +FWKR+ RVIFLF+ + E + G G L +SY APV NRR     VN+    L+ +SFKL
Sbjct: 894  GIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRG--LGVNS---HLVGYSFKL 948

Query: 1033 NASSDGVMLDDIIES-FETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKN 1091
             A SD +M DD++ S FE  D  N D +  P+LSM+ G++IF+YVGYKR+  ++YSFDKN
Sbjct: 949  MAKSDDIMFDDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKN 1008

Query: 1092 GDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFNE 1151
            GD ISTSF+N+WSI            +  T                    PMNE  +FN+
Sbjct: 1009 GDLISTSFYNTWSI------------NQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNK 1056

Query: 1152 CFDPKYKTLEEFWSQEIYPD--SQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKF 1209
            CFDP+Y +++EFW++EIY D   +  + L   TYFILDATSWLRHFAH+YKIAT+ ILKF
Sbjct: 1057 CFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKF 1116

Query: 1210 AICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEF 1269
            +ICLTTFQELR+LRKSKD NVVEAATRAIITLRQL+ E  LLPLRFTGNVATHIEEHLEF
Sbjct: 1117 SICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEF 1176

Query: 1270 EEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAM 1329
            EEQITWRSHVDEFVIEAV+KAE KR ++        +      F I+LVTDD  MKNKA+
Sbjct: 1177 EEQITWRSHVDEFVIEAVIKAETKRKEQ--------EMHNMKGFQIVLVTDDSNMKNKAL 1228

Query: 1330 DRKIKTFSTRFIFSMANYIRTMEEGHNKLAIN 1361
            ++  KTFSTRF+F+++NY+RT++E   +LAIN
Sbjct: 1229 EKGSKTFSTRFVFAISNYLRTIDESKRQLAIN 1260

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 88/193 (45%), Gaps = 39/193 (20%)

Query: 31  KAMMQNNTSVEHDNVGQKRHGSNSYKYLQPGIVKRRLAGN--NNGDIHIQESSSNFDPKY 88
           K M   +T+    N+GQKRHGS+SY Y+ P  +K+R+A N  N+   +  +S SN     
Sbjct: 49  KQMNLQSTNQNTKNLGQKRHGSSSY-YITPNYIKKRVAKNSYNSATGNFLDSGSN----- 102

Query: 89  SSFAYSRKDPINLTTVDAPFIDLRPYVTENTPIASPKRNAIKKHQNNIAVTPQQSLVGND 148
                   D  N T++            +NTP+ASPK +  K +  N + TPQ + +  D
Sbjct: 103 -----GGGDISNQTSL------------QNTPLASPKPSIAKNNIINTSTTPQPTYITQD 145

Query: 149 IATL-------LSMDQKVLSNPEILKATEPIIDDSMINNISLKNSLSRERSLNPGVNNIE 201
             T        L  +  ++SN  +  +     D S IN  ++K+ + R  S+        
Sbjct: 146 SMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQDFSQINQ-AIKDKMMRPLSVR------N 198

Query: 202 DIFKIAASNFPSP 214
           D F    SNFPSP
Sbjct: 199 DSFVYQVSNFPSP 211

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1001 (52%), Positives = 664/1001 (66%), Gaps = 68/1001 (6%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            V VP ++SSQ LVQKLQDIYK IVKQEIELQERC +LT SQTTELKNLWTIY++NS+L++
Sbjct: 406  VVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLIN 465

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY+TF+TTA+ P+Q E D              RRLWVYGTITFLD+ KNFSNFMDPEVCC
Sbjct: 466  NYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCC 525

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI HVFISISNML DIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+
Sbjct: 526  QFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK 585

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            FTY HGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+ + NN
Sbjct: 586  FTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNN 645

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
             N+ RN QL ++Y+KH EV LLP+F ES +LQQVVL+YF  KFG D NN   N+F +RKM
Sbjct: 646  GNH-RNTQL-IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNV--NIFDTRKM 701

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            F QN D  + F+R++ AFAES ILQ+VG+G+ K+PF+LLFE                  +
Sbjct: 702  FCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKS 761

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792
              + + +               M       T E FF NI+T+ +P  +P++++IWN SL 
Sbjct: 762  TTVTETSSTMAIDDLEDEQSDRMS------TPEGFFGNIETLRFPYSVPSNLEIWNESLN 815

Query: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852
            Y N  S+KCSM+V +KFL  P ++ALPH +PW YFIIS+  ++    + +  +FWVEFV 
Sbjct: 816  YINMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVD 875

Query: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC 912
            RIFPWN+IV FLNVL+AYM+DN W+ S+++ LC  Y+SM L++LL YFN NE LPEVWKC
Sbjct: 876  RIFPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKC 935

Query: 913  RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI 972
             G+LWFDTI      NK+++         ++ D +  G+K++ F D PIDG  FD +DE 
Sbjct: 936  WGTLWFDTI-----CNKEQS---------HVEDLESVGIKNHMFLDAPIDGIAFDANDES 981

Query: 973  GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL 1032
            GE FWKRA R+IFLFK LAE++    G+ LS  APV+ RR D    +     L  FSFKL
Sbjct: 982  GENFWKRACRIIFLFKGLAENFPI--GITLSPVAPVYCRRNDVSPYHI----LKSFSFKL 1035

Query: 1033 NASSDGVM-----------------LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDY 1075
               SD  +                 L + +E FE     N      PMLS+++G+SIFDY
Sbjct: 1036 RRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDY 1095

Query: 1076 VGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXX 1135
             GY+R+ P+++S+DKNG+F+S S + SW   N TN                         
Sbjct: 1096 AGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTG-----------VIPAHGSDVDS 1144

Query: 1136 XXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHF 1195
                   + E+ +FN+  +P Y     F       D+    +    TYF+LD T+WLRHF
Sbjct: 1145 QRDAVQSVQEMHIFNQIMEPGY--CGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHF 1202

Query: 1196 AHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRF 1255
             HIYK+A+S +LKFAICLTTF ELR+LRK KD NVVEAATRAIIT+RQLY E  LLPLRF
Sbjct: 1203 GHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRF 1262

Query: 1256 TGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTD--------RLNDINMDTDE 1307
            TGNVATHIEEHLEFEE+ITWRSHVDEFVIEAV KA+ K  +              +   +
Sbjct: 1263 TGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHD 1322

Query: 1308 KEKSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
                +  ++LVTDD  M+ KA D+ ++TFST+F+FS+ N I
Sbjct: 1323 DRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSI 1363

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/993 (53%), Positives = 666/993 (67%), Gaps = 100/993 (10%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            V VP +KSSQ LVQKLQDIYK IVKQEIELQERC +LTNSQTTELK LW IY+VNS+L++
Sbjct: 229  VVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLIN 288

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY+TFITTA+ P Q + D              RRLWVYGTITFLD+LKNFSNFMDPEVC 
Sbjct: 289  NYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCA 348

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI HVFISISNMLADIP +Y + WYQ+LGDLSRMAIALYPS FIDWKLSAE WYM AM+
Sbjct: 349  QFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK 408

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            + YGHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQRA+ + NN
Sbjct: 409  YIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNN 468

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
             N+ RN Q L++Y+KH EV LLP+F ES +LQQVVL+YF DKFG+D N   NN+F +R+M
Sbjct: 469  GNH-RNSQ-LIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTN--ENNIFDTRQM 524

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            F QN DQ K F+R++ AFAES ILQ+VG+G+ K+PF+LLFE                   
Sbjct: 525  FDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPR---------------- 568

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEE--------------FFENIDTINYPS 778
               LK  + +   R   +++ T  ++ + +  EE              FF+NID++  P 
Sbjct: 569  --CLKDRRDKKEKRKTKSSVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPY 626

Query: 779  FMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKH 838
              P S+++WN SL+Y N  S+ CSMIV KKFL  P ++ALPH LPW YFII++V ++   
Sbjct: 627  LFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHI 686

Query: 839  KNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLT 898
             + A  EFW+E V RIFPWN+IV FLNVL+AY +DN      ++ LC   ++M LD+L+ 
Sbjct: 687  TDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVE 746

Query: 899  YFNENEELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFD 958
            +FN NE+LPEVWKC G LWFD I +K  +  D               Y+  G+KD+ F D
Sbjct: 747  HFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDS--------------YESAGIKDHMFLD 792

Query: 959  FPIDGTDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKV 1018
             PIDG  FD  DE G +FWKRA RVIFLFK++AE++     L++S +A V  RR D   +
Sbjct: 793  LPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQ--TRLVVSSQAQVHCRRTD--PM 848

Query: 1019 NTVCQELLEFSFKLNAS--SDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYV 1076
            N V   L  F FKL  +  +   +L + IE FE   + N D   TP LS+++ +SIF YV
Sbjct: 849  NHV---LKSFCFKLRDTFYNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYV 905

Query: 1077 GYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXX 1136
            GYKR+  +   +D+ G+F+STS + SW  +   NE+ ++  +                  
Sbjct: 906  GYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQ----------------- 948

Query: 1137 XXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGK-TYFILDATSWLRHF 1195
                   NE  +F E  +    +L EF     +P+ + N    GK T+F+LDATSWLRHF
Sbjct: 949  ---QQTANEADLFIEGIN---TSLTEF--NIDFPECKMN----GKDTFFVLDATSWLRHF 996

Query: 1196 AHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRF 1255
            AH+YK+A++++L+FAICLTTFQELR+LRKSKD NVVEAATRA+IT+RQLY EN +LPLRF
Sbjct: 997  AHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRF 1056

Query: 1256 TGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGI 1315
            TGNVATHIEEHLEFEEQITWRSHVDEFV EA+ KA+     RL+  N D          +
Sbjct: 1057 TGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQA----RLSQENRD-------FHHV 1105

Query: 1316 ILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
            +LVTDD  M+ KA    I T STRF+F+  N +
Sbjct: 1106 VLVTDDANMRRKAQQHAIHTLSTRFVFATCNAV 1138

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1020 (49%), Positives = 657/1020 (64%), Gaps = 81/1020 (7%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            RKSSQ LVQKLQDIYK IVKQEIELQERC +LT SQTTELKNLWTIY++N++L++NY TF
Sbjct: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+QP  D              RRLWVYGTITFLD+LKNFSNFMDPEVC QFI H
Sbjct: 345  ITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VFIS+S +L DIP K+ + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY H
Sbjct: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQR + D N   N R
Sbjct: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
            N   L+DY+KH EV LLP+F  S++LQQVVL YF D+FG+DY  S NN+F ++ MF Q  
Sbjct: 525  NPD-LIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDY--SENNIFDTQDMFFQPP 581

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILK 737
               + F+R++ AFAES ILQ+VG+GN K+PF+LLFE                  +     
Sbjct: 582  SCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTAD 641

Query: 738  I--TQPRLYHRWVGTTLPTMPNNNVFLTA----EEFFENIDTINYPSFMPNSVDIWNHSL 791
            +  T P+         +    N++  LTA     E+ +NI+T+ Y    P+ +  W  SL
Sbjct: 642  VSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD-ICTWIKSL 700

Query: 792  QYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFV 851
             + N  S+KCSMIV KKFLH P +IALPH LPW  FII+  +++++ +N    +FW   +
Sbjct: 701  DFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILM 760

Query: 852  RRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWK 911
            +RIFPW++I  FLNVLLAY++DN    +I+ ELC  Y+ M LD++L +FN++E+LPEVWK
Sbjct: 761  KRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWK 820

Query: 912  CRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDE 971
            C G+LW+D I  K++++ D               + G G+ D+ F DFPIDG +FD  DE
Sbjct: 821  CWGTLWYDAICNKNSVDADT--------------FAGFGIGDHMFLDFPIDGIEFDAEDE 866

Query: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFK 1031
             G +FWKRA RVIFLFK +++ +    GL +S+EA V+ R +           L  F+FK
Sbjct: 867  TGAKFWKRALRVIFLFKGISKKFD--FGLKISHEAGVYCRNE-----KAADSPLRRFTFK 919

Query: 1032 LNASSDGV--MLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFD 1089
            L +  +      ++ I   E    +N D   TP LS+V G++IF+Y+GY+ +  +  SFD
Sbjct: 920  LESYDEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFD 979

Query: 1090 KNGDFISTSFFNSW------------------SIKNLTNELSRNTCSSITXXXXXXXXXX 1131
            KNG+ +S+S + SW                  ++     +L+ N  + I+          
Sbjct: 980  KNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANG-TPISASLSAAGKTT 1038

Query: 1132 XXXXXXXXXXPMNELLVFNECF---DPKYK-------TLEEFWSQEIYPDSQTNISLQGK 1181
                       +NE  +F +     DP+ +       T + +  + ++  S   +  + K
Sbjct: 1039 TSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELD-RLK 1097

Query: 1182 TYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITL 1241
            T+FI DATSWLRHFAHIYKIAT+ +LKF +CLTTFQELR+LRKSKD NVVEAA RAIIT+
Sbjct: 1098 TFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITM 1157

Query: 1242 RQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDI 1301
            RQLY EN LLPLRFTGNVA  IEEHLEFEEQITWRSHVDEFVIEAV+KA++K T      
Sbjct: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFT-----T 1212

Query: 1302 NMDTDEKEKSIFG-------------IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
              +T + E+   G             + LVT+D  MK KA D+ IKTFST F+FS+ + +
Sbjct: 1213 AGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKL 1272

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/989 (50%), Positives = 644/989 (65%), Gaps = 58/989 (5%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            +K+S+VL++KLQ+IYK IVKQE+ELQ+RC +LT SQTTELKNLW+IY++N++L++NYITF
Sbjct: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+Q   D Q            RRLWVYGTITFLD+LKNFSNFMDPEVC QFI H
Sbjct: 338  ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VFIS+S ML D+P K+ + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY H
Sbjct: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQR + D N + N R
Sbjct: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
            N   L+DY+KH EV LLP+F E+++LQQVVL YF D+FGVDYN+  NN+F ++ MF Q  
Sbjct: 518  NSD-LIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYND--NNIFETQDMFFQVP 574

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFE-----XXXXXXXXXXXXXXXXXXT 732
               + ++R++ AFAES ILQ+VG+GN K+PF+LLF+                       +
Sbjct: 575  ASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEIS 634

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792
             + +     R      G  L T    N      E+F+NID++  P   PN + +W  SL+
Sbjct: 635  TMSIDTNDSR------GPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPN-ILVWLKSLE 687

Query: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852
            + N  S+KCS+IV +KFL  P +IALPH LPW YFII+  L+    KN +  +FW   +R
Sbjct: 688  HLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMR 747

Query: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFY-NSMSLDELLTYFNENEELPEVWK 911
            RI PWN++  FLNVLLAY++DN ++   + +LC  Y N  +  ELL YFN NE LPE+WK
Sbjct: 748  RILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWK 807

Query: 912  CRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDE 971
            C G+LWFD I  K  LN D               + G G++D+ F DFP+DG  FDE DE
Sbjct: 808  CWGTLWFDVISNKRALNADT--------------FNGLGIEDHMFLDFPLDGIGFDELDE 853

Query: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFK 1031
             GE FW RA R++FLFK +AE+     GL +S  APV  RR D+   N +   L  FSFK
Sbjct: 854  TGENFWNRALRIVFLFKGIAENLQ--TGLRVSRTAPVHCRR-DDIDPNHI---LKSFSFK 907

Query: 1032 LNASSDG-------VMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPN 1084
            +    +          ++ ++  FE  DE N D    PMLS+V G++IF+YVGYK++  N
Sbjct: 908  MEGFDESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLN 967

Query: 1085 FYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMN 1144
             +SFD+NG+ +S+S + +W I N  N L+ +  +  T                     M 
Sbjct: 968  NHSFDRNGELVSSSIYTAWVIDN-DNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMR 1026

Query: 1145 ELLV-------FN-ECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFA 1196
                       FN E +    K  +      I+  +   I+ +  TYF+ DATSWLRHFA
Sbjct: 1027 NFASNEDTEDDFNFELYMNPEKLNKNMDQASIWTTANDEIN-RNITYFVFDATSWLRHFA 1085

Query: 1197 HIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFT 1256
            HIYK++T+ +L FA+CLTTFQELR+LRKSKD NVV AA RAIIT+RQLY E  LLPLRFT
Sbjct: 1086 HIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFT 1145

Query: 1257 GNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGII 1316
            GNVAT IEEHLEFEEQITWRSHVDEFVIEAV+KA+ K       + +      K    ++
Sbjct: 1146 GNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESVTL-----RKGFNHVV 1200

Query: 1317 LVTDDITMKNKAMDRKIKTFSTRFIFSMA 1345
            LVTDDI MK KA ++ IKTF+T FIFS+ 
Sbjct: 1201 LVTDDINMKRKAQEQGIKTFTTHFIFSVC 1229

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1061 (49%), Positives = 670/1061 (63%), Gaps = 123/1061 (11%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            +K+ + LV+KLQDIYK IVKQEIELQERC +LT SQTT+LKNLWTIY+VN +L++NY+TF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+  +Q + D              RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VFIS+S MLADIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PSQQY+QLVI NIYQRA+ + NN NN R
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN-R 532

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFG------------VDYNNSSNN 665
            N Q L++Y+KH EV LLP F E+ ELQQVVL+YF +KFG            +  N  +NN
Sbjct: 533  NLQ-LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNN 591

Query: 666  -----MFISRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXX 720
                 MF SR MF+QN +Q K F+R++ AFAES ILQ+VG+G+ K+PF+LLFE       
Sbjct: 592  TRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKE 651

Query: 721  XXXXXXXXXXXTML---------------ILKITQPRLYHRWVGTTLPTMPNNNVFLTAE 765
                       +                 ++ I    +    +         N V  T+E
Sbjct: 652  RKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQV--TSE 709

Query: 766  EFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWC 825
            EFF+NI+ + +  F+PNS++IW  SL + N +S+KCSMIV KKFLH P +IALPH LPWC
Sbjct: 710  EFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 826  YFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCW--------- 876
            YFIISI+L+ +   +     FW+  ++ IFPWN I+ FLNVLL Y +DN           
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 877  -EQSILN----ELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIMEKSNLNKDK 931
             +Q  +N    +LC  Y++M   +LL +FNENE+LPEVWKC G+LWFDTI  K+ ++ D 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 932  NPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLA 991
                          ++  G+KD+ F DFPIDG  +   DE GE FWKR  R+IFLFK +A
Sbjct: 890  --------------FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIA 935

Query: 992  ESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQE--LLEFSFKLNASS----DGVMLDDI- 1044
            E++  L GL +SY A        EY+ N V  +  L  FSFK   S+    D  + D++ 
Sbjct: 936  ENFDSL-GLKVSYNAGT------EYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELE 988

Query: 1045 -------------IESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKN 1091
                         ++  E   E N +    P+ SM+  + IFDY GYK++ PN  SFDKN
Sbjct: 989  IYTNTIINRITEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKN 1048

Query: 1092 GDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFNE 1151
            G+F S S + +W +      L++N  ++                         + L F +
Sbjct: 1049 GEFSSGSIYTAWPMDYDQLILAQNNNNNTNATDEMTDLFTGTLSI--------DELSFRQ 1100

Query: 1152 CFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAI 1211
               P+++      S      + T    + KTYF+ DATSWLRHFAHIYK+A++ +LKFA+
Sbjct: 1101 LKRPEFRDKSTLLSS-----TSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAV 1155

Query: 1212 CLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEE 1271
            CLTTFQELR+LRKSKD NVVEA+TRAIIT+RQLY + NLLPLRFTGNVAT IEEHLEFEE
Sbjct: 1156 CLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEE 1215

Query: 1272 QITWRSHVDEFVIEAVLKAEEK-----------RTDRLNDINMDT-----DEKEKS-IFG 1314
            QITWRSHVDEFVIEAV+KA+EK            T    +I+  T     +E+EKS +F 
Sbjct: 1216 QITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFK 1275

Query: 1315 -IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEG 1354
             ++L+TDD +M+ KA  + I TF T+ +FS+ + +  ++EG
Sbjct: 1276 YVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMM-GIDEG 1315

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/990 (49%), Positives = 658/990 (66%), Gaps = 93/990 (9%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            ++S   L+QKLQ++Y+ IVKQEIELQERC +LTNSQTTELK+LWTIY++N+ELV+NY+TF
Sbjct: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+QP  D              RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VFIS+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++TY H
Sbjct: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 487

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
             + LL++Y+KH E  LLP+F ES +LQ VVL YFI+KFG+D N    N+F    MF+QN 
Sbjct: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGC--NIFNCEDMFIQNP 545

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILK 737
            D FK F+R+  +FA+S ILQIVG+G  K+PF++LFE                        
Sbjct: 546  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNN-DSS 604

Query: 738  ITQPRLYHRWVG--------TTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSV--DIW 787
            +T+    +   G        ++  +M + ++ +   EFF +IDT+  P  +P+ +  + W
Sbjct: 605  VTESSTGNSRNGNEDDDETMSSTTSMSDPDLLV---EFFNDIDTLRRP-ILPSMLTNEAW 660

Query: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847
              +L++ N  S+KC MIV +KFLH P  +ALPH LPW YFIISI L+ ++  +    EFW
Sbjct: 661  LETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFW 720

Query: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907
            +  ++R+FPW+++V F+NVL+AY++DN    SI+ +LC  Y+ ++L ELL  FNENE+LP
Sbjct: 721  IVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLP 780

Query: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967
            E+W C G+LWFD I +       KN   I+  D    +++  G++DY   D P DG  FD
Sbjct: 781  EIWGCWGTLWFDAICQ-------KNTHSISSED----NFQEIGIRDYMALDSPTDGIIFD 829

Query: 968  ESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLE 1027
            + DE GE+FWKRA R+IFLF++++ S+    G+I+ ++ P+ N      + N + ++L+ 
Sbjct: 830  DKDENGEKFWKRACRIIFLFREVSRSFP--LGVIVRHD-PLVN--CSSLQSNNILRDLV- 883

Query: 1028 FSFKLNA-----SSDGVM--LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKR 1080
              +KL       SS  V+  L+ I +  E   E+N D H  P LS+++GD+IF YVGYK+
Sbjct: 884  --YKLEPLTNIRSSVPVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKK 941

Query: 1081 VCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXX 1140
            + P++  FDKNG+F+S S + SW + N  N L  N   +                     
Sbjct: 942  LRPDYTCFDKNGEFLSASLYTSWYVPNCNNNLETNISYA--------------------N 981

Query: 1141 XPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYK 1200
               NE L F EC    +  +        YP+    I  +  TYF+ DATSWLRH A I+K
Sbjct: 982  ERENEAL-FLECMKSVHPEIA-------YPE----IDFK-TTYFVFDATSWLRHSARIFK 1028

Query: 1201 IATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVA 1260
            +A +++L+FAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY E+ +LPLRFTGNVA
Sbjct: 1029 LAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVA 1088

Query: 1261 THIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG-----I 1315
            THIEE+LEFEEQITWR+HVDEFVIE+++KA+EK            + K+ +I       +
Sbjct: 1089 THIEENLEFEEQITWRTHVDEFVIESIMKAQEKL----------ENAKQPNISSHRFNYV 1138

Query: 1316 ILVTDDITMKNKAMDRKIKTFSTRFIFSMA 1345
            +L++DD TMK KA ++KI+T STRF+FS+ 
Sbjct: 1139 VLISDDDTMKKKAEEKKIRTLSTRFVFSLC 1168

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/985 (50%), Positives = 642/985 (65%), Gaps = 88/985 (8%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            +KSS  L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIYR+N+ELV+NY+TF
Sbjct: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+QP+ D              RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 499

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
             + LL++Y+KH E  LLP+F ES +LQ VVL YF++KFG+D N    N+F    MF+QN 
Sbjct: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGC--NIFNPEDMFIQNP 557

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILK 737
            D FK F+R++ +FA+S ILQIVG+G  K+PF++LFE                        
Sbjct: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSI 617

Query: 738  ITQPRLYHR-------WVGTTLPTMPNNNVFLTAEEFFENIDTINYP---SFMPNSVDIW 787
                    R        + ++  ++   +  +   EFF +IDT+  P   S + N  + W
Sbjct: 618  TESSTSNSRNENDDNDEIMSSTTSISERDSLI---EFFNDIDTLRRPIVSSMLTN--EAW 672

Query: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847
              SL++ N  S+KC MIV +KFLH P  IALPH LPW YFIISI L+  +  +    EFW
Sbjct: 673  LESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFW 732

Query: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907
            +  V+RIFPW+++V F+N+L+A ++DN     I+  LC  Y+ ++L ELL  F E EELP
Sbjct: 733  IVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELP 792

Query: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967
            E+W C G+LWFDTI +       KN   I+  D    D++  G+KDY   D PIDG  FD
Sbjct: 793  EIWGCWGTLWFDTICQ-------KNTNSISSDD----DFEEVGIKDYMALDSPIDGIIFD 841

Query: 968  ESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLE 1027
             +DE GE+FWKRA R IFLF++L+ S+    G+I++ E+ +    +   + N +   L  
Sbjct: 842  VNDENGEKFWKRACRTIFLFRELSRSFQ--IGVIINNESSI---NRSSLQSNNILGNL-- 894

Query: 1028 FSFKLN-----ASSDGVM--LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKR 1080
             S+KL       SS   +  L+ II+ FET  E N D H  P LS++ G SIF+Y GYK+
Sbjct: 895  -SYKLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKK 953

Query: 1081 VCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXX 1140
            +CPN+  FDKNG+F+S S + SW + N +N    N  S+                     
Sbjct: 954  LCPNYTCFDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQ------------- 1000

Query: 1141 XPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYK 1200
                    F EC     + ++                    TYF+ DATSWLRH A I+K
Sbjct: 1001 --------FLECLKSDDREID-----------------LNTTYFVFDATSWLRHSARIFK 1035

Query: 1201 IATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVA 1260
            +A +++LKFAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+EN +LPLRFTGNVA
Sbjct: 1036 LAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1095

Query: 1261 THIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTD 1320
            THIEE+LEFEEQITWR+HVDEFVIE+++KA+EK  +  N + + +         +IL++D
Sbjct: 1096 THIEENLEFEEQITWRTHVDEFVIESIMKAQEK-LENANQLPVSSCRFNY----VILISD 1150

Query: 1321 DITMKNKAMDRKIKTFSTRFIFSMA 1345
            D TMK KA ++KIKT STRF+FS+ 
Sbjct: 1151 DDTMKKKAEEKKIKTLSTRFVFSLC 1175

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1015 (48%), Positives = 663/1015 (65%), Gaps = 79/1015 (7%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            V+VP + +SQ LVQKLQDIY++IVKQEIELQERC +LTNSQTT++KNLW IY+VN+EL++
Sbjct: 235  VNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELIN 294

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NYI+FITTA+ P+QPE D              RRLWVYGTITFLD+LKNFSNFMDPEVCC
Sbjct: 295  NYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCC 354

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI HVF+SISNML D+P +Y + W ++LGDLSRMAIALYPS FIDWKLSAE WY  A+ 
Sbjct: 355  QFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALI 414

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            +TYGHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+   
Sbjct: 415  YTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE--R 472

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
            S     +  +V+Y+KH EV LLP+F ES ELQ+VVL +F  +FGV  NN   + F  +++
Sbjct: 473  SGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNV--DFFDHKQI 530

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            F+Q+ ++ + F+ ++ AFAES ILQ+VG+G+ ++PF++LFE                   
Sbjct: 531  FIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPK---------------- 574

Query: 733  MLILKITQPRLYHRWVGTTLPTM---PNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNH 789
             L  +  +           LPT     N +  ++ + +FENID+   P   P  + IW  
Sbjct: 575  FLKERKERKERRRSKSSPPLPTNLDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQ 634

Query: 790  SLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVE 849
            SL Y N  S++CSM V KKFLHAP + ALPH LPW +F++S+ +++    + A+ +FW+ 
Sbjct: 635  SLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLV 694

Query: 850  FVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEV 909
            F+RRIFPWNS+V FLN L+A+++DN    S + +LC  YN M L  L+ +F  +EELPEV
Sbjct: 695  FMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEV 754

Query: 910  WKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDES 969
            WKC G+LWFDTI  KS L                +  +  G++D+ F D PIDG  FD+ 
Sbjct: 755  WKCWGTLWFDTISNKSELKA--------------SSVQSTGIRDHLFLDAPIDGICFDQD 800

Query: 970  DEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFS 1029
            DE G +FWKRA RVIF+FK +A+ +    G+ +S + P+  RR       T    L  FS
Sbjct: 801  DESGLKFWKRACRVIFMFKGMAKEFH--YGIRVS-DTPISTRRD-----VTTLHALKRFS 852

Query: 1030 FKLNAS----SDGVML--DDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCP 1083
            FK         + V L  D+ I+ FE    +N +    P LSM+DG+SIF++ GY+R+ P
Sbjct: 853  FKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYP 912

Query: 1084 NFYSFDKNGDFISTSFFNSWSIKNLTNE------LSRNTCSSITXXXXXXXXXXXXXXXX 1137
            ++Y F+KNGD I+ S + S  ++ +  +      + R+  + +                 
Sbjct: 913  DYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPE 972

Query: 1138 XXXXPMNELLVFNECFDPKY-KTLEE--FWSQEIYPDSQTNISLQGKTYFILDATSWLRH 1194
                   E    N C DP + ++L +  F   ++  ++ +N+     TYF+LDATSWLRH
Sbjct: 973  TMVE-YAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNV-----TYFVLDATSWLRH 1026

Query: 1195 FAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLR 1254
            FAH+YK+AT+ +LKFAICLTTFQELR+LRKSKD +VVEAATRA+IT RQLY+E  LLPLR
Sbjct: 1027 FAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLR 1086

Query: 1255 FTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK------RTDRLNDINMDTDEK 1308
            FTGN+ATH+EEHLEFEEQITWRSHVDEFVIEAV K++ K      +        + TD K
Sbjct: 1087 FTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPK 1146

Query: 1309 EKSIFG-IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEGHN-KLAIN 1361
            +   F  ++LVTDD+ M+ KA    I  FS+RF+F+  N +     G+N K+ IN
Sbjct: 1147 DDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQL-----GYNQKVCIN 1196

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 15/27 (55%)

Query: 40 VEHDNVGQKRHGSNSYKYLQPGIVKRR 66
            H  + QKRH SNSY Y   G  KRR
Sbjct: 25 ASHPTLHQKRHNSNSYDYYDSGYAKRR 51

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/975 (48%), Positives = 635/975 (65%), Gaps = 68/975 (6%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            ++SS  L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIYR+N+EL++NY+TF
Sbjct: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+QP  D              RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 500

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
             + LL++Y+KH E  LLP+F ES +LQ VV+ YF++KFG+D N    N+F    MF+QN 
Sbjct: 501  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGC--NIFNPEDMFIQNP 558

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFE----XXXXXXXXXXXXXXXXXXTM 733
            D FK F+R++ +FA+S ILQIVG+G  K+PF++LFE                      ++
Sbjct: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSV 618

Query: 734  LILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPN--SVDIWNHSL 791
                    R  +      + +  + +      EFF +IDT+  P  +P+  + + W  +L
Sbjct: 619  TESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRP-ILPSMLTSEAWLETL 677

Query: 792  QYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFV 851
            ++ N  S+KC MIV +KFLH P  IALPH LPW YFII+  L+ ++  +    +FW+  V
Sbjct: 678  KFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIV 737

Query: 852  RRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWK 911
            +R+FPW++IV F+NVL+AY++DN     I+ ELC  Y +++L  LL  FNE+EELPE+W 
Sbjct: 738  KRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWN 797

Query: 912  CRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDE 971
            C G+LWFDTI +       KN   I+  D    +++  G+KDY   D P DG  FD+ DE
Sbjct: 798  CWGTLWFDTICQ-------KNAHSISSDD----NFQEIGIKDYMALDAPTDGIIFDDKDE 846

Query: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPV-FNRRKDEYKVNTVCQELLEFSF 1030
             GE+FWKRA R+IFLF++L+ ++    G+I+S +  +  +  +    +  +  +L   S 
Sbjct: 847  SGEKFWKRACRIIFLFRELSRTFP--IGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSN 904

Query: 1031 KLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDK 1090
              + +     L++ ++  E   + N D +  P LS+  GD+IF Y GYK++ P++  FD+
Sbjct: 905  IRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDR 964

Query: 1091 NGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFN 1150
            NG+F+S S +  W + N  N       S I                           +F 
Sbjct: 965  NGEFLSASLYTRWYLPNGNNISEALVNSDIEKGDED---------------------LFL 1003

Query: 1151 ECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFA 1210
            EC  P    +          D +T       TYF+ DATSWLRH A I+K+A +++LKFA
Sbjct: 1004 ECMKPDCPGI----------DFET-------TYFVFDATSWLRHSARIFKLAQNRLLKFA 1046

Query: 1211 ICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFE 1270
            ICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+E+ +LPLRFTGNVATHIEE+LEFE
Sbjct: 1047 ICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFE 1106

Query: 1271 EQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMD 1330
            EQITWR+HVDEFVIE++ KA+EK    L +          S + ++L++DD TMK KA +
Sbjct: 1107 EQITWRTHVDEFVIESIKKAQEK----LENAGQPHVTPRHSNY-VVLISDDDTMKKKAEE 1161

Query: 1331 RKIKTFSTRFIFSMA 1345
            ++IKT ST+F+FS+ 
Sbjct: 1162 KEIKTLSTKFVFSLC 1176

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/982 (48%), Positives = 645/982 (65%), Gaps = 76/982 (7%)

Query: 379  KSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFI 438
            K +Q LVQKLQDIYK IV+QE+ELQE+C +LT+SQTT+L ++W+IYR+N ELV NY+TFI
Sbjct: 365  KPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFI 424

Query: 439  TTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHV 498
            +TA+  +Q + D              RRLWVYGTITFLD+LKNFS+FMDPEVC QFI HV
Sbjct: 425  STALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHV 484

Query: 499  FISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHG 558
            FISIS MLADIP KY + W Q+LGDLSRMAIALYPS FIDWKLS+E WY  A+++TYG+G
Sbjct: 485  FISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYG 544

Query: 559  KLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRN 618
            KLYYHMST+QQNTLEAFVNLGKS+FC++TF+PS QY+QLVI NIYQRA+ +   SNN RN
Sbjct: 545  KLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIE-RGSNNTRN 603

Query: 619  DQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNND 678
             Q L++Y+KH EV LLPNF  ++ LQ+VV+ YF  KFG D ++   N+F  R +F+QN +
Sbjct: 604  SQ-LIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDL--NIFQPRDIFLQNPE 660

Query: 679  QFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILKI 738
              K F+R++ AFAES ILQ VG+G+ K+PF+LLF+                  +      
Sbjct: 661  NLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTS 720

Query: 739  TQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVS 798
             +  +    + T        +  ++++++F N++++ +P   P   DIW  SL Y N  +
Sbjct: 721  NESVMSLDNIST--------DSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTA 772

Query: 799  IKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWN 858
            ++C +IV +KFLH PF++ALPH + W YFIIS+ L+ +   +     FW  F+RR+ P N
Sbjct: 773  VQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLN 832

Query: 859  SIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWF 918
            SIV FLNVL+AY +DN +  ++++ +    +SM L ELLT FN NEELPEVWKC G+LWF
Sbjct: 833  SIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWF 892

Query: 919  DTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWK 978
            D I +KSN               + N Y+  GV D+ FFD PIDG  FD  DE GE+FWK
Sbjct: 893  DAITDKSNT--------------DTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWK 938

Query: 979  RAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFK-----LN 1033
            RA R+IFLFKK+AE++    G+ LS+ APV+ RR D+ ++N +   L  FSFK     LN
Sbjct: 939  RALRIIFLFKKIAETFD--IGITLSHTAPVYCRR-DDVELNHI---LGSFSFKIEQHLLN 992

Query: 1034 ASSDGVMLDD----IIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFD 1089
             ++  V +++    IIE  E P+EVN     TP +S+ + ++IF+Y GYKR+ P   +FD
Sbjct: 993  GNTVQVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFD 1052

Query: 1090 KNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVF 1149
            KNG+  S + + SW       E+   + +S                      P N +   
Sbjct: 1053 KNGELRSAANYTSWYS---AQEIVPKSAAS----------------------PENSVAGS 1087

Query: 1150 NECFDPKYKTLEE-FWSQEIYPDSQTNISLQG----KTYFILDATSWLRHFAHIYKIATS 1204
            +     + + +EE  +S     +  +   L G     T F+LDATSWLRH AHIYK+A++
Sbjct: 1088 SPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWLRHSAHIYKLASN 1147

Query: 1205 KILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIE 1264
              L F+ICLTTFQELR+LRKSKD NV+EAA RAII +RQLY +  ++PLRFTGN+ATHIE
Sbjct: 1148 SFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIE 1207

Query: 1265 EHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITM 1324
            EHLEFEEQITWRSHVDEFVIE++ KA++K         +D D +       +LV+DD  M
Sbjct: 1208 EHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSR-----FFVLVSDDENM 1262

Query: 1325 KNKAMDRKIKTFSTRFIFSMAN 1346
            K KA +++I+TF+TRF+F++ +
Sbjct: 1263 KRKAHEKEIRTFTTRFVFALCS 1284

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/988 (49%), Positives = 638/988 (64%), Gaps = 93/988 (9%)

Query: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437
            ++S   L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIY++N++LV+NY+TF
Sbjct: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328

Query: 438  ITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497
            ITTA+ P+QP  D              RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388

Query: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448

Query: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 506

Query: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677
             + LL++Y+KH E  LLP+F ES +LQ VVL YFI+KFG+D N    N+F +  MFVQN 
Sbjct: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGC--NIFNAEDMFVQNP 564

Query: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILK 737
            D FK F+R+  +FA+S ILQIVG+G  K+PF++LFE                        
Sbjct: 565  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN----- 619

Query: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTA----------EEFFENIDTINYPSFMPNSV--D 785
                 +     G +     +++  +++           EFF +IDT+  P  +P+ +  +
Sbjct: 620  -NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRP-ILPSMLTNE 677

Query: 786  IWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNE 845
             W  +L++ N  S+KC +IV +KFLH P  IALPH LPW YFIISI L+  +  +    E
Sbjct: 678  AWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKE 737

Query: 846  FWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEE 905
            FW+  V+R FPW+++V F+NVL+ Y++DN    SI+ +LC  Y+ +SL ELL  FNE EE
Sbjct: 738  FWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEE 797

Query: 906  LPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTD 965
            LPE+  C G+LWFDTI E       KN   I+  D    +++  G+KDY   D P DG  
Sbjct: 798  LPEILGCWGTLWFDTICE-------KNTHSISSED----NFQEIGIKDYMALDSPTDGII 846

Query: 966  FDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQEL 1025
            FDE DE GE+FWKRA R IFLF++L+ S+    G+I+  +  ++   +  ++   +   L
Sbjct: 847  FDEKDENGEKFWKRACRTIFLFRELSRSFP--IGVIIRNDPLIY---RSSFQNTNILGSL 901

Query: 1026 LEFSFKL--------NASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077
            +   FKL        N    G  L+ II+  E   E N D H  P LS+ +GD+IF YVG
Sbjct: 902  V---FKLEPLCNIHNNIPVLGA-LESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVG 957

Query: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXX 1137
            YK++  ++  FDKNG+F+S S + +W + N  N    N   +I                 
Sbjct: 958  YKKLRADYTCFDKNGEFLSASLYTTWYVPNSNN---TNIEDNINYNSEKE---------- 1004

Query: 1138 XXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAH 1197
                  NE L F EC    Y  +          D +T       TYF+ DATSWLRH A 
Sbjct: 1005 ------NEGL-FLECIKSDYPEI----------DFKT-------TYFVFDATSWLRHSAR 1040

Query: 1198 IYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTG 1257
            I+K+A +++L+FAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+EN +LPLRFTG
Sbjct: 1041 IFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTG 1100

Query: 1258 NVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIIL 1317
            NVATHIEE+LEFEEQITWR+HVDEFVIE+V+KA+EK      +   +     +    ++L
Sbjct: 1101 NVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKL-----ESASEPRLSPRRFNYVVL 1155

Query: 1318 VTDDITMKNKAMDRKIKTFSTRFIFSMA 1345
            ++DD  MK KA +++IKT STRF+FS+ 
Sbjct: 1156 ISDDDAMKKKAEEKEIKTLSTRFVFSLC 1183

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/992 (48%), Positives = 642/992 (64%), Gaps = 71/992 (7%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            VS     +SQ LVQKLQDIY+ IVKQE+ELQERC +LT SQTT+LKNLW IY++N EL++
Sbjct: 233  VSPSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELIN 292

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY+ FITTA+ P+QPE D              RRLWV+GTITFLD+LKNFSNFMDPEVCC
Sbjct: 293  NYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCC 352

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI HVFISIS ML D+PQK+   W+++LGDLSRMAIALYPS FIDWKLSAE WY  A+ 
Sbjct: 353  QFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALS 412

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
              +GHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PS QY+QLVI NIYQRA+A+ N 
Sbjct: 413  HIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNG 472

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
             N+   + L+V+Y+KH EV LL +F ES ELQ+VVL +F  KFGV  +N+  + F  R M
Sbjct: 473  GNH--RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNT--DFFNPRDM 528

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            F+Q+ ++ K F+R++ AFAES ILQ VG+G+ K+PF+LLFE                   
Sbjct: 529  FLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFE-----------LPKFLKER 577

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQ 792
                +  + +  H +  T++ T  +    L+  E+ EN+D+  Y    P  + IW  SL 
Sbjct: 578  KERKERRKSKSSHSF--TSIETTSH----LSPSEYLENVDSPRYAYEFPEDLAIWRESLS 631

Query: 793  YANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVR 852
            + N  S +CS IV++KFL  P ++A+ H LPW YF++S+ L++D   +V +  FW+  VR
Sbjct: 632  HINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVR 691

Query: 853  RIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKC 912
            +IFPWNSIV FLN+L+A+++DN W+ S ++ LC   +S+    L+ +F+E+E+LPE+W+C
Sbjct: 692  QIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRC 751

Query: 913  RGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI 972
             G+LWFD I +KSN    ++ +VIN           +G KD+ F+D P DG  FDE DE+
Sbjct: 752  WGALWFDVIADKSN---GEDGDVIN-----------SGSKDHPFWDLPGDGICFDEDDEV 797

Query: 973  GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKL 1032
            GE+FWKRA R+IF+FK +A+ ++   GL LS  AP   R        T    L  FSF  
Sbjct: 798  GEKFWKRACRLIFIFKGIAQEFS--LGLTLSAFAPQSRRPM------TAGHPLQNFSFNF 849

Query: 1033 NASSDGVMLDDIIES----FETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSF 1088
                    +   + +    FE     N D +  P  SM++G+SIFD+ GY+++  ++  F
Sbjct: 850  EEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCF 909

Query: 1089 DKNGDFISTSFFNSWSIKNLTNELSRNTCSSI----TXXXXXXXXXXXXXXXXXXXXPMN 1144
            +K+G  IS S + S        +L R          T                       
Sbjct: 910  NKSGSLISCSLYTS-------GKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERL 962

Query: 1145 ELLVFNECFDPKYKTLEEFWSQEI-YPDSQTNISLQGKTYFILDATSWLRHFAHIYKIAT 1203
            E    + C +P++  +E+ +  +  + D   N    G +YF+LDATSWLRHFAH++K+AT
Sbjct: 963  ERDWLDNCMNPEF--IEQAYEMKFPFGDLSCNCD-SGVSYFVLDATSWLRHFAHVFKLAT 1019

Query: 1204 SKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHI 1263
            + +L+F ICLTTFQELR+LRKSKD +VVEAATRA+IT+RQLY +  LLPLRFTGNVATH+
Sbjct: 1020 NNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHL 1079

Query: 1264 EEHLEFEEQITWRSHVDEFVIEAVLKAEEK-------RTDRLNDINMDTDEKEKSIFGII 1316
            EEHLEFEEQITWRSHVDEFVIEAV KA++K         +  +D    TDE+      + 
Sbjct: 1080 EEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHF--VA 1137

Query: 1317 LVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
            LV+DD  M+ KA  ++I+TFSTRF+F++ N I
Sbjct: 1138 LVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQI 1169

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1000 (47%), Positives = 642/1000 (64%), Gaps = 99/1000 (9%)

Query: 379  KSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFI 438
            ++SQ LVQKLQDIY+ IVKQE+ELQERC +LT+SQTT+LKNLW IY+VN+EL++NY+ FI
Sbjct: 209  QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268

Query: 439  TTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHV 498
            TTA+ P+QPE D              RRLWV+GTITFLD+LKNFSNFMDPEVCCQFI HV
Sbjct: 269  TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328

Query: 499  FISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHG 558
            FISISNML D+PQK+   W ++LGDLSRMAIALYPS FIDWKLSAE WY  A+   +GHG
Sbjct: 329  FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388

Query: 559  KLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRN 618
            KLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+ N  N  + 
Sbjct: 389  KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN--QR 446

Query: 619  DQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNND 678
            + L+V+Y+KH EV LL +F ES ELQ+VVL +F +KFG+  NN+  + F  + +F+Q+ +
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNT--DYFSHQAIFLQDGE 504

Query: 679  QFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTM-LILK 737
            + K F+R++ AFAES ILQ+VG+GN K+PF+LLFE                  +      
Sbjct: 505  RTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTS 564

Query: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHV 797
            +  P           PT P         E+ E++D+  +    P  + IW  SL + N  
Sbjct: 565  MEAPS----------PTSPI--------EYLESVDSPRFVYEFPTDLAIWQQSLSHINTT 606

Query: 798  SIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPW 857
            SIKCS +V +KFLH P + A  H LPW YF++S+ +++D+  +  + +FW+   R++FPW
Sbjct: 607  SIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPW 666

Query: 858  NSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLW 917
            NSIV FLN+++A+ +DN W+ S ++ LC  ++S+ +  L+ +F++NE+LPEVWKC G+LW
Sbjct: 667  NSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALW 726

Query: 918  FDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFW 977
            FD I +KS++       V  G+ +       N V+D+ F D P+DG  FDE DE G RFW
Sbjct: 727  FDVISDKSDV-------VDEGATY-------NSVQDHMFGDMPVDGICFDEDDETGSRFW 772

Query: 978  KRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLN---- 1033
            KRA R++F+FK +A+ +    GL L+   P+ +RR            L  F FK      
Sbjct: 773  KRACRLVFIFKGIAQEFN--MGLTLA-SVPLQSRRS-----LAAGHPLQNFCFKFEDPPV 824

Query: 1034 ASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGD 1093
             S    ++   + +FE   E N D +  P  SM++G S+F+  GY+++  +   F+K G 
Sbjct: 825  DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGT 884

Query: 1094 FISTSFFNSWSIK---------------NLTNELSRNTCSSITXXXXXXXXXXXXXXXXX 1138
             I+ S + S S++               + ++EL++     I                  
Sbjct: 885  LITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKM------------ 932

Query: 1139 XXXPMNELLVFNECFDPKYKTLEEFWSQEI-YPDSQTNISLQGKTYFILDATSWLRHFAH 1197
                  E +  + C +P++  +E+ +  +  + D   N    G +YF+ DATSWLRHFAH
Sbjct: 933  ------ERMWLDTCMNPEF--IEQTYDMKFPFGDLSCNCD-SGVSYFVPDATSWLRHFAH 983

Query: 1198 IYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTG 1257
            +YK+AT+ +L+FAICLTTFQELR+LRKSKD +VVEAATRA+IT+RQLY E  LLPLRFTG
Sbjct: 984  VYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTG 1043

Query: 1258 NVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDE---------K 1308
            NVATH+EEHLEFEEQITWRSHVDEFVIEAV KA+ K       +N    E         +
Sbjct: 1044 NVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK----FEALNAQAKEGGHDFIPTTE 1099

Query: 1309 EKSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
            E+    I LV+DD  M+ KA  ++I+TFS+RF+F++ N I
Sbjct: 1100 EEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQI 1139

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1002 (47%), Positives = 643/1002 (64%), Gaps = 118/1002 (11%)

Query: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434
            +P  + +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 435  ITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494
            I FI TA+  TQP +D              +RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554
            I + FIS+S+ML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD----- 609
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D     
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437

Query: 610  -SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFI 668
             +NN    RN Q L+DY+KH EV LLP+F E+ +LQ VVLMYF DKFG D+N   N++F 
Sbjct: 438  TNNNETAHRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFN--GNDIFD 494

Query: 669  SRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXX 728
            ++ MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+               
Sbjct: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY----------- 543

Query: 729  XXXTMLILKITQPRLYHRWVGTT-LPTM--PNNNVFLTAEEFFENIDTI--NYPSFMPNS 783
                   LK+ + +   +  G T +P    P ++  +++E +F+NID++  N+   +P +
Sbjct: 544  -------LKLKRHKREKKKSGATEVPQYRDPFDDQ-ISSESYFQNIDSLTSNFDD-IPTN 594

Query: 784  VDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAM 843
            ++IW  SL + N  SI+CS+ V  KFLHAP ++ALPH L W +FI++I+ +L+   + A+
Sbjct: 595  LNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAV 654

Query: 844  NEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNEN 903
            + FW+ F+RR  PWNS+V   NVL+ YM+DN     +  EL  FY S+ LD+L+ YFNEN
Sbjct: 655  SGFWIHFLRRTMPWNSMVNLANVLVCYMLDNI-HPFLERELERFY-SLELDDLIEYFNEN 712

Query: 904  EELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDG 963
            E LPE+WKC GSLWFD I         K  +V+             GV+D+ FFD P+DG
Sbjct: 713  ENLPEIWKCWGSLWFDAI---------KKCDVMEIP----------GVQDHLFFDSPLDG 753

Query: 964  TDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQ 1023
              FDE DEIGERFW R+ R I + K +A+ +  L GL ++++APVF RR D      +  
Sbjct: 754  IVFDEKDEIGERFWIRSIRTILILKGVAKKFPDL-GLKVNFQAPVFCRRND------ISP 806

Query: 1024 E--LLEFSFKL-----NASSDGVMLD---DIIESFETPDEVNYDTHKTPMLSMVDGDSIF 1073
            +  L  F+FKL     N  +D   LD   D IE  E  + VN D   TP LS+V G++IF
Sbjct: 807  DYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIERVNRDLRATPNLSVVSGENIF 866

Query: 1074 DYVGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXX 1133
            +Y GY R+ P+++ FDKNG F S   ++ WS  N+ N +  +  S               
Sbjct: 867  EYTGYTRLTPDYHCFDKNGGFNSAFIYSQWS--NVGNGMVLDVSSE-------------- 910

Query: 1134 XXXXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQG------KTYFILD 1187
                               +D     L   W ++I+ D  T     G        YF++D
Sbjct: 911  -----------------SMYDAANNNLSPHW-EKIFFDRITTAGHNGDKNGNCSVYFVID 952

Query: 1188 ATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHE 1247
            ATSWLRHFAHI+K+A + ILKFAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E
Sbjct: 953  ATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE 1012

Query: 1248 NNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTD 1306
              ++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K  +  +T+RL D N    
Sbjct: 1013 KKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKN---- 1068

Query: 1307 EKEKSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
             K K+    +LVTDD  M  KA D+ IKT +T+++FS+ + I
Sbjct: 1069 -KNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKI 1109

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1001 (46%), Positives = 632/1001 (63%), Gaps = 120/1001 (11%)

Query: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434
            +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 435  ITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494
            I FI TA+  TQP +D              +RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554
            I + FIS+SNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD--SNN 612
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D  S +
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437

Query: 613  SNNG----RNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFI 668
            +NN     RN Q L+DY+KH EV LLP+F E+ +LQ VVLMYF DKFG D+N   N++F 
Sbjct: 438  ANNNEIAHRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFN--GNDVFD 494

Query: 669  SRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXX 728
            ++ MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+               
Sbjct: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKK 554

Query: 729  XXXTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSF--MPNSVDI 786
                      T P                 +V +++E +F+NID +N  SF  +P +++I
Sbjct: 555  RSEATETSSYTDPF----------------DVQISSESYFQNIDALN-SSFNDIPTNLNI 597

Query: 787  WNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEF 846
            W  SL + N  SI+CS+ V  KFLHAP ++ALPH L W +FI++I+ +L+   +  +  F
Sbjct: 598  WLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAF 657

Query: 847  WVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEEL 906
            W+ F+RR  PWNSIV   NVL+ YM+DN     +  EL  FY S+ LD+L+ Y+NENE L
Sbjct: 658  WIHFLRRTMPWNSIVTLGNVLVCYMLDNL-HPFLKKELEKFY-SLELDDLIEYYNENENL 715

Query: 907  PEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDF 966
            PE+WKC G+LWFD I         K  +V+          +  GV+D+ FFD P+DG  F
Sbjct: 716  PEIWKCWGTLWFDAI---------KKCDVM----------EIPGVQDHLFFDSPLDGIVF 756

Query: 967  DESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKD---EYKVNTVCQ 1023
            DE DE+GE+FW R+ R + L K +A+ +  L GL +S++A VF RR D   +Y       
Sbjct: 757  DEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL-GLKVSFQASVFCRRNDIPPDYF------ 809

Query: 1024 ELLEFSFKLNA-----SSDGVMLDDIIESFETPDE---VNYDTHKTPMLSMVDGDSIFDY 1075
             L   +FKL+A      +D   LDD+ ++ E  +E   VN D   TP LS+V G+SIF+Y
Sbjct: 810  -LKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEIEAVNMDPQATPNLSVVSGESIFEY 868

Query: 1076 VGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXX 1135
             GY R+ P+++ FDKNG F S   ++ WS  N+ N ++ +                    
Sbjct: 869  TGYTRLAPDYHCFDKNGGFNSAFIYSQWS--NVGNGVTLDVSGE---------------- 910

Query: 1136 XXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIY---------PDSQTNISLQGKTYFIL 1186
                             +D     L   W +  +          D   N +L    YF++
Sbjct: 911  ---------------SIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTL----YFVI 951

Query: 1187 DATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYH 1246
            DATSWLRHFAHI+K+A +  LKFAICLTTFQELRYLR SKD  VVEAATR++IT+RQLY 
Sbjct: 952  DATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYD 1011

Query: 1247 ENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDT 1305
            E  ++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  ++ + +RL D N   
Sbjct: 1012 EKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN--- 1068

Query: 1306 DEKEKSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346
              K K     +LVTDD  M  KA DR IKT +T+++FS+ +
Sbjct: 1069 --KNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1014 (47%), Positives = 627/1014 (61%), Gaps = 104/1014 (10%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            V+V  ++SSQ L++KLQ+IY+ IV+QE ELQ+RC +LT SQTT+LKNLW IY+VN+EL+D
Sbjct: 274  VAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELID 333

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY  FITTA+ PTQPE+D              RRLWVYGTITFLD+LKNFSNFMDPEVCC
Sbjct: 334  NYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 393

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI +VFISISNML DIP K+ + W ++LGDLSRMAIALYPS FIDWKLSAE WY  A++
Sbjct: 394  QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALK 453

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            +T+GHGKLYYHMSTVQQNTL AFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+  N
Sbjct: 454  YTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE-RN 512

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
            S + RN   LV+Y+KH EV LLP+F ES ELQ VVL +F  KFGV    S+ + F  R +
Sbjct: 513  SGHHRNAH-LVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV---TSNVDFFDPRLV 568

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            FVQ++++ K F+R+++ +AES +LQ+VG+G+ ++PF+LLFE                   
Sbjct: 569  FVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKH--------------- 613

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNV-----FLTAEEFFENIDTINYPSFMPNSVDIW 787
               LK  + R   R   ++  T  + ++     F    EFFE ID+  Y    P+ ++IW
Sbjct: 614  ---LKERKDRREKRKSKSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIW 670

Query: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847
              SL YAN  ++KCSMIV +KFLH P + ALPH LPW YF+ +   ++       +  FW
Sbjct: 671  KESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFW 730

Query: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907
            V  VR++FP+N+I+ FLNVLL YM +        +E    +  MSL +L+ YF ENEELP
Sbjct: 731  VALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELP 790

Query: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967
            EVW+C G+LWFD +  K                 N+ D    GVKD+ F D PIDG  FD
Sbjct: 791  EVWECWGTLWFDALNTKHIT--------------NLTDINSTGVKDHMFMDSPIDGISFD 836

Query: 968  ESDEIGERFWKRAARVIFLFKKLA-ESYTGL----GG-----LILSYEAPVFNRRKDEYK 1017
             +DE GE+FWKR ARVI LF+ LA E   GL    GG     L+  +E P       E+ 
Sbjct: 837  HNDESGEKFWKRCARVILLFRALALECPVGLREISGGRNWRSLVFKFEEP-----PSEW- 890

Query: 1018 VNTVCQELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077
                C   LE  F L           + ++FE    VN D   TP   M     I    G
Sbjct: 891  ----CDMYLE-PFTL-----------VFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQG 934

Query: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKNL----TNELSRNTCSSITXXXXXXXXXXXX 1133
            Y+ + P++Y F++NGD I+ S +   ++++      ++ +                    
Sbjct: 935  YRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNS 994

Query: 1134 XXXXXXXXPMNELLVFNECF-DPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWL 1192
                     M+E L    C  D +++ +        + D+         TYF+LDAT+WL
Sbjct: 995  LIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHV-------TYFVLDATTWL 1047

Query: 1193 RHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLP 1252
            RHF H+YK+A + ILKFAICLTTFQELR+LRKSKD +V+EAATRA+IT+RQLY+E  LLP
Sbjct: 1048 RHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP 1107

Query: 1253 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSI 1312
            LRFTGNVA H+EEHLE EEQ+TWRSHVDEFVIEA+ KA+    D+ N +N D     +  
Sbjct: 1108 LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQ----DKFNALNDDAKAASRDC 1163

Query: 1313 FG---------IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEGHNK 1357
                       I LVTDD+ M+NKA  + IK FSTRF+FS+ N     E GH K
Sbjct: 1164 IPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCN-----ELGHAK 1212

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/994 (47%), Positives = 631/994 (63%), Gaps = 106/994 (10%)

Query: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434
            +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 435  ITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494
            I FI TA+  TQP +D              +RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554
            I + FIS+SNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD----- 609
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D     
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437

Query: 610  SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFIS 669
            +NN+     +  L+DY+KH EV LLP+F E+ +LQ VVLMYF +KFG D+N   N++F +
Sbjct: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFN--GNDVFDT 495

Query: 670  RKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXX 729
            + MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+                
Sbjct: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKR 555

Query: 730  XXTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTI--NYPSFMPNSVDIW 787
                   +   P  +H                 + E +F+NID +  N+   +P +++IW
Sbjct: 556  SSATETPQYRDP--FHDKK--------------SPESYFQNIDALSSNFDD-IPTNLNIW 598

Query: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847
              SL + N  SI+CS+ V  KFLHAPF+IALPH L W YF+++I+ +L+   +  +  FW
Sbjct: 599  LESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFW 658

Query: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907
            + F+RR  PWNS+V   NVL+ YM+DN     +  EL  FY S  LD+L+ +FNENE LP
Sbjct: 659  IHFLRRTMPWNSMVSLANVLVCYMLDNL-HPFLKKELESFY-SFELDDLIEHFNENENLP 716

Query: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967
            E+WKC GSLWFD I         K  +V+             GV+D+ FFD P+DG  FD
Sbjct: 717  EIWKCWGSLWFDAI---------KKCDVMEIP----------GVQDHLFFDSPLDGIVFD 757

Query: 968  ESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQE--L 1025
            E DEIGERFW R+ R I L K +A+ +  L GL ++++APVF RR D      + Q+  L
Sbjct: 758  EKDEIGERFWVRSVRAISLLKGIAKKFPDL-GLKVNFQAPVFCRRND------IPQDYFL 810

Query: 1026 LEFSFKLNASSDGVMLD--------DIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077
             +F+FKL+A  +G   D        + IE  E  D VN D   TP LS+V G+SIF+Y G
Sbjct: 811  RKFTFKLDAYDEGNNNDNNELDELYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTG 870

Query: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTN----ELSRNTCSSITXXXXXXXXXXXX 1133
            Y R+ P+++ FDKNG F S   ++ WS  N+ N    ++S      +T            
Sbjct: 871  YTRLAPDYHCFDKNGGFNSAFIYSQWS--NVGNGVPIDVSNEPIYDVTDNDLS------- 921

Query: 1134 XXXXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLR 1193
                     ++   +F +     YK  +E            N ++    YF++DATSWLR
Sbjct: 922  ---------LHWEKIFFDRIAAAYKNCDE----------NDNCTI----YFVVDATSWLR 958

Query: 1194 HFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPL 1253
            HFAHI+K+A + IL FAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E  ++P+
Sbjct: 959  HFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPM 1018

Query: 1254 RFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSI 1312
            RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  +  +T+R     M  + K K+ 
Sbjct: 1019 RFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTER-----MIAENKNKNK 1073

Query: 1313 FGIILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346
               +LVTDD  M  KA D+ IKT +T+++FS+ +
Sbjct: 1074 QFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGS 1107

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/991 (46%), Positives = 625/991 (63%), Gaps = 100/991 (10%)

Query: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434
            +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IY++N+EL+ NY
Sbjct: 197  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNY 256

Query: 435  ITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494
            I FI TA+  TQP +D              +RLWVYG ITFLD+LK+FSNFMDPEVCCQF
Sbjct: 257  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQF 316

Query: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554
            I + FI ISNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 317  ITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 376

Query: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD--SNN 612
            YG GKLYYH++T+QQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D  S N
Sbjct: 377  YGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGN 436

Query: 613  SNNG----RNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFI 668
            +NN     RN Q L+DY+KH EV LLP+F E+ +LQ VVL+YF DKFG D+N   N++F 
Sbjct: 437  TNNNETAHRNSQ-LIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFN--GNDVFS 493

Query: 669  SRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXX 728
            ++ MF QN +  + ++R++ AFAESQILQ++G+GN K+PF+LLF+               
Sbjct: 494  TKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKK 553

Query: 729  XXXTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYP-SFMPNSVDIW 787
                  I     P                     ++E +F+NIDT+N   +  P ++ IW
Sbjct: 554  KSGAAEIPHYRDPFDDQG----------------SSESYFQNIDTLNSDFNDPPTNIGIW 597

Query: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847
              SL Y N  SI+CS+ V  KFLHAP  +ALPH L W +FII+++ +L+   +  +  FW
Sbjct: 598  LDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFW 657

Query: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907
            + F+RR  PWNS+V F NVL+ YM+DN     +  +L  FY S+ LD+L+ YFNENE LP
Sbjct: 658  IHFLRRTMPWNSMVTFSNVLVCYMLDNL-HPFLEKQLEKFY-SLELDDLIEYFNENENLP 715

Query: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967
            EVWKC GSLWFD +         K  +V+          +  GV+D+ FFD P+DG  FD
Sbjct: 716  EVWKCWGSLWFDAV---------KKCDVM----------EIPGVQDHLFFDSPLDGIVFD 756

Query: 968  ESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKD---EYKVNTVCQE 1024
            + DEIGE+FW R+ R I   K +A+ +  L GL ++++A VF RR D   +Y +  +  +
Sbjct: 757  KKDEIGEKFWIRSVRTILTLKGIAKKFPDL-GLKVNFQASVFCRRNDISPDYFLKNLTFK 815

Query: 1025 LLEFSFKLNASSDGVMLD---DIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRV 1081
            L    ++ +A +D   LD   D IE  E  + VN D   TP LS+V G+SIF+Y GY R+
Sbjct: 816  LD--PYEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRL 873

Query: 1082 CPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXX 1141
              +++ FDKNG F S   +  WS  N+ N ++ +  S                       
Sbjct: 874  TQDYHCFDKNGGFNSAFIYTQWS--NVGNGVTLDVSSE---------------------- 909

Query: 1142 PMNELLVFNECFDPKYKTLEEFWSQEIYP-----DSQTNISLQGKTYFILDATSWLRHFA 1196
                       +D     L   W++ ++         T+       YF++DATSWLRHFA
Sbjct: 910  ---------SLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFA 960

Query: 1197 HIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFT 1256
            HI+K+A + ILKFAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E  ++P+RFT
Sbjct: 961  HIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFT 1020

Query: 1257 GNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSIFGI 1315
            GN+ATHIEE+LEFEEQITW++HVDEFVI+A+ K  +  +T+R  D N     K +S    
Sbjct: 1021 GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKN-----KGRSKEFA 1075

Query: 1316 ILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346
            +LVTDD  M  KA D+ IKT +T+++FS+ +
Sbjct: 1076 VLVTDDDNMNQKAKDKMIKTCNTKYLFSLGS 1106

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1002 (46%), Positives = 611/1002 (60%), Gaps = 91/1002 (9%)

Query: 373  VSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVD 432
            V+VP + SSQ LV+KLQ+IYK IVKQE ELQERC +LT SQTT+LKNLW IY++N+EL+D
Sbjct: 312  VAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELID 371

Query: 433  NYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCC 492
            NY TFITTA+ PTQP++D              RRLW+YGTITFLD+LKNFSNFMDPEVCC
Sbjct: 372  NYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCC 431

Query: 493  QFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAME 552
            QFI +VFISISN+L +IP  + V W ++LGDLSRMAIALYPS FIDWKLSAE WY  A++
Sbjct: 432  QFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALK 491

Query: 553  FTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNN 612
            + +GHGKLYYHMSTVQQNTL AFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+ N+
Sbjct: 492  YNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS 551

Query: 613  SNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKM 672
             ++  +   +V+Y+KH EV LLP+F E+ E Q VVL +F  KFG      S N F    +
Sbjct: 552  GHHRYSH--IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA---TGSANFFDPSLI 606

Query: 673  FVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXT 732
            FVQ+ ++ K F+R+++ +AES ILQ+VG+G+ ++PF+LLFE                   
Sbjct: 607  FVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFE---------------LPKC 651

Query: 733  MLILKITQPRLYHRWVGTTLPTMPNNNVFLTAE-EFFENIDTINYPSFMPNSVDIWNHSL 791
            +   K  + +   +   +    M  ++ FL    +FFE +++          ++IW  SL
Sbjct: 652  IKERKERKEKRKSKSTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESL 711

Query: 792  QYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFV 851
             Y N  S++CSM+V +KFL++  + ALPH LPW YF++++ L+LD  +N     FW+ F+
Sbjct: 712  NYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFI 771

Query: 852  RRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWK 911
            R+IFPW SI  FLNVLL Y+ D    +  ++E    Y +M L ELL YF ENE+LPEVW 
Sbjct: 772  RQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWN 831

Query: 912  CRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDE 971
            C G+LWFD I  K                 N+ D    GVKD+ F D P+DG  FD SDE
Sbjct: 832  CWGTLWFDVINSKHVS--------------NLVDIHSTGVKDHMFLDAPVDGISFDHSDE 877

Query: 972  IGERFWKRAARVIFLFKKLAE----SYTGLGG------LILSYEAPVFNRRKDEYKVNTV 1021
             GE+FWKR  RVI LF+ +A      +T   G      L+       FN    E+K    
Sbjct: 878  SGEKFWKRCVRVILLFRGIAYQFPFGFTEFNGSDDWKSLVFK-----FNEPPAEWKE--- 929

Query: 1022 CQELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRV 1081
             Q L  FS +                FE+   VN D    P   MV G  I    GYK++
Sbjct: 930  -QYLGSFSKEYG-------------EFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQL 975

Query: 1082 CPNFYSFDKNGDFISTSFFNSW------SIKNLTNELSRNTCSSITXXXXXXXXXXXXXX 1135
             P++  F+KNGD I+ S + S        + N + +       S                
Sbjct: 976  VPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDF-----GSTKRLLENELLVTSERR 1030

Query: 1136 XXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHF 1195
                     E  + +E    +Y +    W Q +        +    TYF+LDAT+WLRHF
Sbjct: 1031 DYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHF 1090

Query: 1196 AHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRF 1255
             H+YK+ATS +LKFAICLTTFQELR+LRKSKD +V+EAATRA+IT+RQLY+E  LLPLRF
Sbjct: 1091 GHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF 1150

Query: 1256 TGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGI 1315
            TGNVA H+EEHLE EEQ+TWRSHVDEFVIEA+ KA+ K     N +N D     +     
Sbjct: 1151 TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSK----FNQLNKDAKASGRESITT 1206

Query: 1316 I---------LVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348
            I         LVTDDI M+NKA  + I+ FST+F+F++ + I
Sbjct: 1207 IDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEI 1248

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/990 (45%), Positives = 600/990 (60%), Gaps = 84/990 (8%)

Query: 384  LVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTAIH 443
            LV+KLQ+IYK+IVKQE ELQERC  LT  QTT+LKNLW  Y++N+EL+DNYI FITTA+ 
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 444  PTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFISIS 503
            P+Q ES               RRLWVYGTITFLD+LKNFSNFMDPEVCCQFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 504  NMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLYYH 563
            NML D+P KY + W ++LGDLSRMAIALYPS F+DWKLSAE WY  +++FT+GHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 564  MSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQLLV 623
            MSTVQQNTLEAFVNLGKS+FC++ FVPS QY+QLVI NIYQRA+A+ ++S N  N   +V
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH--IV 521

Query: 624  DYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFKCF 683
            DY+KH EV LLP+F ES ELQ VV+ YF  KFGV   +SS N F    +F+Q+ ++ K F
Sbjct: 522  DYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV---SSSGNFFDPNLIFIQDAERLKHF 578

Query: 684  YRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILKITQPRL 743
            +R+S+ F++S ILQ+ G+G+ K+PF++LFE                       K T    
Sbjct: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKST-----KSTSE-- 631

Query: 744  YHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSM 803
                 G+  P   ++    + E+FF  ID+   P   P  + +W  SL Y N  S+KC M
Sbjct: 632  -----GSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGM 686

Query: 804  IVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKF 863
            IV ++FL+ P + ALPH LPW  FIISI ++LD+  ++ + +FW+ F+RRIFPW+S++ F
Sbjct: 687  IVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITF 746

Query: 864  LNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIME 923
            +N L+ Y +    +   ++     Y  M+ +ELLT   ENE LPE W C GSLWF+TI +
Sbjct: 747  MNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISK 806

Query: 924  KSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARV 983
            K              SD ++   +  G+ D  F D P +G  FD+ DE G ++W+R  R 
Sbjct: 807  K--------------SDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRT 852

Query: 984  IFLFKKLAE----SYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASSDGV 1039
            + LF  + E       G G   L+ EA  +      +  +T  Q  +E   + N S    
Sbjct: 853  LLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFP-- 910

Query: 1040 MLDDIIESFETPDEVNY-DTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTS 1098
                  E FE    +N  D  +    SM+ G SI +  G+K + P+++ F+KNGD I+ S
Sbjct: 911  -----FEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITAS 965

Query: 1099 FFNSWSIKNLTNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFNECFDPKYK 1158
             +    ++              T                     + + L ++   D   +
Sbjct: 966  LYTKGPLE--------------TANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQ 1011

Query: 1159 T-LEEFWSQEIYPDSQTNISLQGK---------TYFILDATSWLRHFAHIYKIATSKILK 1208
              LE F + +       N S  G          T+F+LDAT+WLRHFAHIYK+ATS +LK
Sbjct: 1012 PWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLK 1071

Query: 1209 FAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLE 1268
            FAICLTTFQELR+LRKSKD +V+EAATRA+I +RQLY+E  LL LRFTGNVA H+EEHLE
Sbjct: 1072 FAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLE 1131

Query: 1269 FEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG-------------I 1315
             EEQ+TW+SHVDEFVI+A+ KA+    D+ N +N D  EK K                 +
Sbjct: 1132 IEEQMTWKSHVDEFVIDAIAKAQ----DKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFV 1187

Query: 1316 ILVTDDITMKNKAMDRKIKTFSTRFIFSMA 1345
             LVTDD  M+NKA    I+TFSTRF+F++ 
Sbjct: 1188 SLVTDDFNMRNKAQQLGIRTFSTRFVFAIC 1217

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/750 (46%), Positives = 475/750 (63%), Gaps = 59/750 (7%)

Query: 379  KSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFI 438
            +S+Q L+ KLQDIYK+I+ QE+ELQ  C  +T+SQTT+LK +W +Y++N ELV+NY+ FI
Sbjct: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330

Query: 439  TTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHV 498
            TTA+ P+Q ++D              RRLWVYGTITFLD+LK+FSNFMDPE+CCQFI HV
Sbjct: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390

Query: 499  FISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHG 558
            FISI+NM   IP+K+ + W+ +LGDLSRMA ALYP    DWKLSAE WY  AM++TYG G
Sbjct: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450

Query: 559  KLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRN 618
            KLYYHM+TVQQN+L AF+NLGKS+FC++ FVP+QQYLQLVI NIYQRAY  S    +  N
Sbjct: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYI-SRGEESSSN 509

Query: 619  DQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNND 678
             Q+L DY+KH E+ +LPNF E+ ELQ++  +YF +KFG D+    NN F +R MFVQN +
Sbjct: 510  VQIL-DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDF--VGNNFFDTRSMFVQNLE 566

Query: 679  QFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFEXXXXXXXXXXXXXXXXXXTMLILKI 738
              K ++R+S  FA++ ILQ+VGYGN+ + F+LL+E                  T +    
Sbjct: 567  SVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV---- 622

Query: 739  TQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVS 798
                        TL    + N      E+F +++ I+    +P +VDIW  SLQY N   
Sbjct: 623  ------DNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTG 676

Query: 799  IKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWN 858
            I C M+V +KFL  PF+ ALPH LPW YF+IS+  +++  ++     FW  F+RRIFPWN
Sbjct: 677  IFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWN 736

Query: 859  SIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWF 918
            +I+ FLNVL+A++ DN    S++N+LC  Y+ +SLDE+LT F+ENEELPEVW C GSLWF
Sbjct: 737  TIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWF 796

Query: 919  DTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWK 978
            DTI               N S+ + +  K  G+KD  F D P DG  FDE D+ G +FWK
Sbjct: 797  DTIK--------------NKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWK 842

Query: 979  RAARVIFLFKKLAESYTGLGGLIL-------SYEAPVFNRRKDEYKVNTVCQELLEFSFK 1031
            RA R++FLFK  AE +    GL L       S E  +F +++++  +        +F FK
Sbjct: 843  RACRILFLFKGYAEKFD--QGLRLTNINSLNSEEENIFTKKQEKRNI--------DFLFK 892

Query: 1032 LNASSDGVMLDDI--------------IESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077
             + + D + +D+               + +FE+  E N      P LS++DG+SIFDYVG
Sbjct: 893  FDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVG 952

Query: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKN 1107
            YK++ P +Y +DKNG+    + +++W   N
Sbjct: 953  YKKLLPCYYYYDKNGNVNKGAIYSNWEAFN 982

 Score =  203 bits (517), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 134/189 (70%), Gaps = 22/189 (11%)

Query: 1182 TYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITL 1241
            TYFI DAT+WLRHFAHIYKIA S +L F ICLTTFQELR+LR+S+D NV+EAATRA+I +
Sbjct: 1085 TYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVI 1144

Query: 1242 RQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRT-DRLND 1300
            R LY    ++PLRF G +A+HIEEHLEFEEQITWRSHV+EFVIEAV K++E    D L++
Sbjct: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204

Query: 1301 ---------INMDT----DEKEK--------SIFGIILVTDDITMKNKAMDRKIKTFSTR 1339
                      NMDT    D K++        S    +LVTDD  M +KA +R I+T STR
Sbjct: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTR 1264

Query: 1340 FIFSMANYI 1348
            FIFS+ + +
Sbjct: 1265 FIFSICSQL 1273

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  436 bits (1121), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 272/381 (71%), Gaps = 43/381 (11%)

Query: 374 SVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDN 433
           S+  + SSQ L+QKLQDIYK IVKQEI+LQ+RC +LT SQTT+LKNLWTIY++N +L++N
Sbjct: 388 SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN 447

Query: 434 YITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQ 493
           YI FIT A+ PTQ ++D              RRLWVYGTITFLD+LK+FSNFMDPEVCCQ
Sbjct: 448 YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ 507

Query: 494 FIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEF 553
           FI HVFI+IS +L DIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WY  AM+F
Sbjct: 508 FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF 567

Query: 554 TYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNS 613
           TY HGKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PSQQY+QLVI NIYQRA+ + NN 
Sbjct: 568 TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG 627

Query: 614 NNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGV---------------- 657
           N+ RN Q L++Y+KH EV LLP F ES +LQ VVL+YF  KFG+                
Sbjct: 628 NH-RNLQ-LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNT 685

Query: 658 --------------------DYNNSSN-----NMFISRKMFVQNNDQFKCFYRYSAAFAE 692
                                 +N++      ++F ++ MF+QN D  K F+R+S  FA+
Sbjct: 686 NGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQ 745

Query: 693 SQILQIVGYGNLKSPFSLLFE 713
           S ILQ+VG+G+ K+PF+LLFE
Sbjct: 746 SHILQLVGFGDPKNPFALLFE 766

 Score =  239 bits (609), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 153/407 (37%), Positives = 228/407 (56%), Gaps = 68/407 (16%)

Query: 757  NNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMI 816
            NN   +  EEFFENID + +P  +P +++IW  SL+  N +S+KCS+IV KKFL+ P +I
Sbjct: 858  NNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILI 917

Query: 817  ALPHTLPWCYFIISIVLQLDKHKNVAMNE---FWVEFVRRIFPWNSIVKFLNVLLAYMVD 873
            ALPH L W +FIISI+L+++   ++  N+   FW  F++ I PWNSIV FLNVL+ Y++D
Sbjct: 918  ALPHLLTWIHFIISILLKIE--NSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLD 975

Query: 874  NCWEQS--ILNELCPFYNSM---SLDELLTYFNENEELPEVWKCRGSLWFDTIMEKSNLN 928
            N  +++  ++  L   YNSM   SL+E+L +FN+NE LPE+WKC G+LWFD I  K N+N
Sbjct: 976  NINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNK-NIN 1034

Query: 929  KD-----------KNPEVINGSDFNINDY------KGNGVKDYKFFDFPIDGTDFDESDE 971
             D                 NG D   ++Y      +  G++D+   D P+DG  F  +DE
Sbjct: 1035 SDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDE 1094

Query: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELL--EFS 1029
             G  F+KR+ R+IFL K + E++  L GL +S+E   + R         + Q  +   F+
Sbjct: 1095 DGINFYKRSIRLIFLCKSMIETFPNL-GLKISHETSNYCRNTK------IPQNFILNNFA 1147

Query: 1030 FKLNASSDGVM---------------------------LDDIIESF---ETPDEVNYDTH 1059
            FKL    D  +                           L +I+E F   E  +E+N +  
Sbjct: 1148 FKLTNLYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQ 1207

Query: 1060 KTPMLSMVDG-DSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSI 1105
              P LS++ G ++IF+Y+GYKR+  N  SF +NG+ IS S ++SW I
Sbjct: 1208 LQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPI 1254

 Score =  197 bits (502), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/124 (72%), Positives = 110/124 (88%), Gaps = 1/124 (0%)

Query: 1181 KTYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIIT 1240
            +T+F+ DATSWLRHFAHIYK++ +  LKFA+CLTTFQELR+LRKSKD NVVEA+TRAIIT
Sbjct: 1330 RTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIIT 1389

Query: 1241 LRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLN 1299
            +RQLY E  LLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEA+++++E+ +T  + 
Sbjct: 1390 MRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449

Query: 1300 DINM 1303
            + N+
Sbjct: 1450 NYNL 1453

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  384 bits (986), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/409 (49%), Positives = 268/409 (65%), Gaps = 72/409 (17%)

Query: 377 LRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYIT 436
           ++KS+Q L+QKLQ+IYK IV QE+ELQ++C +L+ SQ+T+LK LW+IY++N +L++NYI 
Sbjct: 262 IKKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYIL 321

Query: 437 FITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLLKNFSNFMDPEVCCQFIF 496
           FI T++ P+Q  +DQ             RRLW+YGTITFLD+LKNF+NFMDPE+  QFI 
Sbjct: 322 FILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFIT 381

Query: 497 HVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYG 556
           HVF SISNM++D+P  +   WYQ+LGDLSRMAIALYPSNFIDWKLS+E WY+ +M+FT+ 
Sbjct: 382 HVFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFS 441

Query: 557 HGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSN----- 611
           HGKLYYH+STVQQN LEAFVNLGKS+FC +TF+PSQ+Y+QLVI NIYQRA+ + N     
Sbjct: 442 HGKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSS 501

Query: 612 --------------NSNNGRNDQ--LLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKF 655
                          S+  +N Q   L++Y+KH EV LLPNF E+  L+ VVL YF + F
Sbjct: 502 SNNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSF 561

Query: 656 G---------------VDYNNSSN-----------------------------------N 665
           G               ++ N+ SN                                   N
Sbjct: 562 GKIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAIN 621

Query: 666 MFISRKMFVQ-NNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFE 713
           +F  R +F Q N+D  K F++ SA FAES ILQ++G+G+ K+PF+LLF+
Sbjct: 622 LFNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQ 670

 Score =  288 bits (738), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 203/335 (60%), Gaps = 37/335 (11%)

Query: 1048 FETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSIKN 1107
            FE     N D +  P LS+++ +S+F+Y GYKR  P+F +FDKNG+ ISTS + S  I  
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 1108 L---------------TNELSRNTCSSITXXXXXXXXXXXXXXXXXXXXPMNELLVFNEC 1152
            +                N+ S N  S+                       + E  +FN+ 
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1153 FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC 1212
             DP YK ++E W  E++ D+    S    TYF+LDATSWLRHFAH+YK+AT+ ILKFAIC
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFS---DTYFVLDATSWLRHFAHVYKLATNGILKFAIC 1326

Query: 1213 LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ 1272
            LTTFQELR+LRKSKD NV+EAATRAIITLRQLY E  LLPLRFTGN+ATHIEEHLEFEEQ
Sbjct: 1327 LTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQ 1386

Query: 1273 ITWRSHVDEFVIEAVLKAEEKRTDRLN--DINMDTDEKEKSIFG-------------IIL 1317
            ITWRSHVDEFVIEA+ +A+ KR D  N  D N+ +      I                +L
Sbjct: 1387 ITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVL 1446

Query: 1318 VTDDITMKNKAMDRK----IKTFSTRFIFSMANYI 1348
            VTDDI+M  K  + K    I TFST+F+FS+ N +
Sbjct: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  257 bits (656), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 192/311 (61%), Gaps = 18/311 (5%)

Query: 762  LTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHT 821
            L+ ++FF N++++    F+PNS++IWN SL+Y N +S+ CS+IV KKFL+ P  ++LPH 
Sbjct: 786  LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHM 845

Query: 822  LPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSIL 881
            LPW YFIIS+ L+++  +N+    FW++F+R+IFPWNSIV +LNV+++ ++DNC+E S++
Sbjct: 846  LPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMI 905

Query: 882  NELCPFYNSMSLDELLTYFNENE-ELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSD 940
             +L   Y++ +LDELL  FNENE ELPEVWKC GSLWFD I E             N   
Sbjct: 906  TKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAE-------------NYQI 952

Query: 941  FNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGL 1000
            ++ +  K   +KD K  ++PIDG  FDE +E G  FWKR+ R+IFLFK +   + G GGL
Sbjct: 953  YSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGL 1012

Query: 1001 ILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHK 1060
             +S    V+  R D    N +   L  F+FKL    D  M +    S    +  N +T  
Sbjct: 1013 TISSNTSVYCNRSD-IPNNHI---LRTFAFKLLPDDDNYMNNSNKNSHGPDNSSNQNTTT 1068

Query: 1061 TPMLSMVDGDS 1071
              M+ +   DS
Sbjct: 1069 DVMVHINQDDS 1079

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 112/577 (19%), Positives = 222/577 (38%), Gaps = 110/577 (19%)

Query: 783  SVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVA 842
            S+  W   ++  +   +  + +++KKFL     I+ P  LPW  F IS+  ++    +  
Sbjct: 477  SLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRH 536

Query: 843  MNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNE 902
            +   W + ++ + PW+ IV +LN  +  +  +      L  L     S SL +LL Y   
Sbjct: 537  VLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMY 596

Query: 903  NEELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPID 962
                 E+  C G +WFD++  K           I  +    N+     +  +K ++   D
Sbjct: 597  ESNFQEISMCEGFIWFDSLASK-----------IKQASITTNE----SLMKFKSYNASED 641

Query: 963  GTDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVC 1022
               +D+ D++  + W RA  +I L K +   Y  L  + +  ++ + N    +   +   
Sbjct: 642  SLIYDDDDQVYTKMWTRALLIILLIKNVINDYPELIDVSIRGQS-LTNSSCIKNSDSLTN 700

Query: 1023 QELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVC 1082
              L ++ F+LN +++ V++DD +                        + IF +       
Sbjct: 701  DYLFDWGFELN-NNNAVIIDDTLHG---------------------RNRIFKF----SYI 734

Query: 1083 PNFYSFDKNG------------DFISTSFFNSWSIKNLTNELSRNTCSSITXXXXXXXXX 1130
            P+F  FDKNG            D+I ++ FNS    N     SR   S+           
Sbjct: 735  PDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSA----------- 783

Query: 1131 XXXXXXXXXXXPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATS 1190
                                      +    E  S++  P  + N       YF++D  +
Sbjct: 784  --------------------------HNDYSEDKSKKYLPKLENN-------YFMVDTLA 810

Query: 1191 WLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVE-AATRAIITLRQLYHENN 1249
            WL+H   + +    + +K  + ++   +L  L+   +H  V  +A+R +I +  LY  N 
Sbjct: 811  WLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQ 870

Query: 1250 LLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKE 1309
            +  L+   +  +   ++++  + + +           +L  E     +LN I +  D   
Sbjct: 871  INILKEFESPISKALKNIDGSQILNFNGKFK----NDLLTKENGPGQQLNMIELRMD--- 923

Query: 1310 KSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346
                 +++V+DD         +     ST+ +FS+A+
Sbjct: 924  ----NVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 95/211 (45%), Gaps = 25/211 (11%)

Query: 420 LWTIYRVNSELVDNYITFITTAIHPTQPESDQQXXXXXXXXXXXXRRLWVYGTITFLDLL 479
           L  ++++++++V  Y  FI  A++    + D               RL  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 480 KNFSNFM----------DPEVCCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAI 529
           +N+ N M          + +   +FI    I I++ML +IP K+   W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 530 ALYPSNFIDWKLSAERWY-----MAAMEFTYGHGK----------LYYHMSTVQQNTLEA 574
            L   +   ++L++   Y     + A+ ++  +GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 575 FVNLGKSLFCKNTFVPSQQYLQLVIGNIYQR 605
            V L K L  +NT V  +   QL I  I  +
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354

>SAKL0G05610g Chr7 (458818..460473) [1656 bp, 551 aa] {ON} similar
           to uniprot|Q03718 Saccharomyces cerevisiae YML023C NSE5
           Protein required for cell viability
          Length = 551

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 62/138 (44%), Gaps = 31/138 (22%)

Query: 580 KSLFCKNTFVPSQQYL--QLVIGNIYQRAYADSNNSNNGRNDQLLVDYIKHCEVTLLPNF 637
           K++ C   FV  Q  L  ++ +  +YQ+  + S N            YI     T +   
Sbjct: 299 KTILCDYLFVNCQYPLAGKINVHPVYQKETSVSPN------------YISSANPTRVYKL 346

Query: 638 KESQELQQVVLMYFID-KFGVDYNNSSNNMFISRKMFVQ----------NNDQFKCFYRY 686
           K+S EL++ VL  F    F +      +++ ++ K F+Q          N D+FKCF+ Y
Sbjct: 347 KQSMELRRAVLASFFKLLFELPGGQKLHSLKVNEKEFIQHTSRILKSFENLDEFKCFF-Y 405

Query: 687 SAAFAESQILQIVGYGNL 704
           S+ F++      +GY +L
Sbjct: 406 SSDFSKD-----IGYLSL 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 141,452,220
Number of extensions: 6563519
Number of successful extensions: 25841
Number of sequences better than 10.0: 74
Number of HSP's gapped: 26338
Number of HSP's successfully gapped: 125
Length of query: 1361
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1239
Effective length of database: 39,492,147
Effective search space: 48930770133
Effective search space used: 48930770133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)