Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D046405.706ON96296245530.0
YIL151C5.706ON11189373132e-28
Skud_9.175.706ON11189352991e-26
Smik_9.185.706ON11189372783e-24
Suva_9.375.706ON11179312774e-24
KLTH0E00968g5.706ON11485752392e-19
Smik_11.3605.706ON11804992382e-19
KLLA0A00528g5.706ON12298712373e-19
Suva_11.3335.706ON11874972257e-18
TDEL0B021405.706ON11475132203e-17
CAGL0H06611g5.706ON12825962193e-17
YKR096W5.706ON11954972132e-16
Skud_11.3365.706ON11884882033e-15
Kpol_1043.735.706ON12605021971e-14
SAKL0E15004g5.706ON11964281972e-14
CAGL0G02541g5.706ON12953251764e-12
ZYRO0B16412g5.706ON13723241703e-11
KNAG0C066305.706ON12813311641e-10
TPHA0E001905.706ON13615401622e-10
AFR290W5.706ON12172531613e-10
Kwal_55.196785.706ON11783231585e-10
Ecym_40155.706ON12574121585e-10
KAFR0H001805.706ON12413291542e-09
TBLA0E017105.706ON15262051362e-07
NCAS0A031705.706ON13192111238e-06
NDAI0E050705.706ON15562111103e-04
Kwal_23.41294.273ON11170780.23
Kpol_1018.1841.525ON228106707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04640
         (962 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...  1758   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   125   2e-28
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   119   1e-26
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   111   3e-24
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   111   4e-24
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...    97   2e-19
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...    96   2e-19
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...    96   3e-19
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...    91   7e-18
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...    89   3e-17
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...    89   3e-17
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...    87   2e-16
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...    83   3e-15
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...    80   1e-14
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...    80   2e-14
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...    72   4e-12
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...    70   3e-11
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...    68   1e-10
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...    67   2e-10
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...    67   3e-10
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...    65   5e-10
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...    65   5e-10
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...    64   2e-09
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...    57   2e-07
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...    52   8e-06
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...    47   3e-04
Kwal_23.4129 s23 (585306..585641) [336 bp, 111 aa] {ON} YLR408C ...    35   0.23 
Kpol_1018.184 s1018 complement(462259..462945) [687 bp, 228 aa] ...    32   7.7  

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score = 1758 bits (4553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 877/962 (91%), Positives = 877/962 (91%)

Query: 1   MSAYTGNMNKDNKRILQSIDEPWFSLKFRKVSPSVKEYGSQSKGDLDSKKCXXXXXXXXX 60
           MSAYTGNMNKDNKRILQSIDEPWFSLKFRKVSPSVKEYGSQSKGDLDSKKC         
Sbjct: 1   MSAYTGNMNKDNKRILQSIDEPWFSLKFRKVSPSVKEYGSQSKGDLDSKKCSETEPVTPE 60

Query: 61  XXXXXXIAPIKPVNSSQHSKPVADIEKSIEIDHMLNADEKLDPLAGLLPLFMSIERAETS 120
                 IAPIKPVNSSQHSKPVADIEKSIEIDHMLNADEKLDPLAGLLPLFMSIERAETS
Sbjct: 61  SETVSPIAPIKPVNSSQHSKPVADIEKSIEIDHMLNADEKLDPLAGLLPLFMSIERAETS 120

Query: 121 IETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKE 180
           IETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKE
Sbjct: 121 IETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKE 180

Query: 181 YVTKGRLNERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHML 240
           YVTKGRLNERLINHCLKPLLEIIENYKNHMK                         THML
Sbjct: 181 YVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHML 240

Query: 241 EEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKES 300
           EEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKES
Sbjct: 241 EEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKES 300

Query: 301 DIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQV 360
           DIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQV
Sbjct: 301 DIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQV 360

Query: 361 NLKQSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKP 420
           NLKQSMGGTTILMKY                  MERSSLHYFWNEFANEYHLNYSSLRKP
Sbjct: 361 NLKQSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKP 420

Query: 421 VNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKSSDDFEIKSVSLSN 480
           VNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKSSDDFEIKSVSLSN
Sbjct: 421 VNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKSSDDFEIKSVSLSN 480

Query: 481 WKILIEQMDDTLLHSNXXXXXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXXX 540
           WKILIEQMDDTLLHSN        MLNVAISQPFILPWLLFYISVASEVANVTDRHV   
Sbjct: 481 WKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLL 540

Query: 541 XXXXXXXXXPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNF 600
                    PWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNF
Sbjct: 541 WKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNF 600

Query: 601 QEISMCEGFIWFDSLASKIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAX 660
           QEISMCEGFIWFDSLASKIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRA 
Sbjct: 601 QEISMCEGFIWFDSLASKIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAL 660

Query: 661 XXXXXXKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNNNAVIIDD 720
                 KNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNNNAVIIDD
Sbjct: 661 LIILLIKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNNNAVIIDD 720

Query: 721 TLHGRNRIFKFSYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRL 780
           TLHGRNRIFKFSYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRL
Sbjct: 721 TLHGRNRIFKFSYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRL 780

Query: 781 LSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLN 840
           LSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLN
Sbjct: 781 LSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLN 840

Query: 841 ELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKF 900
           ELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKF
Sbjct: 841 ELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKF 900

Query: 901 KNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVASLQDW 960
           KNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVASLQDW
Sbjct: 901 KNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVASLQDW 960

Query: 961 LL 962
           LL
Sbjct: 961 LL 962

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 192/937 (20%), Positives = 361/937 (38%), Gaps = 164/937 (17%)

Query: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187
            Q  L+L  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 227  QRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 286

Query: 188  NERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKF 247
             +RL  + +   L++++N+ N M                          ++MLE+IPLK+
Sbjct: 287  EKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV----------SNMLEDIPLKY 336

Query: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382

Query: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL----NKQVNLK 363
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I         +   N  
Sbjct: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441

Query: 364  QSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423
            +     + L+ Y                  ++   L YF ++F  +++ N     K + C
Sbjct: 442  EIAHRNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKDKFGKDFNGNDVFDTKDMFC 500

Query: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYK----------------- 466
            +  +       +YF +AP F+   +++ I      NPF  +++                 
Sbjct: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS 556

Query: 467  -------SSDDFEIK--------------------SVSLSNWKILIEQMDDTLLHSNXXX 499
                    +D F+++                      +L+ W   +  ++ T +  +   
Sbjct: 557  EATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV 616

Query: 500  XXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLN 559
                    + ++ P  L WL F +++  ++  V  + V            PW+ IVT  N
Sbjct: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN 676

Query: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617
              +  +  N H      L+  ++   S  L DL+ Y     N  EI  C G +WFD+   
Sbjct: 677  VLVCYMLDNLHPF----LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDA--- 729

Query: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPEL- 676
             IK+  +     +     +++  D +++D+ D+V  K W R+       K +   +P+L 
Sbjct: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG 788

Query: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFEL--------NNNN-------AVIIDDT 721
            + VS +        C +N D   + +L +  F+L        N+NN        + I++ 
Sbjct: 789  LKVSFQASVF----CRRN-DIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEE 843

Query: 722  LHGRN---------------RIFKFS----YIPDFQDFDKNGDI--TWGYSLISNYDYIY 760
            +   N                IF+++      PD+  FDKNG     + YS  SN     
Sbjct: 844  IEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGV 903

Query: 761  SNDFNSEE-----DGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHS 815
            + D + E      + N    + +         S+   + Y   L   YF++D  +WL+H 
Sbjct: 904  TLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTL---YFVIDATSWLRHF 960

Query: 816  NKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK 875
              + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY   +I  ++
Sbjct: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRG-SKDDTVVEAATRSVITIRQLYDEKKIIPMR 1019

Query: 876  -------------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTKEN-GPGQQLNMIE 919
                         EFE  I+    +       I   N +F+ + LT EN   G++     
Sbjct: 1020 FTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEF---- 1075

Query: 920  LRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956
                  V+V+DD       K +     +TK LFS+ S
Sbjct: 1076 -----AVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  119 bits (299), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 194/935 (20%), Positives = 367/935 (39%), Gaps = 160/935 (17%)

Query: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187
            Q  LFL  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 227  QRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 286

Query: 188  NERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKF 247
             +RL  + +   L++++N+ N M                          + MLE+IPLK+
Sbjct: 287  EKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV----------SSMLEDIPLKY 336

Query: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382

Query: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKII-SKLLNKQ---VNLK 363
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I  S  +++     N  
Sbjct: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNN 441

Query: 364  QSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423
            ++    + L+ Y                  ++   L YF ++F  +++ N     K + C
Sbjct: 442  ETAHRNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKDKFGKDFNGNDIFDTKDMFC 500

Query: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCV------------------- 464
            +  +       +YF +AP F+   +++ I      NPF  +                   
Sbjct: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKS 556

Query: 465  -------YKSSDDFEIKSVS-LSNWKILIEQMDD-----------------TLLHSNXXX 499
                   Y+   D +I S S   N   L    DD                 T +  +   
Sbjct: 557  GATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHV 616

Query: 500  XXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLN 559
                    + ++ P  L WL F +++  ++  V  + V            PW+ +V   N
Sbjct: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLAN 676

Query: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617
              +  +  N H      L   ++   S  L DL+ Y     N  EI  C G +WFD+   
Sbjct: 677  VLVCYMLDNIHPF----LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDA--- 729

Query: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPEL- 676
             IK+  +     +     +++  D +++D+ D++  + W R+       K V   +P+L 
Sbjct: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLG 788

Query: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLF-DWGFEL--------NNNN-------AVIIDD 720
            + V+ +        C +N   ++ DY   ++ F+L        N+NN        + I++
Sbjct: 789  LKVNFQAPVF----CRRN--DISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINE 842

Query: 721  TLHGRNR---------------IFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYS 761
             +   NR               IF+++      PD+  FDKNG    G+    N  +IYS
Sbjct: 843  KIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNG----GF----NSAFIYS 894

Query: 762  NDFNSEEDGNFFQRYSRRLL-SAHNDYSEDKSKKYLPKLENN------------YFMVDT 808
              +++  +G      S  +  +A+N+ S    K +  ++               YF++D 
Sbjct: 895  Q-WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDA 953

Query: 809  LAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAM 868
             +WL+H   + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY  
Sbjct: 954  TSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDE 1012

Query: 869  NQINILKEFESPISKALKNIDGSQILNFNG---KFKNDLLTKENGPGQQLNMIELRMDN- 924
             +I  L+   +  +   +N++  + + +     +F  D + K N   Q   +I+   +  
Sbjct: 1013 KKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKN 1072

Query: 925  ---VVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956
                V+V+DD       K K     +TK LFS+ S
Sbjct: 1073 NAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGS 1107

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 184/937 (19%), Positives = 358/937 (38%), Gaps = 164/937 (17%)

Query: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187
            Q  L+L  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +    +
Sbjct: 227  QRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGM 286

Query: 188  NERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKF 247
             +RL  + +   L++++N+ N M                          ++MLE+IPLK+
Sbjct: 287  EKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV----------SNMLEDIPLKY 336

Query: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382

Query: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL----NKQVNLK 363
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I         +   N  
Sbjct: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNN 441

Query: 364  QSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423
            ++    + L+ Y                  ++   L YF N+F  +++ N     K + C
Sbjct: 442  ETAHKNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKNKFGKDFNGNDVFDTKDMFC 500

Query: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKS---------------- 467
            +  +       +YF +AP F+   +++ I      NPF  +++                 
Sbjct: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS 556

Query: 468  ----------------------------SDDFEIKSVSLSNWKILIEQMDDTLLHSNXXX 499
                                        S +F+    +L+ W   +  ++ T +  +   
Sbjct: 557  SATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHV 616

Query: 500  XXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLN 559
                      I+ P  L WL F +++   +  +  + V            PW+ +V+  N
Sbjct: 617  LTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLAN 676

Query: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617
              +  +  N H    K L +      S  L DL+ +     N  EI  C G +WFD+   
Sbjct: 677  VLVCYMLDNLHPFLKKELESFY----SFELDDLIEHFNENENLPEIWKCWGSLWFDA--- 729

Query: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPEL- 676
             IK+  +     +     +++  D +++D+ D++  + W R+       K +   +P+L 
Sbjct: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLG 788

Query: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNNN---------------AVIIDDT 721
            + V+ +        C +N D   + +L  + F+L+  +                + I++ 
Sbjct: 789  LKVNFQAPVF----CRRN-DIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINEK 843

Query: 722  LHGRN---------------RIFKFS----YIPDFQDFDKNGDI--TWGYSLISN----- 755
            +   N                IF+++      PD+  FDKNG     + YS  SN     
Sbjct: 844  IDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGV 903

Query: 756  ---------YDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMV 806
                     YD +  ND +   +  FF R    + +A+ +  E+ +          YF+V
Sbjct: 904  PIDVSNEPIYD-VTDNDLSLHWEKIFFDR----IAAAYKNCDENDNCTI-------YFVV 951

Query: 807  DTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866
            D  +WL+H   + +      +   + ++   +L  L+  S+ ++V  +A+R +I I  LY
Sbjct: 952  DATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLY 1010

Query: 867  AMNQINILKEFESPISKALKNIDGSQILNFNG---KFKNDLLTKENGPGQQLNMIELRMD 923
               +I  ++   +  +   +N++  + + +     +F  D + K N   Q   MI    +
Sbjct: 1011 DERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKN 1070

Query: 924  N----VVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956
                  V+V+DD       K K     +TK LFS+ S
Sbjct: 1071 KNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGS 1107

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  111 bits (277), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 193/931 (20%), Positives = 361/931 (38%), Gaps = 152/931 (16%)

Query: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187
            Q  L+L  ++      L  ++KL+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 226  QRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 285

Query: 188  NERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKF 247
             +RL  + +   L++++++ N M                          ++MLE+IPLK+
Sbjct: 286  EKRLWVYGIITFLDVLKSFSNFMD----------PEVCCQFITYAFICISNMLEDIPLKY 335

Query: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 336  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 381

Query: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKII-SKLLNKQ---VNLK 363
              Y++++ +Q +SL   V L K +  ++     +   QL I+ I  S  +++     N  
Sbjct: 382  -LYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNN 440

Query: 364  QSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423
            ++    + L+ Y                  ++   L YF ++F  +++ N     K + C
Sbjct: 441  ETAHRNSQLIDY-LKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFC 499

Query: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYK----------------- 466
            +  +       +YF +AP F+   I++ I      NPF  +++                 
Sbjct: 500  QNPES----LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKS 555

Query: 467  ----------------SSD-----------DFEIKSVSLSNWKILIEQMDDTLLHSNXXX 499
                            SS+           DF     ++  W   +  ++ T +  +   
Sbjct: 556  GAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQV 615

Query: 500  XXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLN 559
                    +A++ P  L WL F I+V  ++  +    V            PW+ +VT+ N
Sbjct: 616  LTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSN 675

Query: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617
              +  +  N H    K L        S  L DL+ Y     N  E+  C G +WFD+   
Sbjct: 676  VLVCYMLDNLHPFLEKQLEKFY----SLELDDLIEYFNENENLPEVWKCWGSLWFDA--- 728

Query: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPEL- 676
             +K+  +     +     +++  D +++D  D++  K W R+       K +   +P+L 
Sbjct: 729  -VKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLG 787

Query: 677  ------IDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNN-----NAVIIDDTLHGR 725
                    V  R   ++    +KN     + Y  D  F  NN      + + I++ +   
Sbjct: 788  LKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEED-AFNDNNELDELYDTIEINELIETV 846

Query: 726  N---------------RIFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNS 766
            N                IF+++       D+  FDKNG    G+    N  +IY+  +++
Sbjct: 847  NIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNG----GF----NSAFIYTQ-WSN 897

Query: 767  EEDGNFFQRYSRRLL-SAHNDYSEDKSKKYLPKL----ENN--------YFMVDTLAWLK 813
              +G      S  L  S  ND S   +K    K+    +N         YF++D  +WL+
Sbjct: 898  VGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLR 957

Query: 814  HSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINI 873
            H   + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY   +I I
Sbjct: 958  HFAHIFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKI-I 1015

Query: 874  LKEFESPISKAL-KNIDGSQILNFNG---KFKNDLLTKENGPGQQLNMIELRMDN----V 925
               F   I+  + +N++  + + +     +F  D + K N   Q    I+          
Sbjct: 1016 PMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFA 1075

Query: 926  VVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956
            V+V+DD       K K     +TK LFS+ S
Sbjct: 1076 VLVTDDDNMNQKAKDKMIKTCNTKYLFSLGS 1106

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1148

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 106/575 (18%), Positives = 225/575 (39%), Gaps = 86/575 (14%)

Query: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206
           ++K++T++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  H     L++++N+
Sbjct: 253 IYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNF 312

Query: 207 KNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266
            N M                          ++ML ++P KF   W   +GDL+R+ + L 
Sbjct: 313 SNFMD----------PEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALY 362

Query: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326
                 ++L++ H Y       A+++   +GK           Y+++S VQ ++L   V 
Sbjct: 363 PSGFIDWKLSAEHWY-----TQALSHIFGHGK----------LYYHMSTVQQNTLEAFVN 407

Query: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXXXXX 386
           L K +   +T +  +   QL ID I  +   ++    Q     +++++Y           
Sbjct: 408 LGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR---NSLMVEY-LKHSEVMLLS 463

Query: 387 XXXXXXXMERSSLHYFWNEFA----NEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPL 442
                  +++  L +F N+F     N  + ++ ++          ++   + ++F +AP 
Sbjct: 464 SFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFL--------QDGERTKYFFRHAPA 515

Query: 443 FSLISIVETIIMNKKLNPFFCVYK---------------------SSDDFEIKSVS---- 477
           F+   I++ +      NPF  +++                     S    E  S +    
Sbjct: 516 FAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIE 575

Query: 478 -----------------LSNWKILIEQMDDTLLHSNXXXXXXXXMLNVAISQPFILPWLL 520
                            L+ W+  +  ++ T +  +           +  +   +LPW  
Sbjct: 576 YLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAY 635

Query: 521 FYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINSKTLRALIK 580
           F +S+A  +  +    +            PW+ IV +LN  I     ++  + ++  L +
Sbjct: 636 FLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCE 695

Query: 581 NIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASK--IKQASITTNESLMKFKSYNA 638
              S  +  L+ +     +  E+  C G +WFD ++ K  +     T N S+      + 
Sbjct: 696 QFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYN-SVQDHMFGDM 754

Query: 639 SEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDY 673
             D + +D+DD+  ++ W RA       K +  ++
Sbjct: 755 PVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF 789

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 802  NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIV 861
            +YF+ D  +WL+H   + +      ++  + ++   +L  L+  S+ ESV  +A+R +I 
Sbjct: 968  SYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRK-SKDESVVEAATRAVIT 1026

Query: 862  INYLYAMNQINILK 875
            +  LY+  ++  L+
Sbjct: 1027 VRQLYSEKRLLPLR 1040

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 109/499 (21%), Positives = 214/499 (42%), Gaps = 66/499 (13%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + ++ P +LPW+ F IS+  +   + D               PWD +VT++N  I  +  
Sbjct: 687  LGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLD 746

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTN 627
            +  ++  +  L       +L +LL       +  EI  C G +WFD++  K    SI++ 
Sbjct: 747  NETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFDAICQK-NTHSISSE 805

Query: 628  ESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIR 682
            ++  +     + + ++  D +I+DD D+   K W RA       + V   +P  + V +R
Sbjct: 806  DNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSRSFP--LGVIVR 863

Query: 683  GQSLTNSSCIKNS----------DSLTN-----------DYLFDWG---FELNNNNAVII 718
               L N S ++++          + LTN           + +FD      E+N +   + 
Sbjct: 864  HDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDISEARSEINTDLHAVP 923

Query: 719  DDTLHGRNRIFKF----SYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQ 774
            + ++   + IF +       PD+  FDKNG+     SL +++ Y+ + + N E + ++  
Sbjct: 924  ELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFL-SASLYTSW-YVPNCNNNLETNISYAN 981

Query: 775  RYSRRLLSAHNDYSEDKSKKYLPKLE--NNYFMVDTLAWLKHSNKLKRFIAEEKVKVILS 832
                  L      S      Y P+++    YF+ D  +WL+HS ++ +      ++  + 
Sbjct: 982  ERENEALFLECMKSVHPEIAY-PEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAIC 1040

Query: 833  VSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK-------------EFES 879
            ++   +L  L+  S+ E+V  +A+R +I I  LY  +++  L+             EFE 
Sbjct: 1041 LTTFQELRFLRK-SKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEE 1099

Query: 880  PIS--KALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLAT 937
             I+    +       I+    K +N          +Q N+   R + VV++SDD      
Sbjct: 1100 QITWRTHVDEFVIESIMKAQEKLEN---------AKQPNISSHRFNYVVLISDDDTMKKK 1150

Query: 938  FKKKGYNVVSTKVLFSVAS 956
             ++K    +ST+ +FS+ +
Sbjct: 1151 AEEKKIRTLSTRFVFSLCT 1169

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 93/211 (44%), Gaps = 25/211 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++T++V+ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 292 LWTIYKINTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 351

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + M+ +IP K+   W   +GDL+R+ +
Sbjct: 352 KNFSNFMD----------PEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAI 401

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y       A+ Y+ N+GK           Y+++S VQ ++L  
Sbjct: 402 ALYPSSFIDWKLSAEHWY-----TEAMKYTYNHGK----------LYYHMSTVQQNTLEA 446

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354
            V L K +  + T        QL ID I  +
Sbjct: 447 FVNLGKSVFCQETFTPSPQYMQLVIDNIYQR 477

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 179/871 (20%), Positives = 316/871 (36%), Gaps = 161/871 (18%)

Query: 107  LLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIAL 166
            L  ++ SI + ET ++   S+   L      D+ N +L   +K++ +++  Y  FI  AL
Sbjct: 288  LQEIYKSIVKQETELQERCSN---LTTQQTTDLKNLWLA--YKINAELIDNYILFITTAL 342

Query: 167  NINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXX 226
              + ++  L  G+E V   R+  RL  +     L++++N+ N M                
Sbjct: 343  LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIAL 402

Query: 227  XXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAP 286
                      ++MLE++P K+   W   +GDL+R+ + L       ++L++ H Y     
Sbjct: 403  ----------SNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR---- 448

Query: 287  VVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQL 346
              ++ ++  +GK           Y+++S VQ ++L   V L K +  E+  V      QL
Sbjct: 449  -ESLKFTFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQL 497

Query: 347  AIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEF 406
             ID I  +   +    + S G  T  +                    ++   +HYF ++F
Sbjct: 498  VIDNIYQRAFAE----RDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKF 553

Query: 407  ANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVY- 465
                  N+       N  + Q       F F ++ LFS   I++        NPF  ++ 
Sbjct: 554  GVSSSGNFFD----PNLIFIQDAERLKHF-FRHSSLFSQSHILQLCGFGDPKNPFAMLFE 608

Query: 466  ------------------KSSDDFEIKSVSLSN--------------------------- 480
                              KS+ +  +  V  S+                           
Sbjct: 609  LSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLG 668

Query: 481  -WKILIEQMDDTLLHSNXXXXXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRHVXX 539
             WK  +  ++ T +              +  + P +LPWLLF IS+   +  V D  +  
Sbjct: 669  VWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKK 728

Query: 540  XXXXXXXXXXPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESN 599
                      PWD ++T++N  I         +  + A +      +  +LL  +    N
Sbjct: 729  FWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENEN 788

Query: 600  FQEISMCEGFIWFDSLASKIKQASITTNES--LMKFKSYNASEDSLIYDDDDQVYTKMWT 657
              E   C G +WF+++ SK     +TT ES  L      ++  + + +DDDD+   K W 
Sbjct: 789  LPECWSCWGSLWFNTI-SKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQ 847

Query: 658  RAXXXXXXXKNVINDYPELIDVSIRGQSLTNSSCIK--------NSDSLTNDYLF----- 704
            R         N+I ++ E  D    G    N             N D  TND L      
Sbjct: 848  RICRTLLLF-NIITEW-EACDGYGHGCKKLNPEATSWKNLVFRFNDD--TNDQLSVELYP 903

Query: 705  ----DWGFE-------------LNNNNAVIIDDTLHGRNRIFKFSYIPDFQDFDKNGDIT 747
                 + FE             L + +  +I        + FK  Y PD+  F+KNGD+ 
Sbjct: 904  EENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMY-PDYFCFNKNGDLI 962

Query: 748  ----WGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLE--- 800
                +    +   +    +DFN+    N      R ++    +YS    K   P LE   
Sbjct: 963  TASLYTKGPLETANIQGGDDFNA----NKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFM 1018

Query: 801  ----------NNYFM---------------VDTLAWLKHSNKLKRFIAEEKVKVILSVSI 835
                      N  F+               +D   WL+H   + +      +K  + ++ 
Sbjct: 1019 NPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTT 1078

Query: 836  LNDLNELKNYSEHESVRSSASRVMIVINYLY 866
              +L  L+  S+ ESV  +A+R +I +  LY
Sbjct: 1079 FQELRFLRK-SKDESVLEAATRAVIAVRQLY 1108

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 91.3 bits (225), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 117/497 (23%), Positives = 207/497 (41%), Gaps = 67/497 (13%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + I+ P  LPW+ F IS+  + + ++D               PWD +VT++N  I  V  
Sbjct: 699  LGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLD 758

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTN 627
            + + S  + +L       +L +LL     +    EI  C G +WFD++  K    SI+++
Sbjct: 759  NEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQK-NTNSISSD 817

Query: 628  ESL--MKFKSYNASE---DSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIR 682
            +    +  K Y A +   D +I+D +D+   K W RA       + +   +   I V I 
Sbjct: 818  DDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQ--IGVIIN 875

Query: 683  GQSLTNSSCIKNSDSLTN-----DYLFDWGFELNNNNAV--IID--DT-------LHG-- 724
             +S  N S +++++ L N     + L   G  +   N +  IID  +T       LH   
Sbjct: 876  NESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVP 935

Query: 725  ------RNRIFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQ 774
                     IF ++      P++  FDKNG+        S Y    SN+  +  + N  +
Sbjct: 936  ELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEK 995

Query: 775  RYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVS 834
                + L         KS      L   YF+ D  +WL+HS ++ +      +K  + ++
Sbjct: 996  ENEGQFLECL------KSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLT 1049

Query: 835  ILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK-------------EFESPI 881
               +L  L+  S+ E+V  +A+R +I I  LY  N++  L+             EFE  I
Sbjct: 1050 TFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQI 1108

Query: 882  S--KALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLATFK 939
            +    +       I+    K +N           QL +   R + V+++SDD       +
Sbjct: 1109 TWRTHVDEFVIESIMKAQEKLEN---------ANQLPVSSCRFNYVILISDDDTMKKKAE 1159

Query: 940  KKGYNVVSTKVLFSVAS 956
            +K    +ST+ +FS+ +
Sbjct: 1160 EKKIKTLSTRFVFSLCT 1176

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 138/325 (42%), Gaps = 37/325 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  +++++T++V+ Y  FI  AL  +  Q DL+ G+E V   R+  RL  +     L+++
Sbjct: 304 LWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 363

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + M+ +IP K+   W   +GDL+R+ +
Sbjct: 364 KNFSNFMD----------PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 413

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 414 ALYPSSFIDWKLSAEHWY-----TEAMKYVYNHGK----------LYYHMSTVQQNTLEA 458

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYXXXXXX 381
            V L K +  + T        QL ID I  +   ++   NL+ S+     L++Y      
Sbjct: 459 FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSL-----LIEY-LKHSE 512

Query: 382 XXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAP 441
                       ++   L YF  +F      N  ++  P +   +  +  +  ++F +AP
Sbjct: 513 AMLLPSFLESPDLQNVVLSYFVEKFG--IDANGCNIFNPEDMFIQNPD--FFKYFFRHAP 568

Query: 442 LFSLISIVETIIMNKKLNPFFCVYK 466
            F+   I++ +   +  NPF  +++
Sbjct: 569 SFAQSHILQIVGFGEPKNPFAILFE 593

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 89.4 bits (220), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 99/513 (19%), Positives = 210/513 (40%), Gaps = 42/513 (8%)

Query: 477  SLSNWKILIEQMDDTLLHSNXXXXXXXXMLNVAISQPFILPWLLFYISVASEVANVTDRH 536
            SL  W   ++ ++ T LH +           + ++ P +LPW  F I+V S+V ++TD  
Sbjct: 631  SLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGA 690

Query: 537  VXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMY 596
                         PW+ IV +LN  I     +   S  +  L + + +  L  L+ +   
Sbjct: 691  SREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNN 750

Query: 597  ESNFQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSY-NASEDSLIYDDDDQVYTKM 655
              +  E+  C G +WFD++  K K    +   + +K   + +   D + +D DD+   K 
Sbjct: 751  NEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKF 810

Query: 656  WTRAXXXXXXXKNVINDYPELIDVSIRGQ----------SLTNSSCIKNSDSLTND---- 701
            W RA       K +  ++   + VS + Q           +  S C K  D+  N     
Sbjct: 811  WKRACRVIFLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVL 870

Query: 702  ----YLFDWGFELNNNNAVIIDDTLHGRNRIFKF----SYIPDFQDFDKNGDI------- 746
                 +F+ G + N +  +    ++     IF +      + D   +D+ G+        
Sbjct: 871  QNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYT 930

Query: 747  TWGYSLISNYDYIYSNDFNSEEDGN----FFQRYSRRLLSAHNDYSEDKSKKYLPKLENN 802
            +WG     N   I  ++   ++  N    F +  +  L   + D+ E K        ++ 
Sbjct: 931  SWGNETSKN--EIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNG-----KDT 983

Query: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862
            +F++D  +WL+H   + +  + + ++  + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 984  FFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRK-SKDENVVEAATRAVITV 1042

Query: 863  NYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRM 922
              LY  N+I  L+   +  +   ++++  + + +       +         +L+      
Sbjct: 1043 RQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRDF 1102

Query: 923  DNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955
             +VV+V+DD       ++   + +ST+ +F+  
Sbjct: 1103 HHVVLVTDDANMRRKAQQHAIHTLSTRFVFATC 1135

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 25/208 (12%)

Query: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206
           ++K+++ +++ Y  FI  AL    + +DL  G+E V   R+  RL  +     L++++N+
Sbjct: 279 IYKVNSDLINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNF 338

Query: 207 KNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266
            N M                          ++ML +IP ++   W   +GDL+R+ + L 
Sbjct: 339 SNFMD----------PEVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALY 388

Query: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326
                 ++L++ H Y     + A+ Y   +GK           Y+++S VQ ++L   V 
Sbjct: 389 PSGFIDWKLSAEHWY-----MEAMKYIYGHGK----------LYYHMSTVQQNTLEAFVN 433

Query: 327 LSKCLCIENTNVYQKSMAQLAIDKIISK 354
           L K +  ++T    +   QL ID I  +
Sbjct: 434 LGKSVFCQDTFTPSQQYMQLVIDNIYQR 461

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 119/596 (19%), Positives = 230/596 (38%), Gaps = 92/596 (15%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           +  ++K++ ++V+ Y  FI  AL  + +Q DL+ G+E +   ++  RL  +     L+++
Sbjct: 312 IWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVL 371

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +++ N M                           +M + IP KF   W   +GDL+R+  
Sbjct: 372 KHFSNFMD----------PEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMAT 421

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ + Y       A+ Y+   GK           Y++++ VQ +SLA 
Sbjct: 422 ALYPPGATDWKLSAEYWYG-----EAMKYTYGVGK----------LYYHMATVQQNSLAA 466

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXX 383
            + L K +   +  V  +   QL ID I  +     ++  +       ++ Y        
Sbjct: 467 FINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAY---ISRGEESSSNVQILDY-LKHNEIM 522

Query: 384 XXXXXXXXXXMERSSLHYFWNEFANEY-HLNYSSLRKPVNCKYRQKEINYSMFYFNNAPL 442
                     ++R +  YF  +F  ++   N+   R         + +    FYF ++PL
Sbjct: 523 VLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMF-----VQNLESVKFYFRHSPL 577

Query: 443 FSLISIVETIIMNKKLNPFFCVY----------------KSSDDFEIKSVSLSNWKILIE 486
           F+   I++ +      N F  +Y                KS    +  S+   ++++   
Sbjct: 578 FAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGN 637

Query: 487 QMDD--------------------------TLLHSNXXXXXXXXM-LNVAISQPFI---- 515
           ++ D                          +L ++N        M L   +  PF+    
Sbjct: 638 EIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALP 697

Query: 516 --LPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINSK 573
             LPW+ F ISVA ++  + D +             PW+ I+ +LN  I  +  +S +  
Sbjct: 698 HLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCS 757

Query: 574 TLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNESLMKF 633
            +  L +     SL ++L          E+  C G +WFD++ +K + +      + +K 
Sbjct: 758 LVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKD 817

Query: 634 KSY-NASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIRGQSLTN 688
            ++ +A  D +++D++D    K W RA       K     Y E  D  +R   LTN
Sbjct: 818 VNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKG----YAEKFDQGLR---LTN 866

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 81/187 (43%), Gaps = 34/187 (18%)

Query: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862
            YF+ D   WL+H   + +      +  ++ ++   +L  L+  S  E+V  +A+R +IVI
Sbjct: 1086 YFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRR-SRDENVMEAATRAVIVI 1144

Query: 863  NYLYAMNQINILK-------------EFESPIS--------------KALKNIDGSQILN 895
              LY + ++  L+             EFE  I+              K+ +N    ++ N
Sbjct: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204

Query: 896  FNGKFKND---LLTKENGPGQQLNMIELRMDN---VVVVSDDKLSLATFKKKGYNVVSTK 949
             + K   D   + T ++   +Q        ++    V+V+DD+   +  K++G    ST+
Sbjct: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTR 1264

Query: 950  VLFSVAS 956
             +FS+ S
Sbjct: 1265 FIFSICS 1271

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 107/497 (21%), Positives = 213/497 (42%), Gaps = 66/497 (13%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + I+ P ILPW+ F IS+  + + ++D               PWD +VT++N  I  +  
Sbjct: 706  LGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYL-- 763

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNF------QEISMCEGFIWFDSLASKIKQ 621
              ++++T  ++I ++  C  YD L        F       EI  C G +WFD++  K   
Sbjct: 764  --LDNQTSNSIIGDL--CDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEK-NT 818

Query: 622  ASITTNESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPEL 676
             SI++ ++  +     + + ++  D +I+D+ D+   K W RA       + +   +P  
Sbjct: 819  HSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFP-- 876

Query: 677  IDVSIRGQSLTNSSCIKNSDSLTN---------------------DYLFDWGFELNNNNA 715
            I V IR   L   S  +N++ L +                     + + D     + NN 
Sbjct: 877  IGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDISEARSENNT 936

Query: 716  ---VIIDDTLHGRNRIFKF----SYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEE 768
                + + +++  + IF +        D+  FDKNG+     SL + +    SN+ N E+
Sbjct: 937  DLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFL-SASLYTTWYVPNSNNTNIED 995

Query: 769  DGNFFQRYSRRLL---SAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEE 825
            + N+        L      +DY E   K         YF+ D  +WL+HS ++ +     
Sbjct: 996  NINYNSEKENEGLFLECIKSDYPEIDFK-------TTYFVFDATSWLRHSARIFKLAQNR 1048

Query: 826  KVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKAL 885
             ++  + ++   +L  L+  S+ E+V  +A+R +I I  LY  N++  L+   +  +   
Sbjct: 1049 LLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIE 1107

Query: 886  KNIDGSQILNFNGKFKNDLLTKENGPGQQL------NMIELRMDNVVVVSDDKLSLATFK 939
            +N++  + + +       ++       ++L       +   R + VV++SDD       +
Sbjct: 1108 ENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDAMKKKAE 1167

Query: 940  KKGYNVVSTKVLFSVAS 956
            +K    +ST+ +FS+ +
Sbjct: 1168 EKEIKTLSTRFVFSLCT 1184

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 98/225 (43%), Gaps = 27/225 (12%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++T +V+ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 311 LWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 370

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + M+ +IP K+   W   +GDL+R+ +
Sbjct: 371 KNFSNFMD----------PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 420

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 421 ALYPSSFIDWKLSAEHWY-----TEAMKYIYNHGK----------LYYHMSTVQQNTLEA 465

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSM 366
            V L K +  + T        QL ID I  +   ++   NL+ S+
Sbjct: 466 FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSL 510

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 105/488 (21%), Positives = 206/488 (42%), Gaps = 49/488 (10%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + I+ P ILPW+ F I+   +   ++D               PWD IVT++N  I  +  
Sbjct: 700  LGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLD 759

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTN 627
            +   +  +  L     + +L  LL          EI  C G +WFD++  K    SI+++
Sbjct: 760  NEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTICQK-NAHSISSD 818

Query: 628  ESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVS-- 680
            ++  +     + + +A  D +I+DD D+   K W RA       + +   +P  + VS  
Sbjct: 819  DNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSND 878

Query: 681  --IRGQSLTNSSCIKN-----------------SDSLTNDYLFDWGFELNNNNAVIIDD- 720
              I+  S  +S  ++N                   +L N          NN +   + + 
Sbjct: 879  PLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPEL 938

Query: 721  TLHGRNRIFKFSYI----PDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRY 776
            +++  + IF ++      PD+  FD+NG+     SL + + Y+ + +  SE   N     
Sbjct: 939  SVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL-SASLYTRW-YLPNGNNISEALVN----- 991

Query: 777  SRRLLSAHNDYSEDKSKKYLPKL--ENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVS 834
               +     D   +  K   P +  E  YF+ D  +WL+HS ++ +      +K  + ++
Sbjct: 992  -SDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLT 1050

Query: 835  ILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKALKNIDGSQIL 894
               +L  L+  S+ E+V  +A+R +I I  LY  +++  L+   +  +   +N++  + +
Sbjct: 1051 TFQELRFLRK-SKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQI 1109

Query: 895  NFNGKFKNDLLTKENGPGQQLN-----MIELRMDN-VVVVSDDKLSLATFKKKGYNVVST 948
             +       ++       ++L       +  R  N VV++SDD       ++K    +ST
Sbjct: 1110 TWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLST 1169

Query: 949  KVLFSVAS 956
            K +FS+ +
Sbjct: 1170 KFVFSLCT 1177

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 138/325 (42%), Gaps = 37/325 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  +++++T++++ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 305 LWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVL 364

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + M+ +IP K+   W   +GDL+R+ +
Sbjct: 365 KNFSNFMD----------PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 414

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 415 ALYPSSFIDWKLSAEHWY-----TEAMKYIYNHGK----------LYYHMSTVQQNTLEA 459

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYXXXXXX 381
            V L K +  + T        QL ID I  +   ++   NL+ S+     L++Y      
Sbjct: 460 FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSL-----LIEY-LKHSE 513

Query: 382 XXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAP 441
                       ++   + YF  +F  +   N  ++  P +   +  +  +  ++F +AP
Sbjct: 514 AMLLPSFLESPDLQNVVVSYFVEKFGID--ANGCNIFNPEDMFIQNPD--FFKYFFRHAP 569

Query: 442 LFSLISIVETIIMNKKLNPFFCVYK 466
            F+   I++ +   +  NPF  +++
Sbjct: 570 SFAQSHILQIVGFGEPKNPFAILFE 594

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 98/502 (19%), Positives = 216/502 (43%), Gaps = 59/502 (11%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + ++ P ILPW+ F IS+A ++    D  +            PW+ +V +LN  +  +  
Sbjct: 748  LMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMID 807

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASIT-- 625
            +  ++  L  L     S +L +LL       +  E+  C G +WFD +  K    +    
Sbjct: 808  NCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSY 867

Query: 626  TNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSI---- 681
            T   +  ++  +   D + +D++D++  K W R+       + ++  +    +++I    
Sbjct: 868  TECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNA 927

Query: 682  -----RGQSLTNSSCI--------KNSDSLTNDYLFDWGFELNNN----NAVIIDDTLHG 724
                 RG  + NS  +        K+ D + +D L     E+++N    NA+ +   ++G
Sbjct: 928  PVINRRGLGV-NSHLVGYSFKLMAKSDDIMFDDMLVSNFEEIDSNNSDFNAIPLLSMIYG 986

Query: 725  RNRIFKFSYI------PDFQDFDKNGDI-------TW---------GYSLISNYDYIYSN 762
             N    F Y+       D+  FDKNGD+       TW         G  L +N     + 
Sbjct: 987  EN---IFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAA 1043

Query: 763  DFNSEEDGNFFQRYSRRLLSAHNDY-----SEDKSKKYLPKL-ENNYFMVDTLAWLKHSN 816
              +   +   F +       + +++      +D  +K+  +L E+ YF++D  +WL+H  
Sbjct: 1044 SSDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFA 1103

Query: 817  KLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKE 876
             + +      +K  + ++   +L  L+  S+ E+V  +A+R +I +  L++  ++  L+ 
Sbjct: 1104 HVYKIATNSILKFSICLTTFQELRFLRK-SKDENVVEAATRAIITLRQLFSEGKLLPLRF 1162

Query: 877  FESPISKALKNIDGSQILNFNG---KFKNDLLTKENGPGQQLNMIELRMDNVVVVSDDKL 933
              +  +   ++++  + + +     +F  + + K     ++  M  ++   +V+V+DD  
Sbjct: 1163 TGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMKGFQIVLVTDDSN 1222

Query: 934  SLATFKKKGYNVVSTKVLFSVA 955
                  +KG    ST+ +F+++
Sbjct: 1223 MKNKALEKGSKTFSTRFVFAIS 1244

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 137/325 (42%), Gaps = 35/325 (10%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++KL+  +++ Y  FI  AL  + ++ DL+ G+E V   ++  RL  +     L+++
Sbjct: 354 LWVIYKLNADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVL 413

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + ML++IP K+   W   +GDL+R+ +
Sbjct: 414 KNFSNFMD----------PEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAV 463

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++   Y     + A+ YS   GK           Y+++S VQ ++L  
Sbjct: 464 ALFPSGFIDWKLSAERWY-----MAAMEYSYGYGK----------LYYHMSTVQQNTLEA 508

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXX 383
            V L K +  +NT V  +   QL ID I  +    + N   +     +L+ Y        
Sbjct: 509 FVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADR-NSSSNSRNCQLLVDY-LKHSEVM 566

Query: 384 XXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYS---MFYFNNA 440
                     +++  L YF  +F  +Y+ N   + +P     RQ  I  +    FYF +A
Sbjct: 567 LLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP-----RQMFIQNNDQLKFYFRHA 621

Query: 441 PLFSLISIVETIIMNKKLNPFFCVY 465
             F+   I++ +      NPF  ++
Sbjct: 622 NAFAEAQILQLVGYGNPKNPFALLF 646

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 92/428 (21%), Positives = 170/428 (39%), Gaps = 88/428 (20%)

Query: 513  PFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINS 572
            P +LPW  F +SVA  +++++   +            PW+ +V++LN  +  +  +S N 
Sbjct: 664  PHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNM 723

Query: 573  KTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIK-QASITTNESLM 631
             ++  L +      L+ L+ +        E+  C G +WFD++++K + +AS   +  + 
Sbjct: 724  SSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIR 783

Query: 632  KFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIRGQSLTNSSC 691
                 +A  D + +D DD+   K W RA       K +  ++   I VS      T  S 
Sbjct: 784  DHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSD-----TPIST 838

Query: 692  IKNSDSLTNDYLFDWGFE--------------------------LNNNNAVIIDDTLHGR 725
             ++  +L     F + FE                          +N+N   +   ++   
Sbjct: 839  RRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDG 898

Query: 726  NRIFKFS----YIPDFQDFDKNGDITWG----YSLISNYDYIYSNDFNSE---EDGNFFQ 774
              IF+F       PD+  F+KNGD+  G      L+        +DFN +   E+G    
Sbjct: 899  ESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENG---- 954

Query: 775  RYSRRLLSAHN--------------DYSEDK------SKKYLPKLENN------------ 802
                 LL+AHN              +Y+E K         ++  L ++            
Sbjct: 955  ----VLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNAD 1010

Query: 803  ----YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRV 858
                YF++D  +WL+H   + +      +K  + ++   +L  L+  S+ ESV  +A+R 
Sbjct: 1011 SNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK-SKDESVVEAATRA 1069

Query: 859  MIVINYLY 866
            +I    LY
Sbjct: 1070 VITARQLY 1077

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 100/216 (46%), Gaps = 25/216 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++ ++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  +     L+++
Sbjct: 282 LWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVL 341

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          ++ML ++P ++   W   +GDL+R+ +
Sbjct: 342 KNFSNFMD----------PEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAI 391

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y+      A+ Y+  +GK           Y+++S VQ ++L  
Sbjct: 392 ALYPSGFIDWKLSAEHWYS-----QALIYTYGHGK----------LYYHMSTVQQNTLEA 436

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ 359
            V L K +  ++T +  +   QL ID I  +   ++
Sbjct: 437 FVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER 472

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 138/325 (42%), Gaps = 45/325 (13%)

Query: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206
           +++++ ++V+ Y  FI+ AL  + +Q DL+ G+E V   R+  RL  +     L++++N+
Sbjct: 409 IYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNF 468

Query: 207 KNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266
            + M                          + ML +IP K+   W   +GDL+R+ + L 
Sbjct: 469 SSFMDPEVCSQFITHVFISI----------STMLADIPTKYSIPWMQRLGDLSRMAIALY 518

Query: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326
                 ++L+S + YN      A+ Y+   GK           Y+++S +Q ++L   V 
Sbjct: 519 PSGFIDWKLSSEYWYN-----QALKYTYGYGK----------LYYHMSTIQQNTLEAFVN 563

Query: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXXXXX 386
           L K +  ++T +      QL ID I  +     +    +    + L++Y           
Sbjct: 564 LGKSVFCQDTFIPSPQYMQLVIDNIYQRAF---IERGSNNTRNSQLIEYLKHSEVMLLPN 620

Query: 387 XXXXXXXMERSSLHYFWNEFANEYH-LNYSS-----LRKPVNCKYRQKEINYSMFYFNNA 440
                  +++  + YF ++F  + H LN        L+ P N KY          +F +A
Sbjct: 621 FIGNEN-LQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKY----------FFRHA 669

Query: 441 PLFSLISIVETIIMNKKLNPFFCVY 465
           P F+   I++T+      NPF  ++
Sbjct: 670 PAFAESHILQTVGFGDSKNPFALLF 694

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 83/392 (21%), Positives = 140/392 (35%), Gaps = 71/392 (18%)

Query: 509  AISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKH 568
             ++ P ++ W  F ISV  +   + D               P + IV++LN  I     +
Sbjct: 789  VVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDN 848

Query: 569  SINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNE 628
            S  S  + ++ + + S  L +LL          E+  C G +WFD++  K    S T   
Sbjct: 849  SYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDK----SNTDTN 904

Query: 629  SLMKFKS-----YNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIRG 683
            S  K        +++  D +++D  D+   K W RA       K +     E  D+ I  
Sbjct: 905  SYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIA----ETFDIGITL 960

Query: 684  QSLTNSSCIKNSDSLTNDYLFDWGF--------------ELNNNNAVIIDDT-------- 721
                   C +  D   N  L  + F              E+ N    II+ T        
Sbjct: 961  SHTAPVYC-RRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNI 1019

Query: 722  ---------LHGRNRIFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYS------- 761
                     L     IF+++      P+ Q+FDKNG++       +NY   YS       
Sbjct: 1020 TMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSA----ANYTSWYSAQEIVPK 1075

Query: 762  ------NDFNSEEDGNFFQR--YSRRLLSAHNDYSEDKSKKYLPKL--ENNYFMVDTLAW 811
                  N       G  FQ       + S   +  E+ S   L  L  E   F++D  +W
Sbjct: 1076 SAASPENSVAGSSPGRSFQSQDVEENIFSVFTN-EEENSTSLLDGLNLETTSFVLDATSW 1134

Query: 812  LKHSNKLKRFIAEEKVKVILSVSILNDLNELK 843
            L+HS  + +  +   +   + ++   +L  L+
Sbjct: 1135 LRHSAHIYKLASNSFLVFSICLTTFQELRFLR 1166

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1372

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 144/324 (44%), Gaps = 35/324 (10%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K+++ +++ Y  F+  AL  + T++D++ G+E V   R+  RL  +     L+I 
Sbjct: 453 LWTIYKINSDLINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIF 512

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          ++ML +IP K+   W   +GDL+R+ +
Sbjct: 513 KNFSNFMDPEVCCQFITHVFISI----------SNMLGDIPPKYGIPWLQRLGDLSRMAI 562

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y     + A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 563 ALYPSGFIDWKLSAEHWY-----MEAMKFTYSHGK----------LYYHMSTVQQNTLEA 607

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYXXXXXXXX 383
            V L K +  ++T +  +   QL ID I  +   ++ N        T L++Y        
Sbjct: 608 FVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR---NTQLIEY-LKHSEVM 663

Query: 384 XXXXXXXXXXMERSSLHYFWNEFA-NEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPL 442
                     +++  L YF  +F  +  ++N    RK + C    +  +Y  ++F +AP 
Sbjct: 664 LLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRK-MFC----QNPDYLRYFFRHAPA 718

Query: 443 FSLISIVETIIMNKKLNPFFCVYK 466
           F+   I++ +      NPF  +++
Sbjct: 719 FAESHILQLVGFGDPKNPFALLFE 742

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 90/438 (20%), Positives = 170/438 (38%), Gaps = 83/438 (18%)

Query: 508  VAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNK 567
            + ++ P  +PW  F IS+A ++ ++                 PW+ IV++LN  I  +  
Sbjct: 837  LVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD 896

Query: 568  HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTN 627
            +S  S  + +L     S  L DLL Y        E+  C G +WFD++ +K +Q+ +   
Sbjct: 897  NSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNK-EQSHVEDL 955

Query: 628  ESLMKFKSY---NASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIRGQ 684
            ES+   K++   +A  D + +D +D+     W RA       K +  ++P    + I   
Sbjct: 956  ESV-GIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP----IGITLS 1010

Query: 685  SLTNSSCIKNSDSLTNDYLFDWGFELNNN-------------NAVIID-DTLHGRNRIFK 730
             +    C +N D      L  + F+L                +   ID D L     IF+
Sbjct: 1011 PVAPVYCRRN-DVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFE 1069

Query: 731  -----------------------FSYI------PDFQDFDKNGDITWGYSLISNYDYIYS 761
                                   F Y       PD+  +DKNG+    +   S Y   Y+
Sbjct: 1070 EASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGE----FLSASLYTSWYA 1125

Query: 762  NDFNSEEDGNF--------FQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTL---- 809
            N+ N+   G           QR + + +   + +++     Y     ++ F+ D L    
Sbjct: 1126 NN-NTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTA 1184

Query: 810  ------------AWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASR 857
                         WL+H   + +  +   +K  + ++  ++L  L+   + E+V  +A+R
Sbjct: 1185 HSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRK-PKDENVVEAATR 1243

Query: 858  VMIVINYLYAMNQINILK 875
             +I +  LY+  ++  L+
Sbjct: 1244 AIITVRQLYSEGKLLPLR 1261

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 138/331 (41%), Gaps = 48/331 (14%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++T +++ YT FI  AL  +   +D++ G+E V   R+  RL  +     L+++
Sbjct: 327 LWTIYKINTDLINNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVL 386

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + +L +IP K    W   +GDL+R+ +
Sbjct: 387 KNFSNFMD----------PEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAI 436

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y     + A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 437 ALYPSGFIDWKLSAEHWY-----MEAMKFTYSHGK----------LYYHMSTVQQNTLEA 481

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGG---TTILMKYXXXXX 380
            V L K +  ++T    +   QL ID I  +       + ++ GG      L+ Y     
Sbjct: 482 FVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTF-----VDRNTGGNYRNPDLIDY-LKHS 535

Query: 381 XXXXXXXXXXXXXMERSSLHYFWNEFANEYHLN-----YSSLRKPVNCKYRQKEINYSMF 435
                        +++  L+YF + F  +Y  N          +P +C           F
Sbjct: 536 EVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL---------RF 586

Query: 436 YFNNAPLFSLISIVETIIMNKKLNPFFCVYK 466
           +F +AP F+   I++ +      NPF  +++
Sbjct: 587 FFRHAPAFAESHILQLVGFGNPKNPFALLFE 617

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 63/158 (39%), Gaps = 15/158 (9%)

Query: 510 ISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHS 569
           I+ P  LPW +F I+   +V  + +               PWD I ++LN  +  V  + 
Sbjct: 725 IALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNY 784

Query: 570 INSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNES 629
            N+  +  L        L D+L +     +  E+  C G +W+D++ +K    + T    
Sbjct: 785 GNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADT---- 840

Query: 630 LMKFKSYNASE--------DSLIYDDDDQVYTKMWTRA 659
              F  +   +        D + +D +D+   K W RA
Sbjct: 841 ---FAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRA 875

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862
            +F+ D  +WL+H   + +      +K  + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 1099 FFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK-SKDENVVEAAARAIITM 1157

Query: 863  NYLYAMNQINILK-------------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTK 907
              LY  N++  L+             EFE  I+    +       ++    KF     TK
Sbjct: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETK 1217

Query: 908  ---ENGPG-QQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956
               E G G  ++ +   R   V +V++D+      + +G    ST  +FS+ S
Sbjct: 1218 QPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCS 1270

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 104/540 (19%), Positives = 198/540 (36%), Gaps = 104/540 (19%)

Query: 510  ISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHS 569
            I+ P  LPW  F IS+  ++    +  +            PW+ IV +LN  +  +  + 
Sbjct: 816  IALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNC 875

Query: 570  INSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASK----------- 618
                 L  L     S SL +LL Y        E+  C G +WFD++  K           
Sbjct: 876  WEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIMEKSNLNKDKNPEV 935

Query: 619  IKQASITTNE----SLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYP 674
            I  +    N+     +  +K ++   D   +D+ D++  + W RA       K +   Y 
Sbjct: 936  INGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAESYT 995

Query: 675  ELIDVSI----------RGQSLTNSSCIKNSDSLTNDYLFDWGFELN-NNNAVIIDDTLH 723
             L  + +          + +   N+ C +         L ++ F+LN +++ V++DD + 
Sbjct: 996  GLGGLILSYEAPVFNRRKDEYKVNTVCQE---------LLEFSFKLNASSDGVMLDDIIE 1046

Query: 724  G---------------------RNRIFKF----SYIPDFQDFDKNGDI-------TWGYS 751
                                   + IF +       P+F  FDKNGD        +W   
Sbjct: 1047 SFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSIK 1106

Query: 752  LISNY-----------DYIYSNDFNSEEDGNFFQRYSRRLL-------SAHNDYSEDKSK 793
             ++N            D I S   N     +        LL         +    E  S+
Sbjct: 1107 NLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVFNECFDPKYKTLEEFWSQ 1166

Query: 794  KYLPKLENN-------YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYS 846
            +  P  + N       YF++D  +WL+H   + +    + +K  + ++   +L  L+   
Sbjct: 1167 EIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSK 1226

Query: 847  EHESVRSSASRVMIVINYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKFK----N 902
            +H  V  +A+R +I +  LY  N +  L+   +  +   ++++  + + +          
Sbjct: 1227 DHNVVE-AATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIE 1285

Query: 903  DLLTKENGPGQQLNMIELRMD-------NVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955
             +L  E     +LN I +  D        +++V+DD         +     ST+ +FS+A
Sbjct: 1286 AVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMA 1345

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 94/211 (44%), Gaps = 25/211 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++++++++V  Y  FI  A++    + D   GKE +   ++  RL  +     L+++
Sbjct: 420 LWTIYRVNSELVDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLL 479

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          ++ML +IP K+   W   +GDL+R+ +
Sbjct: 480 KNFSNFMDPEVCCQFIFHVFISI----------SNMLADIPQKYRVSWYQKLGDLSRMAI 529

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L   +   ++L++   Y     + A+ ++  +GK           Y+++S VQ ++L  
Sbjct: 530 ALYPSNFIDWKLSAERWY-----MAAMEFTYGHGK----------LYYHMSTVQQNTLEA 574

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354
            V L K L  +NT V  +   QL I  I  +
Sbjct: 575 FVNLGKSLFCKNTFVPSQQYLQLVIGNIYQR 605

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 113/253 (44%), Gaps = 30/253 (11%)

Query: 107 LLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIAL 166
           L  ++ +I R ET ++   S    L      D+ N ++  ++K++ +++  Y  FI  AL
Sbjct: 289 LQEIYRNIVRQETELQQRCSQ---LTTSQTTDLKNLWI--IYKVNAELIDNYFMFITTAL 343

Query: 167 NINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKXXXXXXXXXXXXXXX 226
                + DL+ GKE +   R+  RL  +     L++++N+ N M                
Sbjct: 344 LPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMD----------PEVCC 393

Query: 227 XXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAP 286
                     ++ML +IP KF   W   +GDL+R+ + L       ++L++ H Y+    
Sbjct: 394 QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYH---- 449

Query: 287 VVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQL 346
             A+ Y+  +GK           Y+++S VQ ++LA  V L K +   +T +  +   QL
Sbjct: 450 -EALKYTFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQL 498

Query: 347 AIDKIISKLLNKQ 359
            ID I  +   ++
Sbjct: 499 VIDNIYQRAFAER 511

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 95/459 (20%), Positives = 173/459 (37%), Gaps = 74/459 (16%)

Query: 464  VYKSSDDFEIKSVSLSNWKILIEQMDDTLLHSNXXXXXXXXMLNVAISQPFILPWLLFYI 523
            +YK  DD  I       WK  +   + T +  +           +  + P +LPW  F  
Sbjct: 660  IYKFPDDINI-------WKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLA 712

Query: 524  SVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIK 583
            +  S V  +    +            P++ I+T+LN  +  +N  +  +       +   
Sbjct: 713  ATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFI 772

Query: 584  SCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSYNASE-DS 642
              SL DL+ Y        E+  C G +WFD+L +K        N + +K   +  S  D 
Sbjct: 773  DMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINSTGVKDHMFMDSPIDG 832

Query: 643  LIYDDDDQVYTKMWTRAXXXXXXXKNVINDYP-ELIDVS---------IRGQSLTNSSCI 692
            + +D +D+   K W R        + +  + P  L ++S          + +   +  C 
Sbjct: 833  ISFDHNDESGEKFWKRCARVILLFRALALECPVGLREISGGRNWRSLVFKFEEPPSEWCD 892

Query: 693  KNSDSLTNDYLFDWGFELNNNN--------AVIIDD----TLHGRNRIFKFSYIPDFQDF 740
               +  T   +FD   +++  N          +  D    TL G  RI     +PD+  F
Sbjct: 893  MYLEPFT--LVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGY-RIL----LPDYYCF 945

Query: 741  DKNGDITWG--YSL--ISNYDYIYSNDFNSE---EDGNFFQRYSR--------------- 778
            ++NGD+  G  Y++  + +      +DFN +   E+G       R               
Sbjct: 946  NRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMD 1005

Query: 779  ---RLLSAHNDYSEDKSKKYLPK--------LENNYFMVDTLAWLKHSNKLKRFIAEEKV 827
               R     ND    + ++ LP+            YF++D   WL+H   + +  A   +
Sbjct: 1006 EFLRHTHCKNDV---RWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNIL 1062

Query: 828  KVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866
            K  + ++   +L  L+  S+ ESV  +A+R +I +  LY
Sbjct: 1063 KFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLY 1100

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
           YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 137/323 (42%), Gaps = 39/323 (12%)

Query: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206
           ++K++ ++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  H     L++++N+
Sbjct: 283 IYKINIELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNF 342

Query: 207 KNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266
            N M                          + ML ++P KF   W   +GDL+R+ + L 
Sbjct: 343 SNFMD----------PEVCCQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALY 392

Query: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326
                 ++L++ H Y+      A+++   +GK           Y+++S VQ ++L   V 
Sbjct: 393 PSGFIDWKLSAEHWYS-----QALSHIFGHGK----------LYYHMSTVQQNTLEAFVN 437

Query: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGG---TTILMKYXXXXXXXX 383
           L K +   +T +      QL ID I       Q    +  GG    +++++Y        
Sbjct: 438 LGKSVFCRDTFIPSPQYMQLVIDNIY------QRAFAERNGGNHRNSLMVEY-LKHSEVM 490

Query: 384 XXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLF 443
                     +++  L +F ++F      + +    P +   +  E     ++F +AP F
Sbjct: 491 LLSSFLESPELQKVVLSFFQHKFG--VSTSNTDFFNPRDMFLQDGE--RVKYFFRHAPAF 546

Query: 444 SLISIVETIIMNKKLNPFFCVYK 466
           +   I++T+      NPF  +++
Sbjct: 547 AESHILQTVGFGDPKNPFALLFE 569

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 73/169 (43%), Gaps = 3/169 (1%)

Query: 506 LNVAISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMV 565
           L VA++   +LPW  F +S+A ++ ++    +            PW+ IV +LN  +  V
Sbjct: 653 LVVAVTH--MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFV 710

Query: 566 NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKI-KQASI 624
             ++  +  +  L + + S     L+ +     +  EI  C G +WFD +A K   +   
Sbjct: 711 LDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGD 770

Query: 625 TTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDY 673
             N        ++   D + +D+DD+V  K W RA       K +  ++
Sbjct: 771 VINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF 819

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 802  NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIV 861
            +YF++D  +WL+H   + +      ++  + ++   +L  L+  S+ ESV  +A+R +I 
Sbjct: 998  SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRK-SKDESVVEAATRAVIT 1056

Query: 862  INYLYA 867
            +  LY+
Sbjct: 1057 VRQLYS 1062

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 85/412 (20%), Positives = 152/412 (36%), Gaps = 68/412 (16%)

Query: 513  PFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHSINS 572
            P +LPW  F ++V   +  + +               PW+ I  +LN  +  +N      
Sbjct: 739  PHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTK 798

Query: 573  KTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNESLMK 632
              +   + N  +  L +LL Y     +  E+  C G +WFD + SK     +  + + +K
Sbjct: 799  FPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHSTGVK 858

Query: 633  FKSY-NASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYP---ELIDVSIRGQSLT- 687
               + +A  D + +D  D+   K W R        + +   +P      + S   +SL  
Sbjct: 859  DHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEFNGSDDWKSLVF 918

Query: 688  --NSSCIKNSDSLTNDYLFDWG-FE-----------LNNNNAVIIDD--TLHGRNRIFKF 731
              N    +  +     +  ++G FE             +   V+  D  TL G  ++   
Sbjct: 919  KFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQL--- 975

Query: 732  SYIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLL-------SAH 784
              +PD+  F+KNGD+  G    S      S   N  ED       ++RLL       S  
Sbjct: 976  --VPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFG----STKRLLENELLVTSER 1029

Query: 785  NDYSEDKSKKYLPKLEN------------------------------NYFMVDTLAWLKH 814
             DY+    K+  P ++                                YF++D   WL+H
Sbjct: 1030 RDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRH 1089

Query: 815  SNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866
               + +      +K  + ++   +L  L+  S+ ESV  +A+R +I +  LY
Sbjct: 1090 FGHVYKLATSNLLKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLY 1140

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 25/216 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++KL+ +++  Y  FI  AL     + DL+ G+E +   R+  RL  +     L+++
Sbjct: 359 LWVIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVL 418

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          +++L  IP  F   W   +GDL+R+ +
Sbjct: 419 KNFSNFMD----------PEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAI 468

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y       A+ Y+  +GK           Y+++S VQ ++LA 
Sbjct: 469 ALYPSGFIDWKLSAEHWYQ-----EALKYNFGHGK----------LYYHMSTVQQNTLAA 513

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ 359
            V L K +   +T +  +   QL ID I  +   ++
Sbjct: 514 FVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 549

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1241

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 137/329 (41%), Gaps = 46/329 (13%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++KL+T +++ Y  FI  AL  + + +D+  G+E V   R+  RL  +     L+++
Sbjct: 320 LWSIYKLNTDLINNYITFITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVL 379

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + ML ++P K    W   +GDL+R+ +
Sbjct: 380 KNFSNFMD----------PEVCSQFITHVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAI 429

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H Y     + A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 430 ALYPSGFIDWKLSAEHWY-----MEAMKFTYSHGK----------LYYHMSTVQQNTLEA 474

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL---NKQVNLKQSMGGTTILMKYXXXXX 380
            V L K +  ++T    +   QL ID I  +     NK  N++ S      L+ Y     
Sbjct: 475 FVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSD-----LIDY-LKHS 528

Query: 381 XXXXXXXXXXXXXMERSSLHYFWNEFANEYHLN----YSSLRKPVNCKYRQKEINYSMFY 436
                        +++  L+YF + F  +Y+ N       +   V    R        FY
Sbjct: 529 EVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLR--------FY 580

Query: 437 FNNAPLFSLISIVETIIMNKKLNPFFCVY 465
           F +AP F+   I++ +      NPF  ++
Sbjct: 581 FRHAPAFAESHILQLVGFGNPKNPFALLF 609

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 510 ISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHS 569
           I+ P +LPW  F I+   +  +  +               PW+ + ++LN  +  +  + 
Sbjct: 711 IALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNF 770

Query: 570 INSKTLRALIKNIKSC-SLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNE 628
             ++++  L +   +  + Y+LL Y     N  EI  C G +WFD +++K    + T N 
Sbjct: 771 YQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFNG 830

Query: 629 SLMKFKSY-NASEDSLIYDDDDQVYTKMWTRA 659
             ++   + +   D + +D+ D+     W RA
Sbjct: 831 LGIEDHMFLDFPLDGIGFDELDETGENFWNRA 862

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 72/170 (42%), Gaps = 29/170 (17%)

Query: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862
            YF+ D  +WL+H   + +      +   + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 1072 YFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRK-SKDENVVGAAARAIITM 1130

Query: 863  NYLYAMNQINILK-------------EFESPIS--KALKNIDGSQILNFNGKF--KNDLL 905
              LY+  ++  L+             EFE  I+    +       ++    KF   N+ +
Sbjct: 1131 RQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESV 1190

Query: 906  TKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955
            T   G            ++VV+V+DD       +++G    +T  +FSV 
Sbjct: 1191 TLRKG-----------FNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVC 1229

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1526

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 92/205 (44%), Gaps = 8/205 (3%)

Query: 510  ISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVNKHS 569
            +S P +LPW  F IS+A  + ++ +               PW+ IV+YLN  I ++  + 
Sbjct: 840  VSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNC 899

Query: 570  INSKTLRALIKNIKSCSLYDLLY-YMMYESNFQEISMCEGFIWFDSLAS--KIKQASITT 626
              +  +  LI N  + +L +LL  +   E    E+  C G +WFD +A   +I     + 
Sbjct: 900  YENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSK 959

Query: 627  NESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYPELIDVSIRGQSL 686
            N S+   K  N   D L +D+ ++  T  W R+       K +I  +     ++I     
Sbjct: 960  NISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTIS---- 1015

Query: 687  TNSSCIKNSDSLTNDYLF-DWGFEL 710
            +N+S   N   + N+++   + F+L
Sbjct: 1016 SNTSVYCNRSDIPNNHILRTFAFKL 1040

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 96/209 (45%), Gaps = 25/209 (11%)

Query: 143 YLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEI 202
           YL  ++KL+  +++ Y  FI  +L+ + +  D + GKE +   ++  RL  +     L+I
Sbjct: 304 YLWSIYKLNHDLINNYILFILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDI 363

Query: 203 IENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLL 262
           ++N+ N M                          ++M+ ++P+ F   W   +GDL+R+ 
Sbjct: 364 LKNFANFMD----------PEILSQFITHVFESISNMISDLPIDFINPWYQRLGDLSRMA 413

Query: 263 MLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLA 322
           + L   +   ++L+S + Y     + ++ ++ ++GK           Y+++S VQ + L 
Sbjct: 414 IALYPSNFIDWKLSSEYWY-----IESMKFTFSHGK----------LYYHISTVQQNPLE 458

Query: 323 RIVTLSKCLCIENTNVYQKSMAQLAIDKI 351
             V L K +   +T +  +   QL ID I
Sbjct: 459 AFVNLGKSVFCFDTFIPSQRYMQLVIDNI 487

 Score = 35.4 bits (80), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 798  KLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASR 857
            +  + YF++D  +WL+H   + +      +K  + ++   +L  L+  S+ E+V  +A+R
Sbjct: 1292 QFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRK-SKDENVMEAATR 1350

Query: 858  VMIVINYLYA 867
             +I +  LY+
Sbjct: 1351 AIITLRQLYS 1360

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 94/211 (44%), Gaps = 25/211 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++  +++ Y  FI  AL  + +Q+DL  G+E +   R+  RL  +     L+++
Sbjct: 336 LWTIYKVNIDLINNYVTFITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVL 395

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +N+ N M                          + ML +IP K+   W   +GDL+R+ +
Sbjct: 396 KNFSNFMD----------PEVCCQFITHVFISLSTMLADIPTKYSIPWLQRLGDLSRMAI 445

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++   Y     + A+ ++ N+GK           Y+++S VQ ++L  
Sbjct: 446 ALYPSGFIDWKLSAEEWY-----MEAMKFTYNHGK----------LYYHMSTVQQNTLEA 490

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354
            V L K +  + T    +   QL ID I  +
Sbjct: 491 FVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 521

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 110/567 (19%), Positives = 211/567 (37%), Gaps = 136/567 (23%)

Query: 510  ISQPFILPWLLFYISVASEVANVTDRHVXXXXXXXXXXXXPWDDIVTYLN-------ESI 562
            I+ P +LPW  F IS+  +   +T                PW+DI+ +LN       ++I
Sbjct: 760  IALPHLLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNI 819

Query: 563  DMVNKHSIN---SKTLRALIKNI----KSCSLYDLLYYMMYESNFQEISMCEGFIWFDSL 615
             +    ++N    K +   I ++     +    DLL +     +  E+  C G +WFD++
Sbjct: 820  GLPTPSAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTI 879

Query: 616  ASK-IKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRAXXXXXXXKNVINDYP 674
            ++K    A    N  +      +   D + Y  +D+     W R        K +  ++ 
Sbjct: 880  SNKNGMDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFD 939

Query: 675  EL-IDVSIRGQSLTNSSCIKNSDSLTNDYLFDW------------GFELN-NNNAVI--- 717
             L + VS    +   ++ +   D++   + F W            G EL    N +I   
Sbjct: 940  SLGLKVSYNAGTEYRNNNVP-MDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRI 998

Query: 718  -----IDDTLHGRNRIFK-------------FSYI------PDFQDFDKNGDITWGYSLI 753
                 I + +H  N  F+             F Y       P+ + FDKNG+ + G    
Sbjct: 999  TEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYT 1058

Query: 754  S---NYDYI------YSNDFNSEEDGNFFQ------------------RYSRRLLSAHND 786
            +   +YD +       +N   ++E  + F                   R    LLS+ + 
Sbjct: 1059 AWPMDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTST 1118

Query: 787  YSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYS 846
               ++ K Y         + D  +WL+H   + +  +   +K  + ++   +L  L+  S
Sbjct: 1119 EPFNRYKTYF--------VFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRK-S 1169

Query: 847  EHESVRSSASRVMIVINYLYAMNQINILK-------------EFESPI------------ 881
            +  +V  +++R +I +  LY+   +  L+             EFE  I            
Sbjct: 1170 KDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIE 1229

Query: 882  -----------SKALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRMDNVVVVSD 930
                       SK ++N++G+   N+ G+      T      ++ N+ +     VV+++D
Sbjct: 1230 AVMKAQEKFVKSKTVENMEGTS--NW-GEIDATTTTVSAEEEEKSNLFKY----VVLITD 1282

Query: 931  DKLSLATFKKKGYNVVSTKVLFSVASL 957
            D       + KG +   T+V+FSV S+
Sbjct: 1283 DDSMRMKAQLKGISTFGTQVVFSVCSM 1309

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 93/211 (44%), Gaps = 25/211 (11%)

Query: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203
           L  ++K++  +++ Y  FI  AL    ++ DL  G+E +   R+  RL  +     L+++
Sbjct: 434 LWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVL 493

Query: 204 ENYKNHMKXXXXXXXXXXXXXXXXXXXXXXXXXTHMLEEIPLKFHYDWELHIGDLNRLLM 263
           +++ N M                            +L +IP+K+   W   +GDL+R+ +
Sbjct: 494 KSFSNFMDPEVCCQFISHVFIAISL----------ILNDIPMKYSIQWLQRLGDLSRMAI 543

Query: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323
            L       ++L++ H YN      A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 544 ALYPSGFIDWKLSAEHWYN-----EAMKFTYSHGK----------LYYHMSTVQQNTLEA 588

Query: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354
            V L K +  + T    +   QL ID I  +
Sbjct: 589 FVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 619

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 10/119 (8%)

Query: 508  VAISQPFILPWLLFYISVASEVAN-VTDRHVXXXXXXXXXXXXPWDDIVTYLNESIDMVN 566
            + I+ P +L W+ F IS+  ++ N +TD               PW+ IV +LN  + MV 
Sbjct: 915  ILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLN--VLMVY 972

Query: 567  K-HSINSKTLRALIK------NIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASK 618
               +IN +  + +I       ++ S SL ++L +     N  EI  C G +WFD + +K
Sbjct: 973  LLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNK 1031

>Kwal_23.4129 s23 (585306..585641) [336 bp, 111 aa] {ON} YLR408C -
           Hypothetical ORF [contig 255] FULL
          Length = 111

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%)

Query: 418 RKPVNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKSSDDFEIKSVS 477
           +   N     KEI  +  Y N   L  L+++ +T    K + P   +Y    D  ++   
Sbjct: 23  KTATNVSEAHKEIEANHAYINQKQLKDLVALHDTTFKEKCVEPLRKLYHKYSDLTLQEGD 82

Query: 478 LSNWKILIEQ 487
           L NW  L+E+
Sbjct: 83  LQNWAELVER 92

>Kpol_1018.184 s1018 complement(462259..462945) [687 bp, 228 aa]
           {ON} complement(462259..462945) [687 nt, 229 aa]
          Length = 228

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 362 LKQSMGGTTILMKYXXXXXXXXXXXXXXXXXXMERSSLHYFWNEFANEYHLNYSSLRKPV 421
           L++ +GGT I  +Y                      + HY+W+ FA + +   +  R+P+
Sbjct: 34  LRKDLGGTLIRDRYNDHLKYSDSLVMFSWLPYEGTMNKHYYWDSFAKQNNRG-TFFRQPI 92

Query: 422 NCKYRQKEI---------NYSMFYFNNAPLFSLISIVETIIMNKKL 458
                +KEI         +Y +++ +N  + +L SI+++ + N KL
Sbjct: 93  QSNEFEKEIQLPFLDSRTDYRLWFQDNMEIDNLNSILKSTLSNDKL 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,561,237
Number of extensions: 4538620
Number of successful extensions: 15189
Number of sequences better than 10.0: 62
Number of HSP's gapped: 15581
Number of HSP's successfully gapped: 101
Length of query: 962
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 843
Effective length of database: 39,836,145
Effective search space: 33581870235
Effective search space used: 33581870235
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)