Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E001805.707ON1651656891e-93
TBLA0I016905.707ON320951397e-10
ZYRO0B16434g5.707ON237991333e-09
NCAS0G002105.707ON288851238e-08
Smik_9.175.707ON251971192e-07
YIL152W5.707ON2351021159e-07
TDEL0B021305.707ON208891141e-06
KNAG0L021605.707ON2091061112e-06
Skud_9.165.707ON226971103e-06
Suva_9.365.707ON224981104e-06
NDAI0F002705.707ON298107920.001
Kpol_1043.745.707ON177101890.002
SAKL0E15026g5.707ON29096790.055
KAFR0D022005.707ON18295740.17
Cgla_YGOB_Anc_5.7075.707ON13094690.64
Kwal_33.137431.163ON82763654.5
NOTE: 3 genes in the same pillar as TPHA0E00180 were not hit in these BLAST results
LIST: KLTH0E00946g Kwal_55.19675 KLLA0A00506g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00180
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...   270   1e-93
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    58   7e-10
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    56   3e-09
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    52   8e-08
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     50   2e-07
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    49   9e-07
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    49   1e-06
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    47   2e-06
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     47   3e-06
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     47   4e-06
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    40   0.001
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    39   0.002
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    35   0.055
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    33   0.17 
Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130...    31   0.64 
Kwal_33.13743 s33 complement(374832..377315) [2484 bp, 827 aa] {...    30   4.5  

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score =  270 bits (689), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 143/165 (86%), Positives = 143/165 (86%)

Query: 1   MKSRLIIDHKRLVSHLDSRKKNKKAISELLAXXXXXXXXXXXXXXXXXXXXXXCSSASVS 60
           MKSRLIIDHKRLVSHLDSRKKNKKAISELLA                      CSSASVS
Sbjct: 1   MKSRLIIDHKRLVSHLDSRKKNKKAISELLATKKKYNKTYSKLKLNNNFHNFKCSSASVS 60

Query: 61  DLRLSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNSN 120
           DLRLSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNSN
Sbjct: 61  DLRLSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNSN 120

Query: 121 NYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKIKTLLKAYIHT 165
           NYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKIKTLLKAYIHT
Sbjct: 121 NYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKIKTLLKAYIHT 165

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 59  VSDLRLSINKFNMLLKASSN-KYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEK-NV 116
           V+ L   ++  N  + +S N K+D+I  I+ + KLS  E +V T  + +L+LHS+     
Sbjct: 226 VNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTIGQ 285

Query: 117 VNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
              NNYTLK ++VA NS   L +  DLNWYL WKF
Sbjct: 286 SEFNNYTLK-EKVATNSISILKITEDLNWYLKWKF 319

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 12/99 (12%)

Query: 59  VSDLRLSINKFNMLLKASSNK--YDEIHDINSIEKLSQNEFIVTTIDS--KTLILHSNE- 113
           V+ L  ++N FN+++K S     YD + DI     LS  E +V + D   K  ILHS++ 
Sbjct: 144 VTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILHSHKA 203

Query: 114 -KNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
               VNS +      ++AI SK  L+LYND+NWYL WKF
Sbjct: 204 IPKFVNSPS------RLAICSKCCLTLYNDMNWYLKWKF 236

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 13/85 (15%)

Query: 80  YDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNV-------------VNSNNYTLKY 126
           YD +  INSI KLS  E  VTT  S  LI+  N+ ++             +N+     + 
Sbjct: 200 YDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIPILKFIHDVSINTKIQVTES 259

Query: 127 QQVAINSKYYLSLYNDLNWYLDWKF 151
            ++AINSK ++ + +D+NWY+DWKF
Sbjct: 260 LKLAINSKSFIKVSDDINWYIDWKF 284

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117
           VS L  S+   + +++    K+D I HD++    LS NE ++     +T+ILHS    + 
Sbjct: 154 VSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLPMEETIILHSRTPTIN 213

Query: 118 NS---NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
                N  +     + I+S+ +L L N++ WYL WKF
Sbjct: 214 EEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKF 250

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 14/102 (13%)

Query: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNE---- 113
           VS L  S+   + +++    K+D I  D +    LS NE ++     +T+ILHS      
Sbjct: 138 VSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRAPKIN 197

Query: 114 ----KNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
               +N VN  + +L      I+S+ +L+L N++ WYL WKF
Sbjct: 198 AEWLQNKVNDPSASL-----VIDSRSFLTLCNNIKWYLHWKF 234

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 64  LSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNSNNYT 123
           ++++  N  ++  S + D++     +  LSQ+E +V T   K  +LHS    +       
Sbjct: 122 VALSHLNTRIQVLSGELDQLMAFERLVLLSQHELLVVT-QRKIFVLHSVIP-LTREGVSR 179

Query: 124 LKYQQVAINSKYYLSLYNDLNWYLDWKFY 152
               ++A+NS+ Y  LYND+ W++ WKF+
Sbjct: 180 FGALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 59  VSDLRLSINKFNMLL--KASSNKYDEIHDINSIEKLSQNEFIVTTI-DSKTLILHSNEK- 114
           V  L+ S+ + N L+     S  YD +  +    KLS +E ++ T   SK  +LHSN   
Sbjct: 108 VQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHSNGPV 167

Query: 115 -----NVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKI 155
                + + S  YT     VA+ SK  + +  DL W L WK    +
Sbjct: 168 HGFLLDQIASGGYT-----VALYSKLAVRVTPDLYWCLQWKLVPAV 208

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117
           VS L  S+   + +++    ++D I HD++    LS NE ++    + T+ILHS    + 
Sbjct: 129 VSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIILHSRIPKIN 188

Query: 118 NS---NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
                N  +     + I+S+ +L L N++ WYL WKF
Sbjct: 189 AEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKF 225

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117
           VS L  S+   + +++    ++D I HD++    LS NE ++      T+ILHS    ++
Sbjct: 127 VSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRTP-II 185

Query: 118 NS----NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
           N+    N  +     + I+S+ +L L +++ WYL WKF
Sbjct: 186 NAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKF 223

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 55  SSASVSDLRLSINKFNMLLKA-SSNKYDEIHDINSIEKLSQNEFIVTTIDS--------K 105
            SA +  L+ S+   +  LK  S + YD +  + S E LS +E  + ++ +         
Sbjct: 192 PSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDV 251

Query: 106 TLILHSN-EKNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
           T++LHS    NV   NN    Y+ +A++SK YL L  ++ WYL WKF
Sbjct: 252 TMLLHSKISLNVPLPNNLHKDYK-LALDSKVYLELAPNVKWYLVWKF 297

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 6/101 (5%)

Query: 56  SASVSDLRLSINKFNMLLKASSN-KYDEIHDINSIEKLSQNEFIVTTID----SKTLILH 110
           S S+  L  S+  FN ++++ S  K+D +  I   + LSQ +     +D    +K +IL+
Sbjct: 75  SPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILY 134

Query: 111 SNEKNVVNSN-NYTLKYQQVAINSKYYLSLYNDLNWYLDWK 150
            N  N  N+N      + ++AINS  ++ LY ++NWYL W+
Sbjct: 135 KNNNNNNNANITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 62  LRLSINKFNMLLKASSN----KYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117
           L+ S+  FN + K SS+     YD +  ++  ++LS +E +V + +    I+    KN  
Sbjct: 192 LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHAIVLHRFKNKA 251

Query: 118 NSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYD 153
                  +  ++ ++S+  + LY  L WY +W F D
Sbjct: 252 FPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFAD 287

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 62  LRLSINKFNMLLKASSN--KYDEIHDINSIEKLSQNEFIV--TTIDSKTLILHSNEKNVV 117
           L+ S+   N L+  S N  KYD +  + S  +LS  E ++  +T ++   ILH       
Sbjct: 88  LQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPLTFRT 147

Query: 118 NS-NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151
           NS +N+T  +  +A+NSK    L + L W L+WK 
Sbjct: 148 NSVDNFTGAH--LALNSKISFRLDDTLIWCLNWKL 180

>Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130
           aa] {ON} ANNOTATED BY YGOB -
          Length = 130

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 7/94 (7%)

Query: 62  LRLS-INKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTI--DSKTLILHSNEKNVVN 118
           LRL  ++ F  +L+  +        +    +LS NE +V T     + LILHSN K  + 
Sbjct: 41  LRLPFLHSFKTVLRQRAEGATISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIA 100

Query: 119 SNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFY 152
           +  YT    Q   ++K+ L+    ++WY  W+ +
Sbjct: 101 TTKYTRI--QYCPSNKFQLT--RRISWYFQWELH 130

>Kwal_33.13743 s33 complement(374832..377315) [2484 bp, 827 aa] {ON}
           YJL176C (SWI3) - transcription factor [contig 112] FULL
          Length = 827

 Score = 29.6 bits (65), Expect = 4.5,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 58  SVSDLRLSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKN-V 116
           S S+L+L+  + + ++  S  ++  +  I+SIEK S  EF    + SKT  ++   +N +
Sbjct: 338 SPSELQLAFPQSHEIIIPSYARWFHLKKIHSIEKQSLPEFFTNRVPSKTSQVYVKYRNFM 397

Query: 117 VNS 119
           VNS
Sbjct: 398 VNS 400

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,999,887
Number of extensions: 641203
Number of successful extensions: 3572
Number of sequences better than 10.0: 76
Number of HSP's gapped: 3561
Number of HSP's successfully gapped: 76
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)