Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0E001705.708ON57857830450.0
Kpol_1043.755.708ON55851824010.0
CAGL0H06633g5.708ON54453323480.0
YKR097W (PCK1)5.708ON54953123370.0
SAKL0E15048g5.708ON54252023170.0
KNAG0C066405.708ON54752523170.0
Smik_11.3615.708ON54953123140.0
Skud_11.3375.708ON54953123060.0
Suva_11.3345.708ON54853123050.0
NCAS0A031605.708ON55253222940.0
KLLA0A00484g5.708ON54352122870.0
TDEL0B021205.708ON54853122830.0
KAFR0H001605.708ON54952022740.0
NDAI0E050805.708ON55151722730.0
TBLA0E017005.708ON57653522520.0
ZYRO0B16456g5.708ON54853122410.0
Ecym_40135.708ON54252422220.0
KLTH0E00902g5.708ON54452022220.0
AFR292W5.708ON54151722180.0
Kwal_55.196635.708ON54452021990.0
Suva_7.275singletonON961131404e-10
NDAI0A005601.67ON71495940.010
SAKL0B05126g8.762ON706142840.16
TPHA0I021203.163ON908318790.65
NCAS0C008008.777ON1359233761.5
TPHA0O006001.380ON137261724.8
KLTH0F16456g5.416ON57165699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0E00170
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...  1177   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   929   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   909   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   904   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   897   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   897   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   895   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   892   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   892   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   888   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   885   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   884   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   880   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   880   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   872   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   867   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   860   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   860   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   858   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   851   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    59   4e-10
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    41   0.010
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    37   0.16 
TPHA0I02120 Chr9 (469624..472350) [2727 bp, 908 aa] {ON} Anc_3.1...    35   0.65 
NCAS0C00800 Chr3 complement(140171..144250) [4080 bp, 1359 aa] {...    34   1.5  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    32   4.8  
KLTH0F16456g Chr6 complement(1335576..1337291) [1716 bp, 571 aa]...    31   9.4  

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/578 (97%), Positives = 565/578 (97%)

Query: 1   MSAIFATETSREDIINNIKSLNDSSSLNTESQXXXXXXXXXXXXXLLEEFISDNLSNHQL 60
           MSAIFATETSREDIINNIKSLNDSSSLNTESQ             LLEEFISDNLSNHQL
Sbjct: 1   MSAIFATETSREDIINNIKSLNDSSSLNTESQNNTKIKNKNDTIKLLEEFISDNLSNHQL 60

Query: 61  INIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWWG 120
           INIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWWG
Sbjct: 61  INIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWWG 120

Query: 121 PVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMNN 180
           PVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMNN
Sbjct: 121 PVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMNN 180

Query: 181 MLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAGE 240
           MLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAGE
Sbjct: 181 MLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAGE 240

Query: 241 MKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIGD 300
           MKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIGD
Sbjct: 241 MKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIGD 300

Query: 301 DEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNST 360
           DEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNST
Sbjct: 301 DEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNST 360

Query: 361 ITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 420
           ITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 361 ITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 420

Query: 421 TSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGSS 480
           TSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGSS
Sbjct: 421 TSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGSS 480

Query: 481 YVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWTD 540
           YVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWTD
Sbjct: 481 YVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWTD 540

Query: 541 SSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
           SSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL
Sbjct: 541 SSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/518 (82%), Positives = 470/518 (90%)

Query: 61  INIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWWG 120
           I IKRNPP+A LYEDGLKE+ TTLSSTGAL+AYSGVKTGRSPKDKRIVEE  SKDNIWWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 121 PVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMNN 180
           PVNK CSE TW+INRERA+DYLNTR  LYVIDA+ GWD  YRIKIRVVCAR YHALFMNN
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 181 MLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAGE 240
           MLIRPT EELENFG+PDFT+WNAG F+ANSLT DM+SKTS+EINFK MEM ILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 241 MKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIGD 300
           MKKGIFTVMFYLMP+YHNVLTLHSSANQ  NNGDVTLFFGLSGTGKTTLSADPHR+LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 301 DEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNST 360
           DEHCWSD+GVFNIEGGCYAKCIGL++EKEP+IFNAIKFGSVLENC+YDE TH VDYD+S 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 361 ITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 420
           ITENTRCAYPID+I +AKIPCL DKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 421 TSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGSS 480
           TSKMAGTE GVTEP+PTFS+CFGQPFLALHPMKYA MLA+KM+ HKA+AWL+NTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 481 YVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWTD 540
           Y +GG RCPLKYTRAILDAIH+GSL NEEYETLP+FNL IPKN   VPSELLNP+ +W+D
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 541 SSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
               Y  AV++LG LF +NF  Y+D+AT++VI AGP L
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/533 (78%), Positives = 468/533 (87%), Gaps = 1/533 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +EE I   L  + ++  I+RN P A LY+D LKE KT +SS GALIAYSG KTGRSPKDK
Sbjct: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIVEEE S+DN+WWGPVNK CSERTWAINRERA DYL TR+TLYV+DAF GWDP+YRIK+
Sbjct: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL NFG+PDFTVWNAGQF AN+ T DM+SKT++EINF
Sbjct: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQ   NGDVTLFFGLSGTG
Sbjct: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI LS+EKEP+IF+AI+FGSVLEN 
Sbjct: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
           IYD E+HEVDYD+S+ITENTRCAYPID+I +AKIPCLA  HP N+ILLTCDASGVLPPVS
Sbjct: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFL+LHPM+YA+MLAEKM +H
Sbjct: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
            ANAWL+NTGWTGSSYVSGG RC LKYTRAILDAIHDGSL   E+E+LPIFNLQ+PK   
Sbjct: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
           GVPSELLNPA +W++    Y +AV +L  LF ENFKTY+DKAT++V+ AGP L
Sbjct: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/531 (78%), Positives = 467/531 (87%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +E+ I   L+ + ++  I+RN P A LYEDGLKENKT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP+IF+AIKFGSVLEN 
Sbjct: 256 KTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
           IYDE++H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 316 IYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM +H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           KANA+L+NTGWTGSSYVSGG RCPLKYTRAILD+IHDGSL NE YETLPIFNLQ+P   N
Sbjct: 436 KANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVN 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP+ELLNPA +W+     Y  AV  L  LF +NFK Y+D+AT +V+ AGP
Sbjct: 496 GVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGP 546

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/520 (79%), Positives = 461/520 (88%)

Query: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118
           +++ I+RN P A LYED LKE KTT+SS+GALIAYSG KTGRSP+DKRIV+E  S DN+W
Sbjct: 23  EVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKRIVDESTSTDNVW 82

Query: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178
           WGPVNK+CSERTW INRERA DYL TRD LY++DA+ GWDPRYRIK+RVVCARAYHALFM
Sbjct: 83  WGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVRVVCARAYHALFM 142

Query: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238
            NMLIRPT++EL  FG+PDFTVWNAGQF AN+ T  M+SKT+VEINFKEMEM ILGTEYA
Sbjct: 143 TNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFKEMEMIILGTEYA 202

Query: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 203 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGKTTLSADPHRLLI 262

Query: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358
           GDDEHCWSD+GVFNIEGGCYAKCIGLS EKEP+I+NAIKFGSVLEN IY+ +T EVDY++
Sbjct: 263 GDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVDYED 322

Query: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418
           S+ITENTRCAYPIDYI +AKIPCLAD HP+N++LLTCDASGVLPPVS+LTPEQVMYHFIS
Sbjct: 323 SSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFIS 382

Query: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478
           GYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM KH ANAWL+NTGWTG
Sbjct: 383 GYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHNANAWLINTGWTG 442

Query: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538
           SSYVSGG RCPLKYTRAILD+IHDGSL  E+YETLP FNL+IP   N VPSELLNPA +W
Sbjct: 443 SSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNNVPSELLNPAKNW 502

Query: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
            +    Y +AVQ L +LF ENFKTY+D+AT++V+ AGP L
Sbjct: 503 IEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/525 (78%), Positives = 457/525 (87%), Gaps = 1/525 (0%)

Query: 54  NLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELS 113
           NLS  ++I I+RN P A LYED L E KT ++S+GALIAYSG KTGRSPKDKRIVEEE S
Sbjct: 24  NLSK-EVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKRIVEEETS 82

Query: 114 KDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAY 173
           KDN+WWGPVNK CSERTW INRERA DYL TRD LY++DAF GWDP+YRIK+RVVCARAY
Sbjct: 83  KDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAY 142

Query: 174 HALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTIL 233
           HALFM NMLIRP+KEEL NFG+PDFTVWNAGQF AN  T DMSSK+++EINFK MEM IL
Sbjct: 143 HALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFKAMEMVIL 202

Query: 234 GTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADP 293
           GTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTGKTTLSADP
Sbjct: 203 GTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADP 262

Query: 294 HRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHE 353
           HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IF+AI+FGSVLEN  YDE++HE
Sbjct: 263 HRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVAYDEKSHE 322

Query: 354 VDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVM 413
           VDYD+STITENTRCAYPI+YI +AKIPCLAD HP N+ILLTCDASGVLPPV+KL+PEQVM
Sbjct: 323 VDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAKLSPEQVM 382

Query: 414 YHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLN 473
           YHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA MLA KM +HKANA+L+N
Sbjct: 383 YHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHKANAYLIN 442

Query: 474 TGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLN 533
           TGWTGSSYVSGG RCPLKYTRAILDAIHDGSL    YE+LPIFNL++P   NGVP ELLN
Sbjct: 443 TGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNGVPHELLN 502

Query: 534 PAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
           PA +W      Y  AV  L  LF ENFK Y+DKAT +V+ AGP+L
Sbjct: 503 PAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/531 (77%), Positives = 464/531 (87%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +E+ I   L+ + ++  I+RN P A LYEDGLKE KT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP+IF+AIKFG+VLEN 
Sbjct: 256 KTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVLENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
            YDE++H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 316 KYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM +H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAAKMSQH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           KANA+L+NTGWTGSSYVSGG RCPLKYTRAILD+IHDGSL NE YE+LPIFNLQ+P    
Sbjct: 436 KANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPTKVK 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP+ELLNPA +W+     Y  AV  L  LF ENFK Y+D+AT +V+ AGP
Sbjct: 496 GVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPDVLAAGP 546

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/531 (77%), Positives = 463/531 (87%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +E+ I   L+ + ++  I+RN P A LYEDGLKE KT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 76  RIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP+IF+AIKFG+VLEN 
Sbjct: 256 KTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVLENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
            YDE++H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 316 KYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM  H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSHH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           K+NA+L+NTGW+GSSYVSGG RCPLKYTRAILD+IHDGSL NE YE+LPIFNLQ+P    
Sbjct: 436 KSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPTKVK 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP+ELLNPA +W+     Y  +V  L  LF ENFK Y+D+AT +V+ AGP
Sbjct: 496 GVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPDVLAAGP 546

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/531 (77%), Positives = 462/531 (87%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +E+ I   L+ + ++  I+RN P A LYEDGLKE KT +SS+GALIAYSGVKTGRSPKDK
Sbjct: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DAF GWDP+YRIK+
Sbjct: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T DMSSK+++EINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQ   NGDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSDNGVFNIEGGCYAKCI LS EKEP+IF+AI+FG+VLEN 
Sbjct: 256 KTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVLENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
            YDE +H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILLTCDASGVLPPVS
Sbjct: 316 KYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA KM +H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           +ANA+L+NTGWTGSSYVSGGSRC LKYTRAILD+IHDGSL    YE+LPIFNLQ+P   N
Sbjct: 436 RANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPTKVN 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP+ELLNPA +W+     Y  AV  L  LF ENFK Y+D+AT +V+ AGP
Sbjct: 496 GVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGP 546

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/532 (76%), Positives = 459/532 (86%), Gaps = 1/532 (0%)

Query: 46  LLEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKD 104
           ++E+ I   L  +  +  I+RN P A LYED L E KT ++S+GALIAYSG KTGRSP+D
Sbjct: 19  IVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRD 78

Query: 105 KRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIK 164
           KRIVEEE SKDN+WWGPVNK CSE+TW INRERA DYL TRD LY++DAF GWDP+YRIK
Sbjct: 79  KRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 138

Query: 165 IRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEIN 224
           +RVVCARAYHA+FM NMLIRPT+EEL  FG+PDFT+WNAGQF AN  T DMSSKT++EIN
Sbjct: 139 VRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEIN 198

Query: 225 FKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGT 284
           FK MEM ILGTEYAGEMKKGIFTVMFYLMP+YHN+LTLHSSANQ   NGDVTLFFGLSGT
Sbjct: 199 FKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGT 258

Query: 285 GKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLEN 344
           GKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IFNAIK+GS+LEN
Sbjct: 259 GKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILEN 318

Query: 345 CIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPV 404
            IYD+ T  VDYD+++ITENTRCAYPI+YI +AKIPCLAD HP N+ILLTCDASGVLPPV
Sbjct: 319 VIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 378

Query: 405 SKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDK 464
           SKLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP++YA+MLAEK+  
Sbjct: 379 SKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISH 438

Query: 465 HKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNA 524
           H A+AWL+NTGWTGSSYV+GG RCPLKYTRAILD+IHDGSL  + YETLPIFNL +P   
Sbjct: 439 HSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAV 498

Query: 525 NGVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           NGVP E+LNPA +W++    Y TAV +LG LF ENFKTY+D+AT +V+ AGP
Sbjct: 499 NGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/521 (78%), Positives = 457/521 (87%), Gaps = 1/521 (0%)

Query: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118
           +++ I+RN P A LYED LKE  T +S+ GALIAYSG KTGRSP+DKRIVEEE SKDN+W
Sbjct: 23  EVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVW 82

Query: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178
           WGPVNK CSERTW INRERA DYL TRD +Y++DA+ GWDPRYRIK+RVVCARAYHALFM
Sbjct: 83  WGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFM 142

Query: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238
            NMLIRP+KEELENFG+PDFTVWNAGQF AN+ T+ M+SKT+VEINFK+MEM ILGTEYA
Sbjct: 143 TNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYA 202

Query: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 203 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLI 262

Query: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358
           GDDEHCWSD+GVFNIEGGCYAKC+GLS EKEP+IFNAIKFGSVLEN IYD  T EVDY++
Sbjct: 263 GDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYED 322

Query: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418
           STITENTRCAYPI+YI +AKIPCLAD HP N++LLTCDASGVLPPVSKLTP+QVMYHFIS
Sbjct: 323 STITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFIS 382

Query: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478
           GYTSKMAGTE GVTEP+ TFSSCFGQPFL+LHPMKYA+MLAEKM +H ANAWL+NTGWTG
Sbjct: 383 GYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTG 442

Query: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKN-ANGVPSELLNPAGS 537
           SSYV+GG RCPLKYTRAILDAIHDGSL  EEYE LPIFNLQIPK   + VP+ LLNP+ +
Sbjct: 443 SSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKN 502

Query: 538 WTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
           W +    Y + V+ L  LF ENFKTY+DKAT +V+ AGP L
Sbjct: 503 WAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAGPQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/531 (76%), Positives = 461/531 (86%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +E+ I D LS ++++I I+RN P A LYED L E KTT++S+GALIAYSG KTGRSPKDK
Sbjct: 16  VEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGDKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RI+EEE SKDNIWWGPVNK   E+TW+INRERA DYL TR  LY++DAF GWDPRYRIK+
Sbjct: 76  RIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT EEL +FG+PDFTVWNAGQF AN  T  MSSKT+VEINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ     DVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR+LIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEP+I+NAIKFGS+LEN 
Sbjct: 256 KTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSILENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
           +YD +T +VDY++S+ITENTRCAYPI++I +AKIPCLAD HP NL+LLTCDASGVLPP+S
Sbjct: 316 VYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLPPIS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP++YA+MLA+KM +H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKMSEH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           +ANAWL+NTGWTGSSYV+GG RCPLKYTRAILDAIHDGSL  E YETLP FNL IP   N
Sbjct: 436 RANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPTKVN 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP ELLNP+ +W +    Y TAV  L KLF ENFK Y+D+AT EV+ AGP
Sbjct: 496 GVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGP 546

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/520 (78%), Positives = 458/520 (88%), Gaps = 1/520 (0%)

Query: 60  LINIKRNPPVATLYEDGLKENK-TTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118
           +  I+RN PV+ LYED LK+ K T +SSTGALIAYSG KTGR PKDKRIVEE  SK++IW
Sbjct: 30  VTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKEDIW 89

Query: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178
           WGPVNK CSERTW INRERA DYL TR+ +Y++DAF GWDP+YRIK+RVVCARAYHALFM
Sbjct: 90  WGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHALFM 149

Query: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238
            NMLIRPTK+ELENFG PDFTVWNAGQF AN  T DMSSKT++EINFK MEM ILGTEYA
Sbjct: 150 TNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTEYA 209

Query: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298
           GEMKKGIFTVMFYLMPI+HNVLTLHSSAN+     DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 210 GEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLI 269

Query: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358
           GDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IFN+IKFGS+LEN +YD ++ EVDYD+
Sbjct: 270 GDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDYDD 329

Query: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418
           S+ITENTRCAYPI++I +AKIPC+A+ HP N+ILLTCDASGVLPPVSKLT +QVMYHFIS
Sbjct: 330 SSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHFIS 389

Query: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478
           GYTSKMAGTE GVTEPQPTFSSCFGQPFLALHPMKYA+MLAEKM+KHKANAWL+NTGWTG
Sbjct: 390 GYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGWTG 449

Query: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538
           SSY++GG RCPL YTRAILDAIHDGSL+ E +ETLPIFNL++PKN N VP++LLNP+ +W
Sbjct: 450 SSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPKNVNNVPTKLLNPSKNW 509

Query: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
            +    Y  AV++L KLF ENFKTYEDKAT EV+ AGP L
Sbjct: 510 YEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/517 (78%), Positives = 447/517 (86%)

Query: 60  LINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWW 119
           +  I+RN P A LYED L E  T +SSTGAL+AYSG KTGRSP+DKRIVEEE SKD+IWW
Sbjct: 33  VTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKRIVEEETSKDDIWW 92

Query: 120 GPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMN 179
           GPVNK CSERTW+INRERA DYL TRD LY++DAF GWDP YRIK+RVVCARAYHALFM 
Sbjct: 93  GPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVRVVCARAYHALFMT 152

Query: 180 NMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAG 239
           NMLIRPT+EEL  FG+PDFTVWNAGQF AN  T DMSSKT++EINFK MEM ILGTEYAG
Sbjct: 153 NMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFKAMEMVILGTEYAG 212

Query: 240 EMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIG 299
           EMKKGIFTVMFYLMP++HN+LTLHSSANQ   NGDVTLFFGLSGTGKTTLSADPHR LIG
Sbjct: 213 EMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIG 272

Query: 300 DDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNS 359
           DDEHCWSD GVFNIEGGCYAKCI LS EKEP+IF AIK+GS+LEN IYD +T  V YD+S
Sbjct: 273 DDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVIYDPKTRVVHYDDS 332

Query: 360 TITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISG 419
           T+TENTRCAYPI++I +AKIPCLAD HP+N+ILLTCDASGVLPPVSKLTPEQVMYHFISG
Sbjct: 333 TLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHFISG 392

Query: 420 YTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGS 479
           YTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA+K+ KH ANAWL+NTGWTGS
Sbjct: 393 YTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHSANAWLINTGWTGS 452

Query: 480 SYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWT 539
           SYVSGG RCPLKYTRAILD+IHDGSL  +E+ETLP+FNLQ+P N N VP ELLNPA +W 
Sbjct: 453 SYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAKNWA 512

Query: 540 DSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
                Y  AV  L  LF ENFK Y+DKAT EV+ A P
Sbjct: 513 QGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAP 549

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/535 (76%), Positives = 460/535 (85%), Gaps = 4/535 (0%)

Query: 46  LLEEFISDNLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           LL +   D   +  LINIK NP  A LYED LKE KT +SS+GALIAYSG KTGRSPKDK
Sbjct: 40  LLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDK 99

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RIV E+ SKDN+WWGPVNK CSE+TW INRER +DYL TR  LYVIDA+VGWDPRYR+K+
Sbjct: 100 RIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKV 159

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RVVCARAYHALFM NMLIRPT+EEL+NF +PDFTVWNAG F ANS T DM+SKTSVEINF
Sbjct: 160 RVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINF 219

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+     DVT+FFGLSGTG
Sbjct: 220 KAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTG 279

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADP+R LIGDDEHCWSD+GVFNIEGGCYAKCIGL++EKEP+IF+AI+FGSVLEN 
Sbjct: 280 KTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENV 339

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
            Y+E  H+VDY++  ITENTRCAYPIDYI +AKIPCLA+ HP NLILLTCDASGVLPPVS
Sbjct: 340 TYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVS 399

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP+ YA+MLA+KMD++
Sbjct: 400 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQY 459

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
           K+NAWL+NTGWTGSSY +GGSRCPLKYTRAILDAIHDG+L NE YETLP+FNLQIP + N
Sbjct: 460 KSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVN 519

Query: 526 GVPSELLNPAGSWTDSSE----DYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP+E+LNP  SW   +      Y  AV +L  LF ENFK Y+DKAT++V+ AGP
Sbjct: 520 GVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/531 (75%), Positives = 452/531 (85%), Gaps = 1/531 (0%)

Query: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105
           +EE I   L+   +++ I+ N P ATLYEDGLKE KT + S+GAL AYSG KTGRSPKDK
Sbjct: 16  VEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRSPKDK 75

Query: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165
           RI+EEE SK+ +WWGPVNK  SE+TW+INRERA DYL TRD LY+IDA+ GWDPRYRIK+
Sbjct: 76  RIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYRIKV 135

Query: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225
           RV+CARAYHALFM NMLIRP+ EEL NFG+PDFTVWNAGQF AN  T  M+SKT+VEINF
Sbjct: 136 RVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVEINF 195

Query: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ    GDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLSGTG 255

Query: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345
           KTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEP+I+NAIKFGSVLEN 
Sbjct: 256 KTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVLENV 315

Query: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405
           ++D    EVDY +++ITENTRCAYPIDYI +AKIPCLADKHP+N++LLTCDASGVLPPVS
Sbjct: 316 VFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLPPVS 375

Query: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPM+YA+MLA+KM +H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQH 435

Query: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525
            ANAWL+NTGWTGSSY +GG RCPLKYTRAILD+IHDGSL   +YETLPIFNL  P   N
Sbjct: 436 NANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPAKVN 495

Query: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           GVP  LLNPA SW +    Y +AV+ L   F ENFK Y+D+AT +V+ AGP
Sbjct: 496 GVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGP 546

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/524 (76%), Positives = 448/524 (85%), Gaps = 1/524 (0%)

Query: 55  LSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSK 114
           LS+  LI I+RN P A LYED L E  T +SSTGALIAYSG KTGRSPKDKRIV+E  S 
Sbjct: 20  LSSGVLI-IRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSA 78

Query: 115 DNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYH 174
           + +WWGPVN++ SERTW INRERAVDYL TR+ LY++DAF GWDPRYRIKIR+VC RAYH
Sbjct: 79  NKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIKIRIVCCRAYH 138

Query: 175 ALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILG 234
           ALFM NMLIRPT+EEL  FG+PDFTVWNAGQF AN+ T  MSSKT+VEINFK MEM ILG
Sbjct: 139 ALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFKAMEMVILG 198

Query: 235 TEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPH 294
           TEYAGEMKKGIFTVMFYLMPI HNVLTLHSSANQ    GDVTLFFGLSGTGKTTLSAD H
Sbjct: 199 TEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGTGKTTLSADQH 258

Query: 295 RQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEV 354
           R LIGDDEHCWSD GVFNIEGGCYAKCIGLS EKEP+IFNAI++GSVLEN +Y+  +  V
Sbjct: 259 RLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLENVVYEPVSRVV 318

Query: 355 DYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMY 414
           DYD+S+ITENTRCAYPI+YI +AKIPCL++ HP+N++LLTCDASGVLPPVSKLTPEQVMY
Sbjct: 319 DYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPVSKLTPEQVMY 378

Query: 415 HFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNT 474
           HFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM +H ANAWL+NT
Sbjct: 379 HFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNANAWLINT 438

Query: 475 GWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNP 534
           GWTG+SYVSGG RCPLKYTRAILDAIH GSL N +YETLP+F L IP+   GVPSELLNP
Sbjct: 439 GWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAVEGVPSELLNP 498

Query: 535 AGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
           + +W +  E Y  AV  L  LF +NFK Y+D+AT EV+ AGP L
Sbjct: 499 SRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/520 (75%), Positives = 452/520 (86%)

Query: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118
           +++ I+RN P A LYED LKENKTT++S+GALIA+SG KTGRSPKDKRIV+E  S  NIW
Sbjct: 25  EVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIW 84

Query: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178
           WGPVNK+CSE+TW +NRERA DYL TRD LY++DA+ GWDPRYRIKIRVVCARAYHALFM
Sbjct: 85  WGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFM 144

Query: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238
            NMLIRPTKEELENFG+PDFTVWNAGQF AN+ T+ M+SKT+VEINF++MEM ILGTEYA
Sbjct: 145 TNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYA 204

Query: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADP R+LI
Sbjct: 205 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLI 264

Query: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358
           GDDEHCWSD+GVFNIEGGCYAKCIGL++ KEP+IFNAIKFGSVLEN  YD  T  VDY++
Sbjct: 265 GDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYED 324

Query: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418
             ITENTRCAYPI+YI +AKIPCLA+ HP N++LLTCDASGVLPPVSKLTP QVMYHFIS
Sbjct: 325 CEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFIS 384

Query: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478
           GYTSK+AGTE GVTEP+ TFSSCFGQPFLALHP+KYA+MLAEKM +H+ANAWL+NTGWTG
Sbjct: 385 GYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTG 444

Query: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538
           +S+V GG+RCPLKYTRAILDA+HDGSL  E++ETLP F L +P++ N VP  +LNPA +W
Sbjct: 445 ASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNW 504

Query: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
            +    Y   V  L KLF ENFK Y+D+A+ +VI AGPVL
Sbjct: 505 FEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/517 (76%), Positives = 446/517 (86%), Gaps = 1/517 (0%)

Query: 60  LINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWW 119
           ++ I+RN P A LYED L E KT +SSTGALIAYSG KTGRSPKDKRIV+E  S DNIWW
Sbjct: 24  VLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWW 83

Query: 120 GPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMN 179
           GPVN++ SE+TW INRERA D+L TR+ LY++DA+ GWDPRYRIKIR+VC RAYHALFM 
Sbjct: 84  GPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMT 143

Query: 180 NMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAG 239
           NMLIRPT+EEL  FG+PDFTVWNAGQF AN+ T  MSSKT+VEINF+ MEM ILGTEYAG
Sbjct: 144 NMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEYAG 203

Query: 240 EMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIG 299
           EMKKGIFTVMFYLMPI HNVLTLHSSANQ  NN DVTLFFGLSGTGKTTLSAD HR+LIG
Sbjct: 204 EMKKGIFTVMFYLMPINHNVLTLHSSANQGPNN-DVTLFFGLSGTGKTTLSADQHRKLIG 262

Query: 300 DDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNS 359
           DDEHCWSD GVFNIEGGCYAKCIGLS EKEP+IFNAIK+GSVLEN +YD  T  VDY++S
Sbjct: 263 DDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDS 322

Query: 360 TITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISG 419
           +ITENTRCAYPI+YI +A+IPCL++ HP+N++LLTCDASGVLPPVS+LTPEQVMYHFISG
Sbjct: 323 SITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISG 382

Query: 420 YTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGS 479
           YTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM +H A+AWL+NTGWTGS
Sbjct: 383 YTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGS 442

Query: 480 SYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWT 539
           SY +GG RCPLKYTRAILD+IHDG+L   EYETLP+F L IPK   GVP+ELLNPA +W 
Sbjct: 443 SYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWV 502

Query: 540 DSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576
           +    Y +AV  L   F ENFK Y+D+AT EV++AGP
Sbjct: 503 EGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/520 (75%), Positives = 447/520 (85%)

Query: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118
           +++ I+RN P A LYED LKENKT +S++GALIA+SG KTGRSPKDKRIV+E  S  NIW
Sbjct: 25  EVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGSKTGRSPKDKRIVDEPTSSQNIW 84

Query: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178
           WGPVNK+CSE+TW +NRERA D+L TRD LY++DA+ GWDPRYRIKIRVVCARAYHALFM
Sbjct: 85  WGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFM 144

Query: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238
            NMLI+PT +ELE FG+PDFTVWNAGQF AN+ T+ M+SKT++EINF++MEM ILGTEYA
Sbjct: 145 TNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIEINFQKMEMVILGTEYA 204

Query: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298
           GEMKKGIFTVMFYLMPI H VLTLHSSANQ   + DVTLFFGLSGTGKTTLSADP R+LI
Sbjct: 205 GEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLSGTGKTTLSADPARKLI 264

Query: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358
           GDDEHCWSD+GVFNIEGGCYAKCIGL++ KEP+IFNAI+FGSVLEN  YD  T EVD++N
Sbjct: 265 GDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVLENVAYDSFTREVDFEN 324

Query: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418
             ITENTRCAYPI+YI +AKIPCLAD+HP N++LLTCDASGVLPPVSKLTPEQVMYHFIS
Sbjct: 325 CEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLPPVSKLTPEQVMYHFIS 384

Query: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478
           GYTSK+AGTE GVTEP+ TFSSCFGQPFLALHP+KYA+MLA+KM  HKA+AWL+NTGWTG
Sbjct: 385 GYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKMSHHKADAWLINTGWTG 444

Query: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538
            S+V GG RCPLKYTRAILDAIHDG+L  EEYETLP FNL IP + N VPS +LNPA SW
Sbjct: 445 QSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPLHVNNVPSNILNPARSW 504

Query: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578
                 Y T V+ L  LF ENFK YE  A+ E++ AGP+L
Sbjct: 505 VGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGPLL 544

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 56/113 (49%), Gaps = 22/113 (19%)

Query: 407 LTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHK 466
           LT E+VMYHF SG+ S   G                 +PFLALHP+ Y +++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 467 ANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNE-----EYETLP 514
            +A+L+NTG+             LK TR   D+IHD SL  E      Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 13/95 (13%)

Query: 267 NQENNNGDVTLFFGLSGTGKTTLSADPHRQL-IGDDEHCWSDNGVFNIEGGCYAKCIGLS 325
           N E N G+     G SG+GK+T+++   R   + +      DN + N     Y + IG +
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 326 KEKEPDIFNAIKFGSVLENCIY-------DEETHE 353
            ++EP +FN    GS+L+N IY        E+ HE
Sbjct: 526 VQQEPSLFN----GSILDNIIYAIPPELTSEKQHE 556

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 97  KTGRSPKDKRIVEEELSKDNIWWGPVNKQCSERTWA-INRERAVDYLNTR---------D 146
           K GR  +DK I++++    N+ W   N+   ++T++ ++  +  DY+            +
Sbjct: 103 KRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPKLSN 162

Query: 147 TLYVIDAFVGWDPRYRIKIRV---VCARAYH--ALFMNNMLIRPTKEELENFGKPDFTVW 201
            L  I   V  + +Y   + +   V  R  H    F N +L + + EEL  FG  D T++
Sbjct: 163 LLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID-TIF 221

Query: 202 NAGQFFANSLTNDMSSKTSVEI 223
           +  + F  S+ + +S  + V+ 
Sbjct: 222 SLSKIFVRSIMDSLSKCSGVKF 243

>TPHA0I02120 Chr9 (469624..472350) [2727 bp, 908 aa] {ON} Anc_3.163
           YOL063C
          Length = 908

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 121/318 (38%), Gaps = 47/318 (14%)

Query: 257 HNVLTLHSSANQENNNGDVTL----FFGLSGTGKTTLSADPHRQL--IGD----DEHCWS 306
           HN+ +L     Q ++NG++ L     FG   T K  L  D ++ +  I D    DE+CW+
Sbjct: 367 HNIPSLKFLPEQVDSNGNILLVFASIFGNVATMKIKLDKDFNKIVCNIHDYQLFDEYCWN 426

Query: 307 DNGVFNIEGGCYAKC-------IGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNS 359
              + N++   + K        +      +  I ++I   S L   +   E+  V  D  
Sbjct: 427 ---IINLKRTDFLKVSKFEFLTLNYQNNYKKSIISSIYQDSTLFGLV--PESVLVSDDLG 481

Query: 360 TITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDAS---GVLPPVSKLTPEQVMYHF 416
             T  T+ + P+  IS+ +   +             D S   G L P   LT + +  ++
Sbjct: 482 IGTLTTQISVPLSNISHRRTDYIDSDIKLRYTCFDDDNSIIEGTLKPEIALTYDPLSEYY 541

Query: 417 ISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYAS----------MLAEKMDKHK 466
              Y + +   +  V       S C   PF+      + S          +  EK+D + 
Sbjct: 542 DYNYDNSLTWDD-KVKYSTRIQSLCHYHPFMDYSKFDFGSNFNQTFEKWIISNEKLDDNN 600

Query: 467 ANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANG 526
            N      G T S+Y+       L+Y     D   + +L   +   L    ++  K  N 
Sbjct: 601 RNG----NGKTESNYL-------LEYAFTFTDGNAEANLGRSQKLKLCQEMIEDNKYENN 649

Query: 527 VPSELLNPAGSWTDSSED 544
            PS+LL  +  W +SS+D
Sbjct: 650 KPSQLLYISNDWYESSDD 667

>NCAS0C00800 Chr3 complement(140171..144250) [4080 bp, 1359 aa] {ON}
           Anc_8.777
          Length = 1359

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 93/233 (39%), Gaps = 53/233 (22%)

Query: 67  PPVATLYEDGLKENKT-----TLSSTGALIAYSGVKTGRSPKDKRIV-----EEELSKDN 116
           P V   Y   LK++KT         TGA +AY   K   S + K  V     E + S  N
Sbjct: 635 PRVGKAY--NLKKDKTFDVEFVDKETGATVAYCH-KLVLSSQCKSFVRSLHEENQFSFKN 691

Query: 117 IWWG-PVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFV------GWDPRYRIKIRVVC 169
           +     +N    +R W I  ER  DYL   D L  +  F+           Y + + ++ 
Sbjct: 692 VKVSLRLNSDFDQREWVILIERERDYLAFNDVLKQLLHFLYTNEIPSEQKAYSLLVEMIH 751

Query: 170 ARAYHALFMN------NMLIRPTKEELE-NFGKPDFT-VWNAGQFFANSL---------T 212
              Y +  ++      +M++ P K+  + +F KPD   +   G+  A+SL         +
Sbjct: 752 GSPYRSALLDATNSLLSMILEPPKQVKQYSFEKPDVVIILKDGKIHAHSLILRTGSLFFS 811

Query: 213 NDMSSKTS-------VEINFKEMEMT--------ILGTEYAGEMKKGIFTVMF 250
           N + SK         VE+N + +           I GT+Y  ++ KG FT  F
Sbjct: 812 NLLRSKYETIDESGCVEVNLQHINTDHFTYLLKYIYGTQYC-DIFKGCFTGTF 863

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 9/61 (14%)

Query: 487 RCPLKYTR----AILDAIHD-----GSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGS 537
           +CP+ +T+    AI   +++      S+Q  E E +PI  +  PK    +P E  NP  S
Sbjct: 359 KCPIDHTKYQELAITSKVNNQPITSASIQKSEEEKIPIIQMTSPKIIKNIPLESTNPLPS 418

Query: 538 W 538
           +
Sbjct: 419 F 419

>KLTH0F16456g Chr6 complement(1335576..1337291) [1716 bp, 571 aa]
           {ON} similar to uniprot|P38817 YHR108W Saccharomyces
           cerevisiae GGA2 Golgi-localized protein with homology to
           gamma-adaptin
          Length = 571

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 52  SDNLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIA-YSGVKTGRSPKDKRIVEE 110
           S  L N +L+ +KR    A L++D L  ++T   S   L+  YS +K  + PK ++I+EE
Sbjct: 232 SKQLINDELVKLKRK---ADLFKDMLSASETPDFSNETLVELYSALKVSQ-PKFQKIIEE 287

Query: 111 ELSKD 115
           E   D
Sbjct: 288 EHEDD 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,015,782
Number of extensions: 3016250
Number of successful extensions: 8536
Number of sequences better than 10.0: 32
Number of HSP's gapped: 8746
Number of HSP's successfully gapped: 32
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)