Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D046205.704ON40640620310.0
SAKL0E14960g5.704ON3843137463e-95
ZYRO0G06556g5.704ON3793176907e-87
TDEL0B021605.704ON3753326854e-86
NCAS0A031905.704ON3983256692e-83
KNAG0C066105.704ON3863256646e-83
KAFR0H002005.704ON3893626603e-82
Kwal_55.196885.704ON3933156501e-80
CAGL0G02519g5.704ON3782716211e-76
KLTH0E01012g5.704ON3863245993e-73
KLLA0A00550g5.704ON3802815905e-72
NDAI0E050505.704ON4513095922e-71
AFR288C5.704ON4652615853e-70
Kpol_YGOB_Anc_5.7045.704ON2071513702e-41
NDAI0K028706.48ON6621041000.001
Suva_11.171.519ON740161850.072
KLTH0C10406g6.48ON553102820.14
KAFR0G026206.48ON60191810.19
TPHA0J005306.48ON589105800.25
Kpol_1037.376.48ON62269790.39
NCAS0F002306.48ON60591780.45
TPHA0F024906.48ON677104780.49
CAGL0K05995g6.48ON79468770.58
TDEL0G042206.48ON632105770.65
SAKL0E02068g6.48ON558154760.87
Suva_8.2246.48ON62491750.94
YOR171C (LCB4)6.48ON624115750.95
YKL205W (LOS1)1.519ON1100171761.00
KAFR0A052506.48ON717104751.1
YLR260W (LCB5)6.48ON687104741.4
Smik_11.201.519ON1103171741.5
Skud_11.161.519ON1099171732.0
Smik_15.3496.48ON62591722.3
ZYRO0C07084g6.48ON64769722.3
KLTH0H02244g7.306ON12075682.6
AGR025Wna 1ON37972712.9
Skud_12.3406.48ON680108712.9
Kwal_YGOB_Anc_7.3067.306ON12075673.2
NDAI0I023706.48ON76068713.2
Ecym_31386.48ON588102703.7
Skud_15.3336.48ON62794704.6
AGR256W6.48ON579106694.9
ACL198W4.190ON39472686.9
TBLA0D053801.284ON624137687.5
YLR355C (ILV5)4.190ON39572678.0
KNAG0G035508.862ON31749678.2
Smik_12.4434.190ON39572678.3
CAGL0L04554g6.48ON560104678.3
Suva_10.4564.190ON39572678.8
Skud_12.4404.190ON39572679.1
TDEL0E018404.190ON39655679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04620
         (406 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   786   0.0  
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   291   3e-95
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   270   7e-87
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    268   4e-86
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    262   2e-83
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   260   6e-83
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      258   3e-82
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   254   1e-80
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   243   1e-76
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   235   3e-73
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   231   5e-72
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   232   2e-71
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   229   3e-70
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   147   2e-41
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    43   0.001
Suva_11.17 Chr11 (34690..35130,35204..36985) [2223 bp, 740 aa] {...    37   0.072
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    36   0.14 
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    36   0.19 
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    35   0.25 
Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON} (90148....    35   0.39 
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    35   0.45 
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    35   0.49 
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    34   0.58 
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    34   0.65 
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    34   0.87 
Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON...    33   0.94 
YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON} ...    33   0.95 
YKL205W Chr11 (50051..53353) [3303 bp, 1100 aa] {ON}  LOS1Nuclea...    34   1.00 
KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6...    33   1.1  
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    33   1.4  
Smik_11.20 Chr11 (34512..37823) [3312 bp, 1103 aa] {ON} YKL205W ...    33   1.5  
Skud_11.16 Chr11 (33522..36821) [3300 bp, 1099 aa] {ON} YKL205W ...    33   2.0  
Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {...    32   2.3  
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    32   2.3  
KLTH0H02244g Chr8 (203853..203855,204273..204632) [363 bp, 120 a...    31   2.6  
AGR025W Chr7 (761509..762648) [1140 bp, 379 aa] {ON} NOHBY732; N...    32   2.9  
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    32   2.9  
Kwal_YGOB_Anc_7.306 s56 complement(1002158..1002517,1002808..100...    30   3.2  
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    32   3.2  
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    32   3.7  
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    32   4.6  
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    31   4.9  
ACL198W Chr3 (15601..16785) [1185 bp, 394 aa] {ON} Syntenic homo...    31   6.9  
TBLA0D05380 Chr4 complement(1325855..1327729) [1875 bp, 624 aa] ...    31   7.5  
YLR355C Chr12 complement(838066..839253) [1188 bp, 395 aa] {ON} ...    30   8.0  
KNAG0G03550 Chr7 (754676..755629) [954 bp, 317 aa] {ON} Anc_8.86...    30   8.2  
Smik_12.443 Chr12 complement(777177..778364) [1188 bp, 395 aa] {...    30   8.3  
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    30   8.3  
Suva_10.456 Chr10 complement(797588..798775) [1188 bp, 395 aa] {...    30   8.8  
Skud_12.440 Chr12 complement(778396..779583) [1188 bp, 395 aa] {...    30   9.1  
TDEL0E01840 Chr5 (350762..351952) [1191 bp, 396 aa] {ON} Anc_4.1...    30   9.1  

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/406 (96%), Positives = 390/406 (96%)

Query: 1   MTTEIDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSEL 60
           MTTEIDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSEL
Sbjct: 1   MTTEIDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSEL 60

Query: 61  VVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI 120
           VVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI
Sbjct: 61  VVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI 120

Query: 121 IFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVF 180
           IFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVF
Sbjct: 121 IFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVF 180

Query: 181 QKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKA 240
           QKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKA
Sbjct: 181 QKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKA 240

Query: 241 SENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGY 300
           SENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGY
Sbjct: 241 SENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGY 300

Query: 301 DASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYK 360
           DASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYK
Sbjct: 301 DASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYK 360

Query: 361 YXXXXXXXXXXXXXXXXQHGVAESNKNKITISKFPNDLNFQLNLFA 406
           Y                QHGVAESNKNKITISKFPNDLNFQLNLFA
Sbjct: 361 YDICCDGLLLNLDDINNQHGVAESNKNKITISKFPNDLNFQLNLFA 406

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  291 bits (746), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 209/313 (66%), Gaps = 11/313 (3%)

Query: 13  LVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGR 72
           L+QIG  +Y V  EK GS YSSF L++ K +  S++L +    A+SEL+++DS+ SG+GR
Sbjct: 9   LLQIGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSL-ISLPSANSELIILDSVMSGIGR 67

Query: 73  TGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEF 132
             Q DF   V+KP+ ++   +HK I+T+   SI + A + E SK YTIIFLSGDTS+SEF
Sbjct: 68  KTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEF 127

Query: 133 INNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKD 192
           +N+   +  +N    S +K  +NI+ IP+GTGNA ASS++L  P + FQKFL N+LI   
Sbjct: 128 LNH---IPTQN----SNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180

Query: 193 FPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNI 252
           FPLY  + PN  + IFFII S+GFHANLLH C+  +Y+ MG ERF  AS  IFKNYDL  
Sbjct: 181 FPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKY 240

Query: 253 GLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNK 312
            ++  N    +S  YAYFAIINTPNLE  Y PSP SD   + LHLLG+++SL + +L+ +
Sbjct: 241 KVSIPN---RVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKR 297

Query: 313 IMAGYSYKEREKI 325
           I  G + ++ + I
Sbjct: 298 ITRGRTAQKGDDI 310

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  270 bits (690), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 196/317 (61%), Gaps = 15/317 (4%)

Query: 17  GDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQN 76
           G+  Y V   K GSKY+SF+LE     + S A    +    S L+V+DS+ SG+GRT  N
Sbjct: 11  GEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRA---STRSDDSTLIVLDSLKSGIGRTENN 67

Query: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136
           DFY+ V+ P+ +E N+ H YI+T   DS+   A   +  +DY I  +SGDT++SEF NNL
Sbjct: 68  DFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL 127

Query: 137 TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLY 196
              +          +  + I  +P+GTGNA A+S+   SP   F+ +LN+ L  +D PLY
Sbjct: 128 PNKKI--------TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLY 179

Query: 197 TVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTT 256
              LPN  +IIFF+IFS+GFHANLLHAC+  +Y KMG ERF  A+++I ++Y L++ ++ 
Sbjct: 180 RAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL 239

Query: 257 KNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAG 316
               + + R+YAYFA+INTPNLE  Y PSP S+  + EL LLGY +SL  ++LV KIM G
Sbjct: 240 ----DGLRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQG 295

Query: 317 YSYKEREKINNKDNLTY 333
           Y  K    +   +++ Y
Sbjct: 296 YQNKPNGDLPTNEDMIY 312

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  268 bits (685), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 138/332 (41%), Positives = 201/332 (60%), Gaps = 21/332 (6%)

Query: 5   IDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVID 64
           + S E +KL+ I  + Y V++E   S++   K  +   TE+   ++         L+VID
Sbjct: 1   MSSTEEIKLLNIHGICYSVISEPSESRFQLVKTAT--TTEDDRTVQ-----NQPNLIVID 53

Query: 65  SICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLS 124
           S+ SG GRT QND Y  VMKP+F+  N  H+ I+T   D+I   A+  + S+ +T++FLS
Sbjct: 54  SVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLS 113

Query: 125 GDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFL 184
           GDTS+SEFINNL +               ++I + P+G+GNA ASS+ +  P + F +F+
Sbjct: 114 GDTSISEFINNLPQ---------GAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFI 164

Query: 185 NNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENI 244
             E+    FPLY    PN  +I+FFII SMGFHANL+HAC+  EYQ+MG E+F  A   I
Sbjct: 165 RGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVI 224

Query: 245 FKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASL 304
            K Y+L++ +T      S++ +Y+YFA+INTPNLE  Y PSP+SD  K EL+LLGY + L
Sbjct: 225 LKEYELDLKITVN----SLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGL 280

Query: 305 STEKLVNKIMAGYSYKEREKINNKDNLTYYYP 336
           S ++ + K+M GY     +K+   D+ T Y P
Sbjct: 281 SKDQFLTKVMKGYELGPSDKL-PLDSDTIYVP 311

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  262 bits (669), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 199/325 (61%), Gaps = 18/325 (5%)

Query: 13  LVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLA------SSELVVIDSI 66
           L+ I    Y V    +GS Y SF L      E+S  L V   L       +++L+VIDSI
Sbjct: 9   LLTIDHDHYYVETVLEGSAYKSFNL----LIEDSTPLSVDRKLQFVPLKDTAQLIVIDSI 64

Query: 67  CSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGD 126
            SG GRT  NDFY NVM+P+F + N  H  ++T  +DS+++ A+K + +K Y I FLSGD
Sbjct: 65  HSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGD 124

Query: 127 TSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNN 186
           T++SEFIN L K      +  ++ K  ++I   P GTGNALA+S+ L+ P  +F  +L +
Sbjct: 125 TTISEFINGLPKQS----LDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180

Query: 187 ELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFK 246
              I +FPLY    PN   I+FF+I S+GFHANLLH C++  Y+K+G ERF  ASE+I  
Sbjct: 181 NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA 240

Query: 247 NY--DLNIGLTTKNGSESI--SRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDA 302
           NY  DLNI + +  G   I  SR Y+YF ++NTP LE  Y+PSP S+  +++LH++ Y +
Sbjct: 241 NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS 300

Query: 303 SLSTEKLVNKIMAGYSYKEREKINN 327
           SL  ++L+ +I+ GY     + +NN
Sbjct: 301 SLPKDELMARILKGYENNIGDVVNN 325

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  260 bits (664), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 201/325 (61%), Gaps = 13/325 (4%)

Query: 10  RLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSG 69
           R  LV        V  +K GSKY+ F L S  C +E A  +   L     L+V+DS+ SG
Sbjct: 6   RKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQ---LFTRENLIVLDSVHSG 62

Query: 70  VGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSV 129
            GRT  ND   NV++PV +  + +++ ++++   S+ +   + + ++ YTI+F+SGDTSV
Sbjct: 63  TGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSV 122

Query: 130 SEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELI 189
           SEF N +              +  + I  I +GTGNALA+S++L+ P + F  FL  EL+
Sbjct: 123 SEFFNGVGA-------GVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELV 175

Query: 190 IKDFPLYTVTLPNKKT-IIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNY 248
             +FPLY   LP+ +T ++FFI+ S+GFHANLLHA ++++Y+ MG ERF +AS +I +NY
Sbjct: 176 TAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNY 235

Query: 249 DLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEK 308
            L   +T     + ++ +YAYFA++N PNLE +Y+PSP SD FK+ELHLL Y +SL+ ++
Sbjct: 236 KLQEQITLDK--QGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQ 293

Query: 309 LVNKIMAGYSYKEREKINNKDNLTY 333
           L+ +IMAGY  +  +++      TY
Sbjct: 294 LLERIMAGYKNRRGDELTADPYTTY 318

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  258 bits (660), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 211/362 (58%), Gaps = 18/362 (4%)

Query: 1   MTTEIDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSEL 60
           M+    ++E L  V  G   ++V   K GSKY +FKL + +  ++      H       +
Sbjct: 1   MSQLATTIEPLCTVN-GSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY----ENV 55

Query: 61  VVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI 120
           VVIDS+ SG GR   N FYN V+KP+F     +H Y +T G  SI   A   + SK YT+
Sbjct: 56  VVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTV 115

Query: 121 IFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVF 180
           IF+SGDTS+SEFINNL  + +    + +  K  ++I  +P+GTGNA +SSI    P Q  
Sbjct: 116 IFISGDTSISEFINNLPPLLE----TSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTL 171

Query: 181 QKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSD-EYQKMGTERFAK 239
             FL+N      FPLY V  PN KT+IFFII S+G HAN+LH C++D +Y+K G ERF  
Sbjct: 172 SSFLHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKL 231

Query: 240 ASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLG 299
           A E +   YDLN+ L        +S  ++YF +INTPNLE +Y+PSP SD F  +LH+LG
Sbjct: 232 AFEKVMTTYDLNVRLQIP--ELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLG 289

Query: 300 YDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKY 359
           Y +SL+ E L+N +  GYS K  +++    N+  Y P++     + I+L  D +   EKY
Sbjct: 290 YSSSLNNEDLLNYVTQGYSNKLGDELVESSNMV-YKPIS---RNVSIVLTEDEES--EKY 343

Query: 360 KY 361
           KY
Sbjct: 344 KY 345

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  254 bits (650), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 195/315 (61%), Gaps = 12/315 (3%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSL-LASSELVVIDSICSGVGRTGQNDFY 79
           + VV E +GSK  SF L  +   + SA L+   +     +++V+DSI SG GR  +NDF 
Sbjct: 17  FSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVVDSIKSGTGRDVKNDFC 76

Query: 80  NNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFE-ASKDYTIIFLSGDTSVSEFINNLTK 138
            NV++PVF E    ++ ++TE E+S+ +L   F    ++ T+IFLSGDTS+SEF+NNLT+
Sbjct: 77  TNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIFLSGDTSISEFVNNLTQ 136

Query: 139 VQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLYTV 198
            Q+         +  +N+  +PLGTGNA A+S+   +      +FL   L  K+FPLY  
Sbjct: 137 EQQGTI------RPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFLKPKNFPLYKA 190

Query: 199 TLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTTKN 258
             PN   I+FFII S+GFHANLLH CD   ++K+G ERF  AS+ IF++Y L+  L    
Sbjct: 191 IFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQV-- 248

Query: 259 GSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAGYS 318
            ++    +Y+YFA+INTPNLE NY PSP S+   +ELHLLGY + L    L+N+IM GYS
Sbjct: 249 -TQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYS 307

Query: 319 YKEREKINNKDNLTY 333
            +    I N++ +TY
Sbjct: 308 NQPETDI-NEEGVTY 321

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  243 bits (621), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 178/271 (65%), Gaps = 13/271 (4%)

Query: 58  SELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLA--TKFEAS 115
           ++++VIDS+ SG  R  ++D Y  V++P+F+    ++KYI+TE E+SI+D A  T F++ 
Sbjct: 49  TQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSG 108

Query: 116 KDYTIIFLSGDTSVSEFINNL-TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
             Y I+FLSGDTS+SEFIN L T + +         K +++I  +PLG+GNALA+S+   
Sbjct: 109 FKYDILFLSGDTSISEFINALDTTILRSA-------KYRISILPVPLGSGNALATSLGFK 161

Query: 175 SPHQVFQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGT 234
           +P Q    +LN+       PLY   LPN  ++IFFII S+GFHANLLH  +  +Y+ MG 
Sbjct: 162 TPLQALITYLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGV 221

Query: 235 ERFAKASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNE 294
           ERF  AS+ +F++YDLN+G+   NG +  S++Y+YFA+I  PNLE  Y PSP S V K E
Sbjct: 222 ERFQVASKTVFESYDLNVGIAV-NGLQ--SQSYSYFAVIAAPNLEPTYKPSPKSSVLKKE 278

Query: 295 LHLLGYDASLSTEKLVNKIMAGYSYKEREKI 325
           LH+LGY A +  E L +KIM GY  K+ E I
Sbjct: 279 LHILGYKAGICLEDLQDKIMRGYHNKDGEDI 309

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  235 bits (599), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 182/324 (56%), Gaps = 11/324 (3%)

Query: 11  LKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGV 70
           + LV      +    E   +KY+SF L S       A+L+        +++++DSI SG 
Sbjct: 7   VPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVDSIKSGT 66

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTI-IFLSGDTSV 129
           GR  +N+F  NV++P+F      HK +RT+  D+   L   F+ S + TI IFLSGDT++
Sbjct: 67  GRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTI 126

Query: 130 SEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELI 189
           SEF+N L +   E        +  +++  +PLGTGNA A+S+ L  P      FL  +L 
Sbjct: 127 SEFLNGLNRRVFEGL------RHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180

Query: 190 IKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYD 249
            + FPLY  T PN   +IFFII S+GFHANLLH C    +Q +G ERF  AS  I + Y 
Sbjct: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240

Query: 250 LNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKL 309
           L   L     S   +R+Y+YFA+INTPNLE +Y PSP S+    +LH+LGY + L    L
Sbjct: 241 LEYRLQV---SGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASL 297

Query: 310 VNKIMAGYSYKEREKINNKDNLTY 333
           V+KIM GYS +  + I+  D + Y
Sbjct: 298 VSKIMKGYSNRAGDDISG-DGVIY 320

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  231 bits (590), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 172/281 (61%), Gaps = 16/281 (5%)

Query: 57  SSELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASK 116
           S EL+++DS+ SG GR    DF  NV+   F++    ++ I+T  + S+ +LA+  ++++
Sbjct: 58  SGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTR 117

Query: 117 DYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSP 176
            YT++FLSGDTS+SEF+NNL             N   +++   P+GTGNA ASS+ L  P
Sbjct: 118 QYTVLFLSGDTSISEFVNNLPL-----------NHDCISVLPFPMGTGNAWASSLKLMDP 166

Query: 177 HQVFQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTER 236
             +F +F+N +L   DFPLY  T  N   + FFII S+GFHANLLH C+ DEYQKMG ER
Sbjct: 167 AVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIER 226

Query: 237 FAKASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELH 296
           F  AS+ I + Y L   ++  +  E    +++YFA+INT NLE  YMPSPDSD  +++LH
Sbjct: 227 FRVASQRILREYKLESRVSIPDILEG---SFSYFALINTTNLEPTYMPSPDSDPLESQLH 283

Query: 297 LLGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPV 337
           +L Y +SL   +   ++  GYS  +   I    N T+Y P+
Sbjct: 284 VLAYQSSLDRVEFQKRVFMGYSNTKHSNI--LQNGTFYRPL 322

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  232 bits (592), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 192/309 (62%), Gaps = 33/309 (10%)

Query: 57  SSELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASK 116
           +++L++IDS  SG+GR  +NDFY  +M+P+  + N K +  +T  +DSIK  A  F    
Sbjct: 81  NTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKT 140

Query: 117 ------DYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASS 170
                 DY +IFLSGDT++SEF NNL   Q +       +K  +NI TIP+GT NA ++S
Sbjct: 141 KDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQ------TSKINLNILTIPMGTANAWSNS 194

Query: 171 IHLSSPHQVFQKFLNNELIIKDFPLYTVTLPN-------------KKTIIFFIIFSMGFH 217
           ++L+ P  +FQKFL N+L +  FPLY++ LP+             K TI FFI+ SMGFH
Sbjct: 195 LNLNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFH 254

Query: 218 ANLLHACDSDE-YQKMGTERFAKASENIFKNYDLNIGLTTKNGSES----ISRNYAYFAI 272
           ANLLH C +DE Y  +G ERF  AS+ I  NY+LN+ +T ++ ++     ++ +++YF +
Sbjct: 255 ANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNL 314

Query: 273 INTPNLELNYMPSPDSDVFKNELHLLGYDA-SLSTEKLVNKIMAGYSYKEREK-INNKD- 329
           +NTP LE NY+PSP SD  KN LH+L Y +   + ++L+  IM GYS +  +K I N D 
Sbjct: 315 MNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDE 374

Query: 330 NLTYYYPVN 338
           +   Y+P+N
Sbjct: 375 DGIIYFPIN 383

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  229 bits (585), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 14/261 (5%)

Query: 60  LVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYT 119
           LVV+DS+ SG GR    DFY  VM PV    + +H+Y+RT    S+++LA  F  + + T
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 120 IIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQV 179
           ++ +SGDT++SEF+N L             +   + ++ +PLGT NA A S+ L +P + 
Sbjct: 197 VLVMSGDTTISEFVNALG------------SGAGVTVYALPLGTANAWAHSVGLGTPAKA 244

Query: 180 FQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAK 239
            Q F+   +    FPLY    P+  +I FFI+ S GFHANLLH C+ + YQ++G ERF +
Sbjct: 245 LQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFRE 304

Query: 240 ASENIFKNYDL--NIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHL 297
           AS  I   Y L  ++ +   +GSE ++  YAYFA++NTP+LE  Y+PSP SD    +LH+
Sbjct: 305 ASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHV 364

Query: 298 LGYDASLSTEKLVNKIMAGYS 318
           L ++A LS +KL   +MAGYS
Sbjct: 365 LAFEAELSRDKLNELLMAGYS 385

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  147 bits (370), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 98/151 (64%), Gaps = 5/151 (3%)

Query: 199 TLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTTKN 258
           T P+   I FFII S+GFHA LLHAC   E  KMGTERF  A++ I + YDL++ +    
Sbjct: 3   TFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVNK 62

Query: 259 GSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAGYS 318
            +    R YAYFAIINT NLEL Y PSP S+V +N L LLGY + LS  +LV+KIM GY 
Sbjct: 63  ST----RRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYI 118

Query: 319 YKEREKINNKDNLTYYYPVNLSGTGLQIILE 349
            ++ + I   D  TYY  ++LS +G+ II++
Sbjct: 119 IRKGDVIKT-DEYTYYETLDLSQSGIDIIVD 148

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+   +  +N   KP+   +N K + I T       D+A   + SK   I   SGD    
Sbjct: 272 GKGKASKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISKYDIIACASGDGIPY 331

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L   Q+ + +   +   ++ I  IP G+GNA++ S H +
Sbjct: 332 EVINGL--YQRPDRV---DAFNKLTITQIPCGSGNAMSISCHWT 370

>Suva_11.17 Chr11 (34690..35130,35204..36985) [2223 bp, 740 aa] {ON}
           YKL205W (REAL)
          Length = 740

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 69/161 (42%), Gaps = 34/161 (21%)

Query: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136
           DF NN  +  F+   F  + +  +  +   +   +F+  K++  I +  D S+  F+NN+
Sbjct: 73  DFLNNFQQICFRRMKFSDEEVTQDDFEEFNE-TIRFKL-KNFQEIIVVIDPSL--FLNNI 128

Query: 137 TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLY 196
           T+    N ++C     Q+                   S P Q   +FLN  L++KDF L 
Sbjct: 129 TQEISANLMNCKNENWQV----------------FMTSQPSQTLVRFLNELLLMKDFLL- 171

Query: 197 TVTLPNKKTIIFFI---------IFSMGFHANLLHACDSDE 228
             T+ N++  I F+         IFS    AN  +A D DE
Sbjct: 172 --TIDNEQIQILFMELIVKNYNFIFSAS--ANTANATDDDE 208

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      Y + +KP+   +N   + + T       DLA   +A K   I   SGD    
Sbjct: 189 GKGHAKKLYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDADKFDIIACASGDGIPH 248

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIH 172
           E +N L   Q+ +    ++   ++ I  +P G+GNA++ S H
Sbjct: 249 EVLNGL--FQRPDR---ADAFNKLIITQLPCGSGNAMSVSCH 285

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 83  MKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL-TKVQK 141
           ++P+ K   FK +   TE       +A K +  K  TI+  SGD    E IN L  +  +
Sbjct: 250 VEPILKLTFFKFEVKLTEYHRHAMQIARKLDLDKFDTIVCASGDGIPYEVINGLYQRTDR 309

Query: 142 ENFISCSENKRQMNIFTIPLGTGNALASSIH 172
            N  +      ++ +  +P G+GNA++ S H
Sbjct: 310 SNAFN------KLCVTQLPCGSGNAMSISCH 334

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      Y +  +P+ K +        T+      D+A + + SK  TI   SGD    
Sbjct: 212 GKGNAKKIYLSKCEPILKASTATVDIAYTKYAGHAIDIAREVDLSKYDTIACASGDGIPY 271

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSS 175
           E IN L   Q+ + +   +   ++ +  IP G+GNA++ S H ++
Sbjct: 272 EVINGLN--QRSDRV---DAFNKLAVTQIPCGSGNAMSVSCHWTT 311

>Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON}
           (90148..92016) [1869 nt, 623 aa]
          Length = 622

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 107 DLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNA 166
           D+  + + SK  TI   SGD    E +N L   Q+ + +   E   ++ I  +P G+GNA
Sbjct: 290 DIGRELDISKYDTIACASGDGIPYEILNGL--YQRPDRV---EAFNKLAITQLPCGSGNA 344

Query: 167 LASSIHLSS 175
           ++ S H SS
Sbjct: 345 MSISCHWSS 353

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 84  KPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKEN 143
           KP+   +N   + I T+      D+A   + +K   I   SGD    E IN L +     
Sbjct: 244 KPILIASNCSLEIIHTKYSRHALDIAKDLDITKYDVIACASGDGIPYEVINGLYQRPDR- 302

Query: 144 FISCSENKRQMNIFTIPLGTGNALASSIHLS 174
               ++   ++ I  +P G+GNA++ S H +
Sbjct: 303 ----ADAFNKLTITQVPCGSGNAMSISCHWT 329

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      Y +  KP+   +  K   + TE      ++A + + +K  TI+  SGD    
Sbjct: 300 GKGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEMDINKYDTIVCASGDGIPY 359

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L + +K+   + S    ++ I  +P G+ NA++ S H +
Sbjct: 360 EIINGLYQ-RKDRAAAFS----KLAITQLPCGSANAMSVSCHWT 398

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 107 DLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNA 166
           D+A + + SK  TI+  SGD    E IN L +          E   ++ I  +P G+GNA
Sbjct: 448 DIAREMDISKYDTIVCASGDGIPYEVINGLYRRPDR-----VEAFNKLAITQLPCGSGNA 502

Query: 167 LASSIHLS 174
           ++ S H +
Sbjct: 503 MSVSCHWT 510

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 5/105 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      + +  KP+   +N       T+      D+A + +  K  TI   SGD    
Sbjct: 254 GKGKAKKMFMSKCKPILLASNCSIDTAYTKYAMHAVDIAREIDLDKYDTIACASGDGIPY 313

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSS 175
           E IN L +         +E   ++ I  +P G+GNA++ S H +S
Sbjct: 314 EVINGLYQRPDR-----AEAFTKLAITQLPCGSGNAMSVSCHWTS 353

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 61/154 (39%), Gaps = 7/154 (4%)

Query: 22  DVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFYNN 81
           D+V +K      S    S    EE       S   +  ++VI +   G GR   N  Y +
Sbjct: 144 DLVPKKVTLSIDSLASSSTDVVEEILDRSYKSTKRNKSILVIINPHGGKGRA--NKLYVS 201

Query: 82  VMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQK 141
             KP+   +    + + T       D+A   +  K   I   SGD    E +N L +   
Sbjct: 202 KAKPILIASQCTVEILETTYHRHAIDIAQNIDIDKYDVIACASGDGIPHEVLNGLYRRAD 261

Query: 142 ENFISCSENKRQMNIFTIPLGTGNALASSIHLSS 175
                 ++   ++ I  +P G+GNA++ S H +S
Sbjct: 262 R-----AKAFNKVAITQLPCGSGNAMSVSCHGTS 290

>Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON}
           YOR171C (REAL)
          Length = 624

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 84  KPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKEN 143
           +P+  E+  K +   T+      D+A   + SK  TI   SGD    E IN L +     
Sbjct: 256 RPILLESGCKIEIAYTKYARHAIDIAKDLDISKYDTIACASGDGIPYEVINGLYRRPDR- 314

Query: 144 FISCSENKRQMNIFTIPLGTGNALASSIHLS 174
                E   ++ +  +P G+GNA++ S H +
Sbjct: 315 ----VEAFNKLAVTQLPCGSGNAMSISCHWT 341

>YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON}
           LCB4Sphingoid long-chain base kinase, responsible for
           synthesis of long-chain base phosphates, which function
           as signaling molecules, regulates synthesis of ceramide
           from exogenous long-chain bases, localizes to the Golgi
           and late endosomes
          Length = 624

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 60  LVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYT 119
           LV+I+    G   T +N F     +P+  E+  K +   T+      D+A   + SK  T
Sbjct: 230 LVIINP--HGGKGTAKNLFLTKA-RPILVESGCKIEIAYTKYARHAIDIAKDLDISKYDT 286

Query: 120 IIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           I   SGD    E IN L +          +   ++ +  +P G+GNA++ S H +
Sbjct: 287 IACASGDGIPYEVINGLYRRPDR-----VDAFNKLAVTQLPCGSGNAMSISCHWT 336

>YKL205W Chr11 (50051..53353) [3303 bp, 1100 aa] {ON}  LOS1Nuclear
           pore protein involved in nuclear export of pre-tRNA and
           in re-export of mature tRNAs after their retrograde
           import from the cytoplasm
          Length = 1100

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 28/171 (16%)

Query: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136
           DF +N  +  FK   F    +  +  +   +   +F+  K++  I +  D S+  F+NN+
Sbjct: 415 DFLDNFQQICFKRMKFSDDEVTQDDFEEFNE-TVRFKL-KNFQEIIVVIDPSL--FLNNI 470

Query: 137 TKVQKENFISCSENKRQM------NIFTIPLGTGNAL----ASSIHLSSPHQVFQKFLNN 186
           ++    N ++C     Q+       IF +   T N       + I  S P     +FLN 
Sbjct: 471 SQEISANLMNCKNESWQIFELTIYQIFNLSECTKNNYFGLNKNEIMTSQPSLTLVRFLNE 530

Query: 187 ELIIKDFPLYTVTLPNKKTIIFFI---------IFSMGFHANLLHACDSDE 228
            L++KDF L    + N++  I F+         IFS    AN  +A D DE
Sbjct: 531 LLMMKDFLL---AIDNEQIQILFMELIVKNYNFIFSTS--ANTANATDDDE 576

>KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6.48
           YOR171C
          Length = 717

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 5/104 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      +    +P+ + + FK     T+       +A   +  K  TI   SGD    
Sbjct: 327 GKGNAKKIFMRKARPLLQASGFKIDVKYTKYSGHAVQIAQGIDIHKYDTICCASGDGIPH 386

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L + +K+   + +    ++ I  IP G+GNA++ S H +
Sbjct: 387 EVINGLYR-RKDRVAAFN----KLTITQIPCGSGNAMSVSCHWT 425

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      +    KP+   +    + + T+      ++A + +  K  TI   SGD    
Sbjct: 280 GKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPH 339

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L   Q+ + +    N   + I  IP G+GNA++ S H +
Sbjct: 340 EVINGL--YQRPDHVKAFNN---IAITEIPCGSGNAMSVSCHWT 378

>Smik_11.20 Chr11 (34512..37823) [3312 bp, 1103 aa] {ON} YKL205W
           (REAL)
          Length = 1103

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 73/171 (42%), Gaps = 28/171 (16%)

Query: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136
           DF NN  +  FK   F    I  +  +   +   +F+  K++  + +  D S+  F+NN+
Sbjct: 415 DFLNNFQQVCFKRMKFSDDEITQDDFEEFNE-TIRFKL-KNFQEVIVVIDPSL--FLNNI 470

Query: 137 TKVQKENFISCSENKRQM------NIFTIPLGTGNAL----ASSIHLSSPHQVFQKFLNN 186
           T+    N ++C     Q+       IF +     N       + I  S P     +FLN 
Sbjct: 471 TQEISVNLMNCKNENWQVFELTIYQIFNLSECIKNNYFGLNKNEIMTSQPSLTLVRFLNE 530

Query: 187 ELIIKDFPLYTVTLPNKKTIIFFI---------IFSMGFHANLLHACDSDE 228
            L++K+F L   T+ N++  I F+         IFS    AN  +A D DE
Sbjct: 531 LLMMKEFLL---TIDNEQIQILFMELIVKNYNFIFSTS--ANTSNATDDDE 576

>Skud_11.16 Chr11 (33522..36821) [3300 bp, 1099 aa] {ON} YKL205W
           (REAL)
          Length = 1099

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 70/171 (40%), Gaps = 28/171 (16%)

Query: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136
           DF NN  +  FK   F    I  +  +   + A +F+  K +  I +  D  +  F NN+
Sbjct: 415 DFLNNFQQICFKRMKFSDDEITQDDFEEFNE-AIRFKL-KIFQEIIVVIDPIL--FANNI 470

Query: 137 TKVQKENFISCSENKRQM------NIFTIPLGTGNAL----ASSIHLSSPHQVFQKFLNN 186
           T+    N ++C     Q+       IF +     N       + I  S P     +FLN 
Sbjct: 471 TQEISTNLMNCKNESWQVFELTIYQIFNLSECIKNNYFGLNKNEIMTSQPSLTLVRFLNE 530

Query: 187 ELIIKDFPLYTVTLPNKKTIIFFI---------IFSMGFHANLLHACDSDE 228
            L++KDF L   T+ N++  I F+         IFS    AN   A D DE
Sbjct: 531 LLMMKDFLL---TIDNEQIQILFMELIVKNYNFIFSTS--ANTASATDDDE 576

>Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {ON}
           YOR171C (REAL)
          Length = 625

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 84  KPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKEN 143
           +P+  E+  K +   T+      D+A   +  K  TI   SGD    E IN L +     
Sbjct: 253 QPILAESGCKIEIAYTKYARHAIDIAKDLDIRKYDTIACASGDGIPYEVINGLYRRSDR- 311

Query: 144 FISCSENKRQMNIFTIPLGTGNALASSIHLS 174
                E   ++ +  +P G+GNA++ S H +
Sbjct: 312 ----VEAFNKLAVTQLPCGSGNAMSISCHWT 338

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 107 DLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNA 166
           D+A + + +K  TI   SGD    E IN L + +     + + NK  ++I  +P G+GNA
Sbjct: 307 DIAREVDLNKYDTIACASGDGIPYEVINGLYQRKDR---AAAFNK--LSITQLPCGSGNA 361

Query: 167 LASSIHLSS 175
           ++ + H +S
Sbjct: 362 MSVTCHWTS 370

>KLTH0H02244g Chr8 (203853..203855,204273..204632) [363 bp, 120 aa]
           {ON} highly similar to uniprot|P39741 Saccharomyces
           cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
           component of the large (60S) ribosomal subunit
          Length = 120

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 44  EESAALEVHSLLASSELVVIDSICSGVGR--TGQNDFYNNVMKPVFKEANFKHKYIRTEG 101
           +E AAL+V  L +   L  I ++   + R  T  N+   N +K ++K A ++ K +R + 
Sbjct: 26  KELAALKVQKL-SRPSLPKIHTVRKDIARVLTIVNENQRNAVKELYKGAKYQPKDMRAKK 84

Query: 102 EDSIKDLATKFEASK 116
             +++   TKFEAS+
Sbjct: 85  TRALRRALTKFEASR 99

>AGR025W Chr7 (761509..762648) [1140 bp, 379 aa] {ON} NOHBY732; No
           homolog in Saccharomyces cerevisiae
          Length = 379

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 4/72 (5%)

Query: 149 ENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFP--LYTVTLPNKKTI 206
           ++ R  +IF  P  +G   A+S      HQ+  KFL +E+   D P  L  V L N    
Sbjct: 120 KHNRLFSIFCKPAESGIPFAAS--FGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGK 177

Query: 207 IFFIIFSMGFHA 218
            FF  F + F+A
Sbjct: 178 TFFATFQIFFYA 189

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 13/108 (12%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      +    KP+   +    + + T+      ++A + +  K  TI   SGD    
Sbjct: 271 GKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPH 330

Query: 131 EFINNL----TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L     +V+  N         Q+ I  IP G+GNA++ S H +
Sbjct: 331 EVINGLYRRPDRVKAFN---------QLAITEIPCGSGNAMSVSCHWT 369

>Kwal_YGOB_Anc_7.306 s56
           complement(1002158..1002517,1002808..1002810) [363 bp,
           120 aa] {ON} ANNOTATED BY YGOB -
          Length = 120

 Score = 30.4 bits (67), Expect = 3.2,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 44  EESAALEVHSLLASSELVVIDSICSGVGR--TGQNDFYNNVMKPVFKEANFKHKYIRTEG 101
           +E AAL+V  L +   L  I ++   + R  T  N+   N +K ++K A ++ K +R + 
Sbjct: 26  KELAALKVQKL-SRPSLPKIHTVRKDIARVLTIINENQRNAVKELYKGAKYQPKDMRAKK 84

Query: 102 EDSIKDLATKFEASK 116
             +++   TKFEAS+
Sbjct: 85  TRALRRALTKFEASR 99

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 107 DLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNA 166
           ++A + +  K  TI   SGD    E IN L   ++E+ +       ++ I  IP G+GNA
Sbjct: 399 EIAKEMDIDKFDTIACASGDGIPHEVINGL--YRREDRVKAFN---KLTITQIPCGSGNA 453

Query: 167 LASSIHLS 174
           ++ S H +
Sbjct: 454 MSVSCHWT 461

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           GR   N  Y    KP+   +    +  +T   +   ++A   +  K   I   SGD    
Sbjct: 212 GRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDIDKYDVIACASGDGIPY 271

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIH 172
           E +N L + +       ++   ++ +  +P G+GNA++ S H
Sbjct: 272 EVLNGLYRREDR-----AKAFNKVAVTQLPCGSGNAMSVSCH 308

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 85  PVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL----TKVQ 140
           P+  E+  K +   T+      D+A   + SK  TI   SGD    E IN L     +V 
Sbjct: 256 PILVESGCKIEIAYTKYARHAIDIARDLDISKYDTIACASGDGIPYEVINGLFRRPDRVD 315

Query: 141 KENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
             N ++ ++         +P G+GNA++ S H +
Sbjct: 316 AFNKVAVTQ---------LPCGSGNAMSISCHWT 340

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 7/106 (6%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+   +  Y    KP+   ++ +   + T+      ++A   + +K   I   SGD    
Sbjct: 205 GKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATMDINKYDVIACASGDGIPH 264

Query: 131 EFINNL-TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSS 175
           E +N L T+  +    +      ++ I  +P G+GNA++ S H +S
Sbjct: 265 EVLNGLFTRPDRVAAFN------KLAITQLPCGSGNAMSISCHGTS 304

>ACL198W Chr3 (15601..16785) [1185 bp, 394 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR355C (ILV5)
          Length = 394

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY- 79
           Y+V+ E   + +S+F  E++  T E A   +  L+    +  +   CS   R G  D+Y 
Sbjct: 274 YEVLRE---NGHSAF--EAFNETGEEATQSLDPLIGKHGMDYMYDACSTTARRGALDWYP 328

Query: 80  --NNVMKPVFKE 89
              N +KPVF++
Sbjct: 329 IFKNALKPVFRD 340

>TBLA0D05380 Chr4 complement(1325855..1327729) [1875 bp, 624 aa]
           {ON} Anc_1.284 YJL083W
          Length = 624

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 51/137 (37%), Gaps = 16/137 (11%)

Query: 65  SICSGVGRTGQNDF-YNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFL 123
           SI   +  T  ND  +NN   P      + H+  +    D IK+    F  S D   I  
Sbjct: 278 SINGQIDATMMNDTPFNNKFPPSTNSKKYHHRLYKQRKRDRIKNKIENFIPSIDSASISS 337

Query: 124 SGDTSVSEFINNLTKVQKENFISCSENKRQMNIFT-------------IPLGTGNALASS 170
            G+TS      +  K    + +S + NK   N+ T             +P    NA A+ 
Sbjct: 338 GGNTSPQMLTISSRKHHHRHILSGTSNK--SNVITNSLNQVAKNSKARLPKTNANANANP 395

Query: 171 IHLSSPHQVFQKFLNNE 187
           IH  + H   ++  N +
Sbjct: 396 IHHRAHHNHRKQIFNED 412

>YLR355C Chr12 complement(838066..839253) [1188 bp, 395 aa] {ON}
           ILV5Bifunctional acetohydroxyacid reductoisomerase and
           mtDNA binding protein; involved in branched-chain amino
           acid biosynthesis and maintenance of wild-type
           mitochondrial DNA; found in mitochondrial nucleoids
          Length = 395

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY- 79
           YDV+ E   S       E++  T E A   ++ L+    +  +   CS   R G  D+Y 
Sbjct: 275 YDVLRENGHSPS-----EAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYP 329

Query: 80  --NNVMKPVFKE 89
              N +KPVF++
Sbjct: 330 IFKNALKPVFQD 341

>KNAG0G03550 Chr7 (754676..755629) [954 bp, 317 aa] {ON} Anc_8.862
           YML125C
          Length = 317

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 313 IMAGYSYKEREKINNKDNLTYYYPVN--LSGTGLQIILETDSDKKLEKY 359
           I AG+    R  I  KD + +Y P+N  +    L II+++  D K+ KY
Sbjct: 105 IPAGHHVAVRIPIGGKDEIRFYNPINPKIDQGHLDIIVKSYQDGKVSKY 153

>Smik_12.443 Chr12 complement(777177..778364) [1188 bp, 395 aa] {ON}
           YLR355C (REAL)
          Length = 395

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY- 79
           YDV+ E   S       E++  T E A   ++ L+    +  +   CS   R G  D+Y 
Sbjct: 275 YDVLRENGHSPS-----EAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYP 329

Query: 80  --NNVMKPVFKE 89
              N +KPVF++
Sbjct: 330 IFKNALKPVFQD 341

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 71  GRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVS 130
           G+      +   ++P+   +    + + T+      D+A + +  +  TI   SGD    
Sbjct: 179 GKGKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIACASGDGVPY 238

Query: 131 EFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLS 174
           E IN L    +E+ +   +   ++ +  +P G+GNA++ S H +
Sbjct: 239 EVINGL--YMREDKV---DAFNKITVTQLPCGSGNAMSISCHWT 277

>Suva_10.456 Chr10 complement(797588..798775) [1188 bp, 395 aa] {ON}
           YLR355C (REAL)
          Length = 395

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY- 79
           YDV+ E   S       E++  T E A   ++ L+    +  +   CS   R G  D+Y 
Sbjct: 275 YDVLRENGHSPS-----EAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYP 329

Query: 80  --NNVMKPVFKE 89
              N +KPVF++
Sbjct: 330 IFKNALKPVFQD 341

>Skud_12.440 Chr12 complement(778396..779583) [1188 bp, 395 aa] {ON}
           YLR355C (REAL)
          Length = 395

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY- 79
           YDV+ E   S       E++  T E A   ++ L+    +  +   CS   R G  D+Y 
Sbjct: 275 YDVLRENGHSPS-----EAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYP 329

Query: 80  --NNVMKPVFKE 89
              N +KPVF++
Sbjct: 330 IFKNALKPVFQD 341

>TDEL0E01840 Chr5 (350762..351952) [1191 bp, 396 aa] {ON} Anc_4.190
           YLR355C
          Length = 396

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 38  ESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQNDFY---NNVMKPVFKE 89
           ES+  T E A   ++ L+    +  +   CS   R G  D+Y    N +KPVF++
Sbjct: 288 ESFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPIFKNALKPVFQD 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,213,945
Number of extensions: 1994223
Number of successful extensions: 6582
Number of sequences better than 10.0: 74
Number of HSP's gapped: 6753
Number of HSP's successfully gapped: 74
Length of query: 406
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 294
Effective length of database: 40,638,807
Effective search space: 11947809258
Effective search space used: 11947809258
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)