Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D046105.702ON1183118349680.0
KLTH0E01056g5.702ON17714922956e-26
CAGL0G02497g5.702ON17804072374e-19
Ecym_40185.702ON17691322294e-18
Smik_11.3585.702ON18783972285e-18
Kpol_2001.755.702ON10065122267e-18
TDEL0B021905.702ON18104682251e-17
NCAS0A032005.702ON17881512187e-17
KNAG0L021405.702ON16084532179e-17
Kpol_1043.705.702ON13214302151e-16
Kwal_55.196975.702ON17604232151e-16
KAFR0D022205.702ON16744122152e-16
ZYRO0G06600g5.702ON18201392133e-16
YKR095W (MLP1)5.702ON18754392115e-16
KLLA0A00594g5.702ON17481462081e-15
Skud_11.3345.702ON18854042081e-15
SAKL0E14916g5.702ON17794192034e-15
AFR286W5.702ON17581322026e-15
Suva_11.3315.702ON18984292018e-15
YIL149C (MLP2)5.702ON16791911883e-13
TBLA0E017305.702ON18201361839e-13
NDAI0E050405.702ON19733281821e-12
Smik_9.205.702ON16821521741e-11
KNAG0C065905.702ON16511281685e-11
NCAS0G002305.702ON17354051661e-10
Suva_9.395.702ON16824061642e-10
TPHA0E002305.702ON12845651623e-10
NDAI0F002905.702ON1554941588e-10
Skud_9.195.702ON16801751533e-09
KAFR0H002105.702ON14541321426e-08
KNAG0D010406.231ON55660850.21
KAFR0B030608.315ON16864761.3
KAFR0G020908.604ON732491762.9
Ecym_55145.414ON854218754.5
NDAI0G030303.177ON111977745.0
ZYRO0F15378g2.16ON92879746.1
KLLA0E24949gsingletonON484110736.9
ZYRO0F06160g8.624ON102936729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04610
         (1183 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...  1918   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   118   6e-26
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    96   4e-19
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    93   4e-18
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    92   5e-18
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    92   7e-18
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    91   1e-17
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    89   7e-17
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    88   9e-17
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    87   1e-16
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...    87   1e-16
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    87   2e-16
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    87   3e-16
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    86   5e-16
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    85   1e-15
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    85   1e-15
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    83   4e-15
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    82   6e-15
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    82   8e-15
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    77   3e-13
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    75   9e-13
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    75   1e-12
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    72   1e-11
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    69   5e-11
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    69   1e-10
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    68   2e-10
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    67   3e-10
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    65   8e-10
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    64   3e-09
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    59   6e-08
KNAG0D01040 Chr4 complement(175315..176985) [1671 bp, 556 aa] {O...    37   0.21 
KAFR0B03060 Chr2 (637546..638052) [507 bp, 168 aa] {ON} Anc_8.31...    34   1.3  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    34   2.9  
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    33   4.5  
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              33   5.0  
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    33   6.1  
KLLA0E24949g Chr5 (2212047..2213501) [1455 bp, 484 aa] {ON} simi...    33   6.9  
ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa] ...    32   9.0  

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 1918 bits (4968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1014/1183 (85%), Positives = 1014/1183 (85%)

Query: 1    MNKQETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLVXXXXXXXXXXXXXXXINKKQ 60
            MNKQETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLV               INKKQ
Sbjct: 1    MNKQETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLVLSNSLNLSNNNSNNSINKKQ 60

Query: 61   LDFSELEKRFEVINSINEQLKNELYTKNKEYFQIKQECDVKIEDYKSNLNELKHRLSKEI 120
            LDFSELEKRFEVINSINEQLKNELYTKNKEYFQIKQECDVKIEDYKSNLNELKHRLSKEI
Sbjct: 61   LDFSELEKRFEVINSINEQLKNELYTKNKEYFQIKQECDVKIEDYKSNLNELKHRLSKEI 120

Query: 121  LXXXXXXXXXXXVYEHSINESLENDKKYVKDFEKLETLESKFLETYDQMNIMKNKIYFNT 180
            L           VYEHSINESLENDKKYVKDFEKLETLESKFLETYDQMNIMKNKIYFNT
Sbjct: 121  LQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLESKFLETYDQMNIMKNKIYFNT 180

Query: 181  QPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVVYKLQERLETVSTMNKEL 240
            QPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVVYKLQERLETVSTMNKEL
Sbjct: 181  QPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVVYKLQERLETVSTMNKEL 240

Query: 241  LKIIKLSENEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTXXXXXXXXXXXX 300
            LKIIKLSENEEM                                  KT            
Sbjct: 241  LKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDFEFDINNIDDIKTELIKEKYEKSLL 300

Query: 301  XXXFNDFLFDIESKLPYLQXXXXXXXXXXXXKIEEQKIIHEHDSLKLENQSLKIKLNDFE 360
               FNDFLFDIESKLPYLQ            KIEEQKIIHEHDSLKLENQSLKIKLNDFE
Sbjct: 301  EKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHEHDSLKLENQSLKIKLNDFE 360

Query: 361  STVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQN 420
            STVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQN
Sbjct: 361  STVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQN 420

Query: 421  IISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQR 480
            IISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQR
Sbjct: 421  IISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQR 480

Query: 481  MIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTN 540
            MIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTN
Sbjct: 481  MIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTN 540

Query: 541  QSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGNE 600
            QSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGNE
Sbjct: 541  QSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGNE 600

Query: 601  TAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTID 660
            TAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTID
Sbjct: 601  TAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTID 660

Query: 661  SFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ 720
            SFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ
Sbjct: 661  SFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ 720

Query: 721  DKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQ 780
            DKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQ
Sbjct: 721  DKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQ 780

Query: 781  AKDKLNEFKGTENKLREDYCDLEKSKNXXXXXXXXXXXXXXXXXXXIVKMKDELMTSNNE 840
            AKDKLNEFKGTENKLREDYCDLEKSKN                   IVKMKDELMTSNNE
Sbjct: 781  AKDKLNEFKGTENKLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKMKDELMTSNNE 840

Query: 841  LDNNQRSQEELRNEYEKQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLK 900
            LDNNQRSQEELRNEYEKQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLK
Sbjct: 841  LDNNQRSQEELRNEYEKQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLK 900

Query: 901  EMVKKDIEIENDXXXXXXXXXXXXNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIR 960
            EMVKKDIEIEND            NSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIR
Sbjct: 901  EMVKKDIEIENDIILKAKLKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIR 960

Query: 961  IEDAENQAMAXXXXXXXXXXXXXXXXXXXXXXDQYNNXXXXXXXXXXXXXXXXYAMELET 1020
            IEDAENQAMA                      DQYNN                YAMELET
Sbjct: 961  IEDAENQAMARTRKELEKEYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKYAMELET 1020

Query: 1021 KLKNETDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIP 1080
            KLKNETDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIP
Sbjct: 1021 KLKNETDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIP 1080

Query: 1081 STTNLSTNFAFGQNPFVSNASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQ 1140
            STTNLSTNFAFGQNPFVSNASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQ
Sbjct: 1081 STTNLSTNFAFGQNPFVSNASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQ 1140

Query: 1141 PTLTFNTDFSNESKDLKRXXXXXXXXXXXXXGDNKIAKIQRDD 1183
            PTLTFNTDFSNESKDLKR             GDNKIAKIQRDD
Sbjct: 1141 PTLTFNTDFSNESKDLKRSAESAAEDDEVEEGDNKIAKIQRDD 1183

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score =  118 bits (295), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 123/492 (25%), Positives = 244/492 (49%), Gaps = 45/492 (9%)

Query: 307 FLFDIESKLPYLQXXXXXXXXXXXXKIEEQ---------KIIHEHDSLKLENQSLKIKLN 357
           F+ ++ESK+P L              +EEQ          I  + +S+ L+ +  K +++
Sbjct: 412 FVVELESKVPMLSSFKDRNDM-----LEEQLAETAYMLESISKDKESVALDLRRTKAQIH 466

Query: 358 DFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTE 417
           DFE  +  L +QRSDL  Q+ YLLI Q+ +  D+   LT  E+ F+R ++ Q   +   +
Sbjct: 467 DFEIQISELTRQRSDLARQVQYLLI-QASVRSDSKGPLTTEEIAFVRRILEQGDLSLERD 525

Query: 418 TQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEA 477
           TQ +ISERL++F ++ +L +KN  L+  +R L +K+ES E+Q+  +   +E D  +I EA
Sbjct: 526 TQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVEND--AIREA 583

Query: 478 KQRMIVLKEEN----------VKNKDIINQI---------ISEKKLLEDKIHGLNSTVTE 518
           K+ +I L+E             K +D    I         I+E  L   K   +++ V +
Sbjct: 584 KEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSK-GKMSARVDD 642

Query: 519 LNKSMEIKREPTLKNLELQKTN-QSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTE 577
           L +S+  +RE   KN+++  +  Q LL +  +L+IEI        + +E+  +   S   
Sbjct: 643 LERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKL 702

Query: 578 LKELKSEISTY---TKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIE 634
            K+   E++      + +++ +D      +S L++ ++K   LE   K   +K + L   
Sbjct: 703 TKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSC 762

Query: 635 NNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSL 694
                + ++++ +E N        + +    ++ +       ++  KE+++ ++     L
Sbjct: 763 QKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAE---TEKSYKEKVDALEVEASQL 819

Query: 695 EAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEID 754
             ++  ++ +    I+   S+ +WYQ+KID +N T++V  S L S A++   L+++ ++ 
Sbjct: 820 RTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLL 879

Query: 755 ELK-KQIETKSK 765
           E + K++ETK++
Sbjct: 880 EGRLKEVETKAQ 891

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar
           to uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 212/407 (52%), Gaps = 40/407 (9%)

Query: 350 QSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQ 409
           QSLK K++D  S ++ LL+QR+DL HQ+ YLLI  S +N DN+ +L E+E+ FI+NLV+ 
Sbjct: 466 QSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIIN-DNDHLLNEDEIKFIKNLVSN 524

Query: 410 PTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM-ESIEKQNSQKFGDLE 468
                + ++Q +ISE L+KF ++  L  KN++L+  VR L  ++ E+ EK+ S     ++
Sbjct: 525 DNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVD 584

Query: 469 MDFKSIDEAKQRMIVLKE--ENV-KNKDIINQIISEKKLL--EDKIHGLNSTVTELNKSM 523
            D +   EAK+ ++ L++  EN+ KN  I+ +     KLL  ED+     S+ + ++K  
Sbjct: 585 EDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNS-VHKYH 643

Query: 524 EIKR--EPTLKNLE---LQKTNQS------------LLEKN-NQLSIEI-------SNAS 558
           E+K   E  +K+LE    Q TN S            LL K  +QL+++I       S A 
Sbjct: 644 ELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAE 703

Query: 559 NENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLE 618
              KI +   +LL K   +L+   S +    + S++ +D       S  V+  +K  +LE
Sbjct: 704 ERLKITQNSMELLSKENEQLRIRSSRL----EDSLLQQDKETQKTFSSYVEAISKNSSLE 759

Query: 619 KSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQ 678
            S ++ E++   L+    ++K EL     E    +     + S    + ++     ++  
Sbjct: 760 TSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSD-- 817

Query: 679 LLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDE 725
             K+ ++ V  +N+ L+ ++  + ++I  + ++  +Q +WYQ KIDE
Sbjct: 818 -FKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDE 863

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 753  IDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDL 802
            ++E K+ ++ K +E  E  DRF RLKKQA +KLN  K  ++ L+E   +L
Sbjct: 1327 LNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNL 1376

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 16/97 (16%)

Query: 1030 KKEFQDALGTEQTKNKILSKKIEFLETQI--KELKDEQT---KHHSNPMKSDEKIPSTTN 1084
            KK F++       K  +L +KI+ LE+QI  KE   E+T   K   N   S +KIP T N
Sbjct: 1628 KKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVKKIPETLN 1687

Query: 1085 LSTNFAFGQNPFVSNASQNAYMSNVFLSGSPFSRNAP 1121
             S++ +FG          N+    V    SPF   + 
Sbjct: 1688 -SSDTSFG----------NSNNVKVLKPSSPFGATSA 1713

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 90/132 (68%), Gaps = 3/132 (2%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
           K+N++ES V +L+ QRSDL HQ+ YLL+ Q  + +D +  LTE E+ F++ +++      
Sbjct: 470 KINNYESQVCSLIVQRSDLAHQVQYLLM-QLSVRDDAHGPLTEQEVEFVKRIISSEDEAP 528

Query: 415 STETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSI 474
            ++TQ IISERL++F +V +L +KN +L++ +R+L +K+E  EK++  +   +E   +++
Sbjct: 529 KSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVET--QTV 586

Query: 475 DEAKQRMIVLKE 486
            EAK+ ++ L+E
Sbjct: 587 KEAKEAILSLQE 598

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 12/120 (10%)

Query: 680  LKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLAS 739
            L+E+L  ++S  KSL   I  ++  I +L E+     +  QD + +      V+   LA 
Sbjct: 1257 LQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLA- 1315

Query: 740  SAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDY 799
                       +E+ ELK ++E KS E  ES +RF +L+KQA ++L+EFK  + K+  ++
Sbjct: 1316 -----------DEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEF 1364

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
           (REAL)
          Length = 1878

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 104/397 (26%), Positives = 213/397 (53%), Gaps = 36/397 (9%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
           KL   E+ ++TL++QR DL  Q+ YLLIT S +++D+   L + E+ FI+N++   ++T 
Sbjct: 458 KLKQCENDIQTLIKQRLDLCRQVQYLLITNS-VSKDSKGPLRKEEIMFIQNILQNDSDTA 516

Query: 415 S-TETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKS 473
           + T++Q I++ERL++F ++ +L  KN +L+ +VR L +++ES E ++ Q    +E +  +
Sbjct: 517 TETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESE--T 574

Query: 474 IDEAKQRMIVLKEENVKNKDIINQIISE----KKLL--EDKIHGLNSTVTELNKS----- 522
           I+EAK+ ++ LK E  + +  + ++  E    K LL  E+  H LNST+ +LN++     
Sbjct: 575 INEAKEAILTLKAEKEQLESKVEELEKECENSKALLSNEETSH-LNSTIQQLNETKRNLE 633

Query: 523 ----------MEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLI 572
                      +I RE T     L K  Q L +  + +SI++    +   + +E+F LL 
Sbjct: 634 CQIQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLS 693

Query: 573 KSY----TELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKF 628
            +      E  +L+       +S+++ +D      ++E +  K+K    E    + + + 
Sbjct: 694 NTLDLTKAENDQLRKRFDCL-QSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEE- 751

Query: 629 QELEIEN-NNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTV 687
           Q+L+I++  N+K E++K+ SE    +     + +  + + ++    +  ++  + +++ +
Sbjct: 752 QKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKERENLL---DETRKSYQNKIDEL 808

Query: 688 KSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKID 724
           +  +  L+ +   ++  IK L E   S I+WYQ+KI+
Sbjct: 809 EHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 38/56 (67%)

Query: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806
            +EID LK +++ K+++  E+ +RF RL++QA+++L   K + + L E   DL+ +K
Sbjct: 1302 HEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAK 1357

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 91.7 bits (226), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 249/512 (48%), Gaps = 106/512 (20%)

Query: 476 EAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLE 535
           E+  RM  L E+N           S  ++LE KI  LNS VT+LN               
Sbjct: 424 ESSSRMTELNEKN-----------SRIQMLESKIDELNSIVTKLN--------------- 457

Query: 536 LQKTNQSLLEKNNQLSIEIS-NASNENKILKEKFDLLIKSYTEL----KELKSEISTYTK 590
                    EKN++    I+ N S+E+ IL EK++LL +SY  L    K LKS  +T  K
Sbjct: 458 ---------EKNSRFMASINKNNSSESTIL-EKYNLLNQSYKTLLEAYKSLKSN-ATDNK 506

Query: 591 SSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYN 650
            +V++   ++T KI   V+ K+    L  + K   +K   ++  N+ + DE +K+  E +
Sbjct: 507 KAVLTSTLDDTKKI---VEFKSTINYLNSTIKSLSAKLVSIQESNDLLADENQKIKMENS 563

Query: 651 TFKSTRGTIDSFNQNKNSIG--INENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKIL 708
              S    ++  N +KNSI   +++  +K++L+ E    K L +  E + KL+E +    
Sbjct: 564 NLSSL---LNKINTDKNSISNELSDLHSKEILELETEKTKLLEQLEEGERKLKETN---- 616

Query: 709 IEKYKSQIKWYQDKIDEMNT-TMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKEL 767
            EK+  QIKW+Q+KID  N  T + + +N             KN+ + LKK  E KSKE+
Sbjct: 617 -EKHNEQIKWFQNKIDNFNEETTKNQFNNAL-----------KNDYENLKKSFEEKSKEV 664

Query: 768 TESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNXXXXXXXXXXXXXXXXXXXI 827
            E+ D+F+RLK+QA ++LN  K T+ +L ++   LE  +                    I
Sbjct: 665 EEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDER--------------TNFKEHI 710

Query: 828 VKMKDELMTSNNELDNNQR--SQEELRNEYEKQ-NKLYKIKEEELESALNQLM-----LK 879
            K++ ++   NN L   ++  S+E L+ E E+Q     ++K ++L+   + L      L+
Sbjct: 711 SKLEVDINNLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKNLE 770

Query: 880 ENQNSALD----LESLPDDVMLKLKEMVKKDIEIENDXXXXXXXXXXXXNSAKDVNTDSI 935
           EN+++  D    +E   DD+M K+  +   +I +++             N     ++++ 
Sbjct: 771 ENESTLKDKIKMIEGNEDDLMGKISVLQSNEILLKD-----------KLNDLNSKSSNNS 819

Query: 936 ELSDDNISTMKEAWEKEYQHILKIRIEDAENQ 967
           EL D  +  +K+ WEKEY HI++ RIE AE Q
Sbjct: 820 ELVD--VEGLKKDWEKEYSHIIEKRIEYAEMQ 849

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1810

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 125/468 (26%), Positives = 224/468 (47%), Gaps = 77/468 (16%)

Query: 340 HEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENE 399
           HE +    E +S   K+   E    TL++QRSDL  Q+ +LL   +  N D+   LT +E
Sbjct: 451 HEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQN-DSRGPLTADE 509

Query: 400 LNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQ 459
           + FI+ ++     +  +++Q+II+ERL++F +++ L  +N +L+   R L +++E  EK 
Sbjct: 510 VAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKN 569

Query: 460 NSQKFGDLEMDFKSIDEAKQRMIVLKEENV----------KNKDIINQIISEK------- 502
           ++ +   LE   K+IDEAK+ +I L+E N           K +D    I+S+        
Sbjct: 570 SNIRIDSLER--KTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNL 627

Query: 503 ----------------KLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEK 546
                           K LEDK+  L    TE +K+ E+          L +  ++L + 
Sbjct: 628 GDADRMKDSQENQELIKSLEDKLSTL---TTETSKNNEL----------LNQEIRNLYQS 674

Query: 547 NNQLSIEISNASNENKILKEKFDLLIKSYTELKELKSEI--STYTKSSVISK----DGNE 600
             QL+I      +   + +++  LL  +    K   +E+   ++   S++SK    +G  
Sbjct: 675 KTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGET 734

Query: 601 TAKI----SELVDLKAKCKNL--EKSFKDRESKFQELEIENNNV-KDELKKVLSEYNTFK 653
             K     S+L  L+A+  NL  EKS     S     EI+  +V ++ L  ++++  T +
Sbjct: 735 VNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQ 794

Query: 654 STRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYK 713
           S R  +   +Q  +   I      QL   E+ T +     L+ +I  ++N+IK   +  +
Sbjct: 795 SERENLLKESQASHKAAI-----AQL---EVQTSE-----LKTEISSKDNEIKASEDAKR 841

Query: 714 SQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIE 761
           +Q KW+Q+KIDEM++        LA+   + A L  + E+++LKK+IE
Sbjct: 842 AQTKWFQEKIDEMSSDAGKIRDELATKTATVAQL--ELEVNDLKKKIE 887

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1788

 Score = 88.6 bits (218), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 92/151 (60%), Gaps = 17/151 (11%)

Query: 363 VKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNII 422
            K+L +QR+DL HQ+ Y+LI  S  N D+N  L+  E+ FI++++   +N  S+++Q +I
Sbjct: 455 TKSLTKQRNDLAHQLQYILIHTSVQN-DSNGPLSAEEVRFIQDILDNESNEESSDSQQVI 513

Query: 423 SERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMI 482
           SERL+ F N+ +L  KNI L+  VREL  K+E +++++ Q    + ++ ++IDEAK+ +I
Sbjct: 514 SERLVTFQNIVELQQKNIDLLKSVRELARKLE-LQEEHQQSTSQV-VEQQAIDEAKEAII 571

Query: 483 VLKEENVKNKDIINQIISEKKLLEDKIHGLN 513
            L+  N K              LEDKI  LN
Sbjct: 572 SLQSYNTK--------------LEDKIKTLN 588

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKL 795
            EI  LK+ +  K KE  E  DRF R+KKQA ++LN  K T+  L
Sbjct: 1290 EIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTL 1333

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score = 88.2 bits (217), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 128/453 (28%), Positives = 207/453 (45%), Gaps = 62/453 (13%)

Query: 307 FLFDIESKLPYLQXXXXXXXXXXXXKIEEQKIIHEHDSLKLENQSLKI-----------K 355
           F+ ++E +LP LQ              E Q+ +H   +  +E    KI           K
Sbjct: 308 FVIELEHRLPGLQILEKQNK-------EVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360

Query: 356 LNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWS 415
           ++        L  QRSDL HQI +LL   S     ++ +L  +EL+FI+ ++        
Sbjct: 361 VDHLNQIFHKLRVQRSDLAHQIQFLLTVNS-----SDTVLPPSELSFIKTIIENENWDAY 415

Query: 416 TETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSID 475
            ++Q I+S+RLL+F N+ +L  +N+KL+S VR L +K+ES E  N      LE     I 
Sbjct: 416 KDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLT-LEAAKLQIS 474

Query: 476 EAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNL- 534
           + +Q    L+ E VKN + + + + +   L+ KI   N T+ E  K +E + E  L ++ 
Sbjct: 475 KLEQSNAQLESE-VKNWEALMETLKDGDSLDSKI---NVTMVEQQKKIE-ELESKLTDVG 529

Query: 535 --ELQKTNQSLLEKN---NQLSIEISNASNENKILKEKFDL-----LIKSYTELKELKSE 584
              +QK N  +L K    NQ +I + N   +N +   K D+     LI    E   L  +
Sbjct: 530 ESHVQKIN--VLNKTIDRNQSTINMLNEQIKNTV---KSDMNAKSELIACKRENLSLTQQ 584

Query: 585 ISTYT------KSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNV 638
           IST         S    K+ +   KI+EL     KCK+ E SF     +  ++E +  ++
Sbjct: 585 ISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSL 644

Query: 639 KD----ELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSL 694
            D    E KK+L      K     I           ++   +++ L  ++  +   NKSL
Sbjct: 645 FDKIQQESKKLLQLETRNKELEVKISGKE-------LHRKRSEETLSSKITFLSEENKSL 697

Query: 695 EAKIKLQENDIKILIEKYKSQIKWYQDKIDEMN 727
              +  +E ++K  IEK + QIKWYQ  IDE++
Sbjct: 698 HNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELS 730

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 17/132 (12%)

Query: 674  NTNKQLLKEELNTVKS---LNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTM 730
            N +K+ L+EE++ ++    L K   + I  QE   KI  E Y+ + + ++    +M+   
Sbjct: 1087 NEDKRTLQEEVSRLRESEELAKKNSSAISEQEWQQKI--ETYQQESEKWKLMCQQMSENT 1144

Query: 731  EVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKG 790
              +I NL            + +++  K  I+ K++E  +  DRF RLKKQA +KLN  K 
Sbjct: 1145 ATEIQNL------------QQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKA 1192

Query: 791  TENKLREDYCDL 802
            T + L  +  +L
Sbjct: 1193 TSDSLAIELSEL 1204

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 129/430 (30%), Positives = 213/430 (49%), Gaps = 50/430 (11%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           S+K  +N+  S+++ L  QR+DL HQ+ YLLI  S  N DNN  L+++E+ F++NL+ + 
Sbjct: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQN-DNNGPLSKSEILFMQNLINKD 327

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
               S++ Q++IS+RL+KF ++  L  KN++L   +R L   +ES  K++  K      D
Sbjct: 328 KQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLES--KESEIKNSRENYD 385

Query: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTV-------------- 516
             +I+EAK+ ++ L+E N       N +  E   L+ KI  L S++              
Sbjct: 386 NDTINEAKETILSLQEYN-------NVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYH 438

Query: 517 TELNKSMEIK-------REPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKEKFD 569
           + L K +E K        + T++N  L K  Q+L  +   + I +    +   +  EK  
Sbjct: 439 SNLVKDLESKLSKLSAYSQSTIEN--LNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496

Query: 570 LLIKSYTELKELKSEISTYTKSSVISKDGNETAK-ISELVDLKAKCKNLEKSFKDRESKF 628
           LL  SY  L     E+S  +K+S++ +  NE  K ++ +++   KCK     F +R +  
Sbjct: 497 LLQNSYDLLTLENEELS--SKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLL 554

Query: 629 Q----ELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQN-KNSIGINENTNKQLLKEE 683
                 LE ENN++K E+K   S Y   K          Q+ +N I    +  K+L   E
Sbjct: 555 NNNKLGLEEENNSLKQEIK---SNYEQIKDLDSKSKHLEQSLENEISKYTDKVKEL---E 608

Query: 684 LNTVKSLNKSLEAKIKLQENDIKI--LIEKYKSQIKWYQDKIDEMNTTMEVKISNL-ASS 740
           LN  K   + L  + KLQ  +I+I  L      QI WYQ K+D+   T++   S L A +
Sbjct: 609 LNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPADT 668

Query: 741 AESAAMLKNK 750
             S A++++K
Sbjct: 669 QNSKALVEDK 678

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 94/186 (50%), Gaps = 22/186 (11%)

Query: 638 VKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAK 697
           V+ EL    S+   F++ R  +    Q+     +NE T  + L E L+ +K  N  L  +
Sbjct: 792 VQSELNAANSQILNFENQRAMV----QDHKKGNVNEETLIEKLTE-LDELKERNMELTQE 846

Query: 698 I-KLQENDI--KILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESA---------A 745
           I  L EN+I  K  +E+   ++K  + KI E+N  +E K + +  S E A          
Sbjct: 847 IHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNEL 906

Query: 746 MLKNKNEIDE----LKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCD 801
            L  KN  +E    L+KQ+E KSKE  E  DRF RLKKQA ++L+  K  +N L E   +
Sbjct: 907 TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNE 966

Query: 802 LEKSKN 807
           L K++N
Sbjct: 967 L-KARN 971

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 104/423 (24%), Positives = 197/423 (46%), Gaps = 54/423 (12%)

Query: 353 KIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTN 412
           K ++ D ES +  L QQRSDL  Q+ YLLI Q  +  D++  L+  E  F++ +V     
Sbjct: 458 KSQIRDLESQISALTQQRSDLARQVQYLLI-QVTVRGDSHGPLSAEETAFVKKVVNMENT 516

Query: 413 TWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFK 472
               + Q IISERL++F N+ +L AKN  L+  VR L N++E+ E++   K   +E D  
Sbjct: 517 QPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIEND-- 574

Query: 473 SIDEAKQRMIVLKEENVKNKDIINQIISEK---KLLEDKI--HGLNSTVTELNKSMEIKR 527
           +I EAK+ ++ L++   + +  I+ I  E+   K ++ +    G N  + ++N       
Sbjct: 575 TITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENS 634

Query: 528 EPTLKNLE----------------LQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLL 571
           +  ++ LE                L   NQ L    ++L + +    +   + +E+  + 
Sbjct: 635 DLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKIS 694

Query: 572 IKSYTELKELKSEI---STYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESK- 627
             S    K+   E+       ++++  +D      ISEL+D K++   L    K+  +K 
Sbjct: 695 KSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKE 754

Query: 628 ------FQELEIENNNV---KDELKKVLSEYNTFKSTRGTI--DSFNQNKNSIGINENTN 676
                  Q+L+  N  +   ++EL  ++++  T +  R T+  DS +  K  I       
Sbjct: 755 NLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDS----- 809

Query: 677 KQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISN 736
              L+ E++ +++L       +  +  ++   +    S+ +WYQ+KID +N  ++   S+
Sbjct: 810 ---LEAEISQLRTL-------LSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSD 859

Query: 737 LAS 739
           L S
Sbjct: 860 LNS 862

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 110/412 (26%), Positives = 198/412 (48%), Gaps = 44/412 (10%)

Query: 337 KIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNED--NNKI 394
           +I  E +SL+ E QS K K    +  ++TL  QRSDL HQI +LL+    L E    N +
Sbjct: 357 RISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLL---ILGEQATTNAL 413

Query: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454
           L+++E +FIR L    T   + ++Q+IISERLLKF+++++L  +N+ +++ VR L  ++E
Sbjct: 414 LSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLE 473

Query: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEEN----------VKNKDIINQIISEKKL 504
             EK        +E   K+++EAK+ ++ L+E             K +D+   +   K  
Sbjct: 474 EQEKLRQADHHTIER--KTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSP 531

Query: 505 LEDKIHGLN----STVTELNKSMEIKREPTLKNLE-LQKTNQSLLEKNNQLSIEISNASN 559
             +K    N     T  +L   ++  RE   K +E L +TN+ +L K  +L   +    +
Sbjct: 532 SSNKPSECNDIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMES 591

Query: 560 ENKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKDGN-------ETAKISELV---- 608
             +  + K +L+  +   L+E         + SV+ ++ +       + AK++EL     
Sbjct: 592 AKEYAEGKAELIENNLLMLQE--------NRKSVLEQNDHLQQLLSQKEAKLAELTQDLH 643

Query: 609 DLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNS 668
           +L ++   L+  F D +S+   L  ++   + EL +V+ E N  K     I     ++N 
Sbjct: 644 ELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKV---KIHELEISRNE 700

Query: 669 IGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ 720
               + T +  L E L   +   + L   I+ QE+ I+ +  K   ++ WYQ
Sbjct: 701 CKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQ 752

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 679  LLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLA 738
            +L +EL+ V+ L+  L+     Q+N+ +   ++   +I  Y+D+I+      +  +    
Sbjct: 1112 ILNDELSQVRKLSGPLQD----QKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQD 1167

Query: 739  SSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLN 786
             +    A  KN  EID LK  IE ++KE  +  ++F  LKKQA +KL+
Sbjct: 1168 DTLGLEANFKN--EIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLD 1213

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 90/139 (64%), Gaps = 3/139 (2%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           +L  K+ D ES++ TL +QR+DL HQ+ +LL+  S +  D+  +L+  E++FI+ +V   
Sbjct: 472 ALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNIS-VQVDSGGLLSAEEVSFIKRIVNND 530

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
                +++Q +ISERL++F+N++ L  KN++L+  VR+L  K+ES EK  ++K    E D
Sbjct: 531 DPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFEND 590

Query: 471 FKSIDEAKQRMIVLKEENV 489
             +I EAK+ ++ L++ N 
Sbjct: 591 --TIKEAKEAIVSLQDYNA 607

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 62/148 (41%), Gaps = 37/148 (25%)

Query: 1030 KKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSN---------PMKSDEKIP 1080
            KK F++       K+ +L +KI  LE+Q+    D   K  S          P K DEK  
Sbjct: 1621 KKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEK-S 1679

Query: 1081 STTNLSTNFAFGQNPFVS-------NASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNT 1133
             TTN S       NP VS       + S+  +  + F  G+PF+          S+P N 
Sbjct: 1680 VTTNQSV-----PNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFT----------SSPQNN 1724

Query: 1134 N----SSITVQPTLTFNTDFSNESKDLK 1157
            +    S+   +PT T + + SN+S   K
Sbjct: 1725 DTMGTSAFGFKPTFTLSNN-SNKSSGTK 1751

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
           MLP1Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved with Tel1p in telomere length
           control; involved with Pml1p and Pml39p in nuclear
           retention of unspliced mRNAs
          Length = 1875

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 117/439 (26%), Positives = 222/439 (50%), Gaps = 48/439 (10%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
           KL + E+ ++TL +QR DL  QI YLLIT S  N D+   L + E+ FI+N++ +  +T 
Sbjct: 462 KLVECENDLQTLTKQRLDLCRQIQYLLITNSVSN-DSKGPLRKEEIQFIQNIMQEDDSTI 520

Query: 415 S-TETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKS 473
           + +++Q +++ERL++F N+  L  KN +L+ +VR L +K+ES EK++ Q    +E +  +
Sbjct: 521 TESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESE--T 578

Query: 474 IDEAKQRMIVLKEE--------------------NVKNKD------IINQIISEKKLLED 507
           ++EAK+ +I LK E                    +V N+D       I Q+   K+ LE 
Sbjct: 579 VNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLES 638

Query: 508 KIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKEK 567
           ++  L + ++      +I RE T     L K  Q L +  + +SI++    +   + +E+
Sbjct: 639 QVQDLQTRIS------QITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEER 692

Query: 568 FDLLIKSY----TELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKD 623
           F LL  +      E  +L+     Y +++++ +D      ++E V  K+K   +E    +
Sbjct: 693 FKLLSNTLDLTKAENDQLRKRFD-YLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLN 751

Query: 624 -RESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKE 682
            +E +   + +E  N+K EL K+  E ++ +     + +  + +  +   E T K   K 
Sbjct: 752 LKEEQKLRVHLE-KNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLL--EETRKSCQK- 807

Query: 683 ELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAE 742
           +++ ++     L+ +   +++ IK L E   S I+WYQ+KI+ +    E  I+++ S   
Sbjct: 808 KIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQT 867

Query: 743 SAAMLKNKNEIDELKKQIE 761
               L+ K  +  L+K+IE
Sbjct: 868 DIEKLQYK--VKSLEKEIE 884

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 37/56 (66%)

Query: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKN 807
            EI+ LK+++E K ++  E+ ++F RL++QA+++L   K +++ L E    L  +KN
Sbjct: 1307 EIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKN 1362

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 92/146 (63%), Gaps = 5/146 (3%)

Query: 352 LKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPT 411
           LK  +  +E+ + +L +QR DL HQI YLL+ +S  +ED   +  E EL F++NL     
Sbjct: 456 LKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAE-ELQFVKNLTNSQE 514

Query: 412 NTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDF 471
            T +++TQ II++RL++F +V +L  KN +L+S +R L +++E  E +N  +   LE + 
Sbjct: 515 ITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDE- 573

Query: 472 KSIDEAKQRMIVLKE--ENVKNKDII 495
            ++ EAK+ ++ L +  +N++N+ +I
Sbjct: 574 -TVREAKETILTLHDHAQNLENQLVI 598

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
           (REAL)
          Length = 1885

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 201/404 (49%), Gaps = 46/404 (11%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
           K+   E+ +  L +QR DL  Q+ YLLIT S  N D+   L + E+ FI+N++ Q  N+ 
Sbjct: 462 KIAKCENDIHILTRQRLDLCRQVQYLLITNSVSN-DSKGPLRKEEIKFIQNIL-QNDNSG 519

Query: 415 STET--QNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFK 472
           +TE+  Q I++ RL++F NV +L  KN +L+ + R L +K+ES E ++ Q    L+++ K
Sbjct: 520 TTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNL--LKIENK 577

Query: 473 SIDEAKQRMIVLKEENVK--------------------------NKDIINQIISEKKLLE 506
           +I+EAK+ ++ L+ E +                           N  +I Q+   K+ LE
Sbjct: 578 TINEAKEAILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLTKTKRELE 637

Query: 507 DKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKE 566
            ++  L + ++      +I RE T     L K  Q + +  + +SIE+    +   + +E
Sbjct: 638 SQVQDLQARIS------QITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEE 691

Query: 567 KFDLLIKSYTELKELKSEI---STYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKD 623
           +F LL  +    K    ++   S   +SS+  +D      ++E +  K+K    E +  +
Sbjct: 692 RFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSN 751

Query: 624 RESKFQELEIEN-NNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKE 682
            + + Q+L+I++  ++K EL K+ SE  + +     + +  + +  +    +  ++  + 
Sbjct: 752 LKLE-QKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLL---DEARKSCQN 807

Query: 683 ELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEM 726
           ++N V+     L+ +   ++  I  L E   S+I+WYQ+KI+ +
Sbjct: 808 KINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETL 851

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 38/56 (67%)

Query: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806
            +E++ LK Q+E K ++ TE+ +RF RL++QA++KL   K T+  L E   +L+ +K
Sbjct: 1307 SEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAK 1362

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1779

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 114/419 (27%), Positives = 208/419 (49%), Gaps = 66/419 (15%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           S+K K+ D+E+ + +L++QRSDL HQ+ +LLI  S  N D+N  LT  E NFI+ ++   
Sbjct: 466 SVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRN-DSNGPLTPEETNFIKKIINSS 524

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
            +    + Q IISERL++F ++ +L  KN++L++ +R L +K+E+ EK++  K  +  ++
Sbjct: 525 ESPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKE--VE 582

Query: 471 FKSIDEAKQRMIVLKEEN----------VKNKDIINQIISEKKLLEDKIHGLNSTVTELN 520
            +++ EAK+ ++ L+E N           K +D    + S+K        G ++  + +N
Sbjct: 583 SETVKEAKEAILTLQEYNKSLESQLEIIAKERDAFKILASDK--------GTSNGPSNVN 634

Query: 521 KSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTEL-- 578
            S         +N  L    + + E  N LS     ++   K+L E+   L ++  +   
Sbjct: 635 SS---------ENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSV 685

Query: 579 ---KELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIEN 635
              KE  S I    +S +IS +  E  K+ E  +L+ +  +L+++   ++SK Q+  IE+
Sbjct: 686 NLEKERSSRILAEDRSKLIS-NTLEMTKM-ENDELRKRFHSLQENILKQDSKTQQT-IES 742

Query: 636 -NNVKDELKKVLSEYNTFKSTRGTIDSFNQN---KNSIGINENTNKQLLKEELNTVKS-- 689
             + K +L  + S+ N  +S R  + S  +N   +N     E  N ++L  +L T+++  
Sbjct: 743 LISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILITQLQTLQTER 802

Query: 690 ---------------------LNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMN 727
                                L+ +LE K+  +  +I   I    SQ KWYQ+K D +N
Sbjct: 803 ESLLEETQKNFQGKTNKLETELSDTLE-KLDAKSKEISDYISTKDSQEKWYQEKFDRLN 860

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 71/133 (53%), Gaps = 17/133 (12%)

Query: 680  LKEELNTVKSLNKSLEAKIKL-----QENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKI 734
            LK EL+ +    + LE+K+ L     +E D++I ++  +++ +W Q   D ++    +  
Sbjct: 1254 LKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAE-RWKQRSQDILHKYERI-- 1310

Query: 735  SNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLD-RFARLKKQAKDKLNEFKGTEN 793
                   E    L +K  + EL+++I++KS E  E LD RF RLK+QA +KLN  K  ++
Sbjct: 1311 -----DPEEHQKLADK--VSELQQEIKSKSDE-NEELDTRFKRLKQQAHEKLNAAKTAQS 1362

Query: 794  KLREDYCDLEKSK 806
             L     DL+ +K
Sbjct: 1363 TLTSQLNDLKATK 1375

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
           YIL149C (MLP2)
          Length = 1758

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (62%), Gaps = 3/132 (2%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
           K+ D+E+ V  L+QQRSDL  Q+  LLI  S + +D++  LT  E+ F++ L +   +  
Sbjct: 467 KVGDYETQVGHLVQQRSDLARQVQCLLIHIS-VRDDSSGPLTAEEVEFVKKLQSCRDSAT 525

Query: 415 STETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSI 474
            ++TQ IIS RL++F +V +L  KN +L++ +R+L  K+E  E +   K   LE +  ++
Sbjct: 526 GSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQN--TV 583

Query: 475 DEAKQRMIVLKE 486
           +EAK+ ++ L+E
Sbjct: 584 NEAKEAILSLQE 595

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%)

Query: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKL 795
            +EI+ LK ++E KS E  +S +RF +L+KQA ++L+EFK  + K+
Sbjct: 1314 SEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKV 1358

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
           (REAL)
          Length = 1898

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 114/429 (26%), Positives = 199/429 (46%), Gaps = 74/429 (17%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVA-QPTNT 413
           KL +++  +  L +QR DL  QI YLL+T S  N D+   L + E+ FI+N++    + T
Sbjct: 462 KLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSN-DSKGPLRKEEIKFIQNILQNDDSAT 520

Query: 414 WSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKS 473
             +++Q I++ERL++F ++  L  KN +L+ + R L +K+ES E ++     ++E +  +
Sbjct: 521 TESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENE--T 578

Query: 474 IDEAKQRMIVLKEENVK--------------------------NKDIINQIISEKKLLED 507
           I+EAK+ ++ L+ + V+                          N  +I Q+   K+ LE 
Sbjct: 579 INEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELES 638

Query: 508 KIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKEK 567
           +   L + ++      ++ RE T     L K  Q L +  + LSIE+    +   + +E+
Sbjct: 639 QTQDLQARIS------QVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEER 692

Query: 568 FDLLIKSYTELKELKSEISTYTKSSV-----ISKDGNETAKISELVDLKAKCKNLEKSFK 622
           F LL  +   L   K+E     K S+     ISK   + +K  E ++    CK       
Sbjct: 693 FKLLSNT---LDLAKAENDQLRKRSINLQNAISK---QDSKTQETLNDYVSCK------- 739

Query: 623 DRESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKE 682
              SK   +E E +N+K  L++ L +    K+ +  +   +  K S+ I     + L KE
Sbjct: 740 ---SKLSAIETELSNLK--LERTL-KIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKE 793

Query: 683 ELNTVKSLNKSLEAKIKLQEND--------------IKILIEKYKSQIKWYQDKIDEMNT 728
             N +    KS + KI   +N               IK L E   S+I+WYQ+KI+ +  
Sbjct: 794 RENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRK 853

Query: 729 TMEVKISNL 737
             E  +S+L
Sbjct: 854 DHESVMSSL 862

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 13/128 (10%)

Query: 1030 KKEFQDALGTEQTKNKILSKKIEFLETQIKELK---DEQTKHHS---NPMKSDEKIPSTT 1083
            KK F++       K  +L +K+  +E+Q+ E K   D   KH S   NP+     +P   
Sbjct: 1648 KKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSPPKHLSKMPNPLLG---LPRKI 1704

Query: 1084 NLSTNFAFGQNPFVSNASQNAYMSNVFLSGS--PFSRNAPEKAFKHSTPDNTNSSITVQP 1141
              ++N  +  NP +S        S    SG   PF+  +P K  +    +   SS   +P
Sbjct: 1705 EENSNPPY--NPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKPLQGDEAEREPSSNETEP 1762

Query: 1142 TLTFNTDF 1149
                   F
Sbjct: 1763 PTHLAPSF 1770

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 7/63 (11%)

Query: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE-------NKLREDYCDLEK 804
            EI+ LK Q+E K+++  +S ++F RL++QA++KL   K ++       N+L++    LEK
Sbjct: 1308 EIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEK 1367

Query: 805  SKN 807
            S N
Sbjct: 1368 SLN 1370

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 109/191 (57%), Gaps = 14/191 (7%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           SL+ K+N  E+ + +L++QR DL  Q+  LL+  S + E  +  L+++EL  +R ++   
Sbjct: 439 SLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASP-LSQDELISLRKILESS 497

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
                 ++Q II+ERL++FSNV++L  KN++L++ +R L +K+E+ E +  +    +E  
Sbjct: 498 NIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVEN- 556

Query: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLL---EDKIHGLNSTVTELNKSME 524
            ++I EAK  +I L+  N K +  IN ++ E+   KLL   E+     NS       SME
Sbjct: 557 -QTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVT-----SME 610

Query: 525 IKREPTLKNLE 535
             RE  ++ LE
Sbjct: 611 AAREKKIRELE 621

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1820

 Score = 75.1 bits (183), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 84/136 (61%), Gaps = 7/136 (5%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLV--AQPTN 412
           KL  ++S +K L++QR DL +Q+ +LL+  +  N D+   LT  E+ FI  +   ++  N
Sbjct: 441 KLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKN-DSGGPLTREEIEFINKISNNSEDLN 499

Query: 413 TWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFK 472
                +Q++ISERL+ FSN+ +L AKN++L++ +R L+  +E+IE  NS K    E   K
Sbjct: 500 GSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK----EFQNK 555

Query: 473 SIDEAKQRMIVLKEEN 488
           +I +AK+ ++ L+  N
Sbjct: 556 TIADAKEAILTLQYHN 571

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKS 805
            E+D LK   ETK K+  E  +RF  LKKQA ++LN  K  ++ L +   +L+ S
Sbjct: 1284 ELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKAS 1337

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1973

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 168/328 (51%), Gaps = 36/328 (10%)

Query: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQ--PTN 412
           ++   E  +K + +QRSDL +Q+ + L+  S  N D+   LT+ E+ FIRN++ +    +
Sbjct: 468 RIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAN-DSAGPLTDEEVKFIRNIIQEDDEMH 526

Query: 413 TWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFK 472
              T+TQ +ISERL KF ++ +L  KN++L+   REL  K+E  +K    +   +E +  
Sbjct: 527 DKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEE-- 584

Query: 473 SIDEAKQRMIVLKEENVKNKDIINQIISEKKLLED-KIHG---LNSTVTELNK---SMEI 525
           +I EAK+ ++ L+     N  +  +I +  K LE  K+      +ST  + +K     EI
Sbjct: 585 TIAEAKEAILTLQN---YNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREI 641

Query: 526 KREPTLKNLELQ--------KTNQSLL--------EKNNQLSIEISNASNENKILKEKFD 569
           +    +K LE +        K N ++L        EKNN +SIE++   +  ++ +E+  
Sbjct: 642 EHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLK 701

Query: 570 LLIKSY----TELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRE 625
           LL KS     TE + L+  +++  ++ V+ +D      I+ L+  +++   +E  +   +
Sbjct: 702 LLQKSMDMTITENERLQKRLNSL-RNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQ 760

Query: 626 SKFQELEIENNNVKDELKKVLSEYNTFK 653
           ++ + L      +K+EL ++  E N+ K
Sbjct: 761 NEIKLLHSSEEMLKNELTRLNEEKNSMK 788

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%)

Query: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806
            E + L+ Q+E KSKE  E  +RF +LKKQA +KLN  K ++N L     DLE  K
Sbjct: 1322 ERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKK 1376

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 91/152 (59%), Gaps = 3/152 (1%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           SL+ K+N  E+ +  L++QR DL  Q+  LL+  S + +     L++++L  +R ++   
Sbjct: 439 SLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAI-QKTTLPLSKDDLISLRKILESG 497

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
           ++    + Q IISERL++F+N+++L  KN++L+  +R L +K+E  E +      ++E  
Sbjct: 498 SDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEK- 556

Query: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEK 502
            ++I EAK  +I L+  N+K +  IN ++ E+
Sbjct: 557 -QTIKEAKDAIIELENTNMKMESRINILLRER 587

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 84/128 (65%), Gaps = 10/128 (7%)

Query: 364 KTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLV---AQPTNTWSTETQN 420
           K L ++R DL  Q+ YLL+  +   +D++  LT +E ++I+ ++    +  NT ST++Q 
Sbjct: 377 KILRRERFDLARQLQYLLL--NGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQL 434

Query: 421 IISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQR 480
           IIS+R+LKF ++ +L  +NI L+S VR L+++ E++E++   + GD     ++I+EAKQ 
Sbjct: 435 IISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK--LESGD---SIEAINEAKQT 489

Query: 481 MIVLKEEN 488
           ++ L++ N
Sbjct: 490 LLDLQQYN 497

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 103/237 (43%), Gaps = 39/237 (16%)

Query: 603  KISELVDLKAK------CKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTR 656
            K S+LVD           + L    K+ ESK    + E N ++++L K  SE        
Sbjct: 1001 KASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNM-- 1058

Query: 657  GTIDSFNQNKNSIGINENTNKQLLKEELNTVKSL---NKSLEAKIKL-QENDIKILIE-- 710
                ++ Q K  +    N      +E +  ++SL   N SL  ++KL Q  + +I+ E  
Sbjct: 1059 ----NYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELN 1114

Query: 711  KYKSQIKWYQDKIDEMNTTMEVK----------ISNLASSAESAAMLKNKNEIDELKKQI 760
            + K++ K  + ++DE    +  K           S L +++       NK+   EL   +
Sbjct: 1115 ELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGAL 1174

Query: 761  ETKSKELTESLD-----------RFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806
            ++    LTE +D           RF RLK+QA+++L+  K T N LR++   L K K
Sbjct: 1175 QSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDK 1231

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/405 (25%), Positives = 186/405 (45%), Gaps = 67/405 (16%)

Query: 363 VKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNII 422
           +  L+ QR DL HQ+ +LL+    L +    +LT +E+ F+R ++    +   +++Q II
Sbjct: 443 INVLMSQRVDLAHQVQFLLLNLD-LKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKII 501

Query: 423 SERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMI 482
           SERL+KF ++S L  +N++L++  R L  ++ES + ++ QK         + +E+K+++ 
Sbjct: 502 SERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI--------TRNESKEKIA 553

Query: 483 VLKEENVKNKDIINQIISEK---KLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKT 539
            L+E        + ++  EK   KLL  +  G  +   EL   ++ K+E  L  LE   +
Sbjct: 554 KLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQ-KKEEQLTKLERMSS 612

Query: 540 -------------NQSLL----EK---NNQLSIEISNASNENK----------ILKEKFD 569
                        NQS++    EK   NN +  E S  +   K          +L +K+D
Sbjct: 613 LDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYD 672

Query: 570 LLIKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQ 629
           L +K Y   + L   ++ +   ++     NET         +AK   L+K  +  +    
Sbjct: 673 LAVKKYEHYETL---LNDHNAENIKHSRENETT--------QAKISILQKEIESYKQNLL 721

Query: 630 ELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTV-- 687
           +   +N N   +L     E  T  S   T+    +N+    IN    ++   +E +++  
Sbjct: 722 QYSKDNENTLSKLAAATQEKETLGSRLSTV----KNELEQKINLMQERETYYKEHDSISE 777

Query: 688 KSLNKS---LEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTT 729
           + L KS   LE KIK    ++K    K  SQI WYQ ++D + TT
Sbjct: 778 RLLKKSKIQLEDKIK----EVKDFEAKKNSQINWYQKRLDSLTTT 818

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 91/192 (47%), Gaps = 37/192 (19%)

Query: 637  NVKDELKKVLSEYNTFKS-TRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLE 695
            N+K+ L +    +   +S   G + +  Q+K ++       KQL   ELNT+K  N+ L+
Sbjct: 1130 NLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAV-------KQL--NELNTLKETNEQLQ 1180

Query: 696  AKIKLQEND-----IKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAE-------- 742
             K  L+END     I   +E  K+++   +DK++ +  ++  K   L   +E        
Sbjct: 1181 QK--LRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLR 1238

Query: 743  SAAMLKNKNEID------------ELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKG 790
            S  +L  + ++D             LK Q++TK+K+  +  DRF RLKKQA +KL+  K 
Sbjct: 1239 SREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKA 1298

Query: 791  TENKLREDYCDL 802
                L  +  DL
Sbjct: 1299 QNASLTAEITDL 1310

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 114/406 (28%), Positives = 206/406 (50%), Gaps = 44/406 (10%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           SL+ K+N+ E+ + +L++QR DL  Q+  LL+  S + +  +  L+ +EL  ++ L+   
Sbjct: 440 SLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASP-LSNDELISLKKLLESG 498

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
                 ++Q II+ERL++F+N ++L  KN++L++ VR L +K+E+ E +  +    LE  
Sbjct: 499 DVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLEN- 557

Query: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLLE----DKIHGLNSTVTE---LN 520
            ++I EAK  +I L+  N   +  I+ +  E+   KLL     +KI+   +  TE   L 
Sbjct: 558 -QTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLK 616

Query: 521 KSMEIKREPTLKNLE----LQKTNQSLL-----EKNNQLSI-EISNASNENKILK-EKFD 569
           K  E++ E +L  +E    +Q+ N+ LL     + N Q+++ E SN     K+L  EK +
Sbjct: 617 KIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNF----KVLAIEKEN 672

Query: 570 LLIKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQ 629
           LL    T + +LK+++     S+  S  G+  ++ +EL   K K K+L     +   K  
Sbjct: 673 LL---QTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNT 729

Query: 630 ELEIENNNVKDELKKVLSEYNTF--KSTRGTIDSFNQNK---NSIGINENTNKQLLKEEL 684
           +L     ++  +L++   E      K T     S N+ K   +S  +  NT  + L++  
Sbjct: 730 DLRCMKESLTRDLERCCKEKMQLQMKLTESET-SHNEQKLKSDSKQVQYNTKIKNLEK-- 786

Query: 685 NTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTM 730
              + LN  L +K++    +I+ L     SQ+KW Q+ ID+    M
Sbjct: 787 -NCEELNNRLHSKVQ----EIETLQTSKNSQLKWAQNTIDDTEKNM 827

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 140/565 (24%), Positives = 253/565 (44%), Gaps = 100/565 (17%)

Query: 353 KIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTN 412
           ++KL+D    ++TL ++ +DL +QI ++LI+ S  N D    LTENE+ FI+ L  + T 
Sbjct: 374 RLKLSD--DKIETLREENNDLTNQIQFMLISNSIQN-DKYGELTENEIKFIKALREKGTE 430

Query: 413 TWSTE---TQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEM 469
           T   E   +Q+IIS+RL++F +V  L  KN++LI  +R +T K+++ E +   K+     
Sbjct: 431 TSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAEND 490

Query: 470 DFKSIDEAKQRMIVLKEENVKNKDII---------NQIISEKKLLEDKIHGLNSTVTELN 520
           D   ++EAK+ ++ +  E+ K K+ I         N+ +S +K   + +   N   TE +
Sbjct: 491 DV--LNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYTEGD 548

Query: 521 KSMEIKREPTLKNLELQKTN---------QSLLEKNNQLSIEISNASNENKILKEKFDLL 571
           + +  + +  +     Q +N          SL  KN +L+ +   A     I ++K DLL
Sbjct: 549 RLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLL 608

Query: 572 IKSYTEL----KELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESK 627
              Y  L    ++LK  +    K ++  KD    + I+  VD KA   ++        +K
Sbjct: 609 QDKYDYLSISNEKLKEHMEVI-KDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTK 667

Query: 628 FQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTN----KQLLKEE 683
           + EL+     +KD+  ++ +E    K  R  +     N  ++ I  +      K  +  +
Sbjct: 668 YDELKY----LKDQQSRITNE---LKMEREQLKMELLNIKTVQIQSDLESAEYKASVASK 720

Query: 684 LNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAES 743
           +N ++  N +L   ++ +E +++  I     ++ WYQ K D  +T               
Sbjct: 721 INDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFST--------------- 765

Query: 744 AAMLKNKNEIDELKKQIETKSKELTES----LDRFARLKKQAKDKLNEFKGTENKLREDY 799
             MLK   E ++    I  K++ +  S    LD F+   +Q      E   T +K R   
Sbjct: 766 --MLKRVAEGNDNNDDIPVKTENINSSDSFVLDNFS---EQV-----EGDDTSSKERSPS 815

Query: 800 CDLEKSKNXXXXXXXXXXXXXXXXXXXIVKMKDELMT-SNNELDN------NQRSQEELR 852
           C+                         + ++KD +   SNN  DN      N ++  +L 
Sbjct: 816 CN----------------------NISVFRVKDPMKPLSNNNTDNVTSSNINFKTSSDLN 853

Query: 853 NEYEKQNKLYKIKEEELESALNQLM 877
           N++E     YK+ E+ELE A N++M
Sbjct: 854 NDFELLFNEYKVIEKELEKAKNEIM 878

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%)

Query: 755  ELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEK 804
            + K++ E KSKE  E++DRF RLKKQA  +L+  K  +N L E    L+K
Sbjct: 972  DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKK 1021

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 5/94 (5%)

Query: 366 LLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNIISER 425
           LL+QRSDL HQ+ YLL+       DN    TE E   ++ +V+       T++  IIS+R
Sbjct: 454 LLRQRSDLAHQVQYLLLCI-----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKR 508

Query: 426 LLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQ 459
           LL F NV +L  KN++L+   R+L   +E  E++
Sbjct: 509 LLHFQNVKELQQKNMELLRTTRQLVQTLERQEQE 542

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 741  AESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE-------N 793
             E  A +K+  +I  L++Q+ET   E  +  DRF RLKKQA +KL+  K  +       N
Sbjct: 1149 VEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 1208

Query: 794  KLREDYCDLEKSKNXXXXXXXXXXXXXXXXXXXIVKMKDELMTSNN 839
            +L E   +LEKS                     I++++ EL  SNN
Sbjct: 1209 ELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNN 1254

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 97/175 (55%), Gaps = 10/175 (5%)

Query: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410
           SL+ K+N +E+ + +L++QR DL  Q+  LL   S + +     L+ +EL  +R L+   
Sbjct: 439 SLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAI-QTTTSPLSNDELMSLRKLLESE 497

Query: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470
                 ++Q II+E+L++F N+ +L  KN++L+  +R L +K+E+ E +  +    +E  
Sbjct: 498 NTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIEN- 556

Query: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLL----EDKIHGLNSTVTE 518
            ++I EAK+ +I ++  N K    +N +  E+   KLL    ++K H     +TE
Sbjct: 557 -QTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITE 610

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 77/132 (58%), Gaps = 5/132 (3%)

Query: 356 LNDFESTVKTLLQQRSDLGHQINYLL-ITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414
            ++  S++ +L  QR+ L  Q+ YLL I Q+  NE     L   +L  +   +A  T   
Sbjct: 405 CSNLRSSINSLAFQRTVLARQVKYLLLIIQN--NETLGSSLGRKDLELLGQYLAANTAEA 462

Query: 415 STETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSI 474
            ++++ I+ ERL +F NV +L  +N++L+ + REL +K E +EK N ++    E +  +I
Sbjct: 463 MSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDE--TI 520

Query: 475 DEAKQRMIVLKE 486
           ++AK+ ++VL+E
Sbjct: 521 NDAKEAILVLQE 532

>KNAG0D01040 Chr4 complement(175315..176985) [1671 bp, 556 aa] {ON}
           Anc_6.231 YPL214C
          Length = 556

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 36/60 (60%)

Query: 402 FIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNS 461
           F R +V  P    +TET++++++ LL +   S +   + +++SL R  T+KM+ ++  N+
Sbjct: 342 FKRPIVFDPVGYSATETRHVLNDTLLTYGQFSCIKGNSSEILSLARFSTSKMKGVDAGNT 401

>KAFR0B03060 Chr2 (637546..638052) [507 bp, 168 aa] {ON} Anc_8.315
           YLR119W
          Length = 168

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 5/64 (7%)

Query: 700 LQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNK-NEIDELKK 758
           L  N+I+ L EKYK+Q+K Y  K  +++T     I +L  S +  + L+NK NEI+E KK
Sbjct: 11  LSANEIQELGEKYKTQLKLYVSKFQDVSTL----IDSLKESKDELSHLQNKFNEIEESKK 66

Query: 759 QIET 762
            + T
Sbjct: 67  GLTT 70

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
           Anc_8.604 YOR195W
          Length = 732

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 126/491 (25%), Positives = 213/491 (43%), Gaps = 104/491 (21%)

Query: 349 NQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDN---NKILTENELNFIRN 405
           N+ LK+K+ +F++ + TL   +S L  + + L+     L ++    N +  ENE      
Sbjct: 292 NEKLKVKVTEFKNEINTLNANQSLLKSKYDNLISENDALKKNKELLNNLSIENE-----K 346

Query: 406 LVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLI-SLVRELTNKMESIEKQNSQKF 464
           L+ Q  N W T        R  +  N  D   +    I     ELT++ ES+E Q     
Sbjct: 347 LINQGKN-WET--------RFSELENEKDSADEKFAQIKEQFSELTSRNESLENQ----- 392

Query: 465 GDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIIS---------------------EKK 503
                    I E  + + V KEEN KN D++N++ S                     E  
Sbjct: 393 ---------ITELNELLSVAKEEN-KNSDLLNEVNSLQEERKELQKKLEKIELDKENEVS 442

Query: 504 LLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKI 563
           +LE KI  LN T++ L        +  ++NL   KTN                  N+   
Sbjct: 443 ILESKISALNETISSLQSC-----QKEIENLNSTKTN----------------LENDLTA 481

Query: 564 LKEKFDLL-----IKSYTELKELKSEISTYTKSSVISKDGNETAKISELVD-LKAKCKNL 617
           LK KF+ +     I++  E+ EL S+I +  +S+   ++ N  +K+ E ++ LK++    
Sbjct: 482 LKSKFEEVNDNSSIRT-AEVTELNSQIESLRESNDQLQELN--SKLDEEIEILKSESLKQ 538

Query: 618 EKSFKDRESKFQELEIENNNVK----DELKKVLSEYNTF-KSTRGTIDSFNQNKNSIGIN 672
           ++ +K    + + ++++N NV+    DEL+ +    ++  KS +G  D   Q K    +N
Sbjct: 539 DEEYKKVSIELESIQLKNKNVEVERNDELESLHKTVDSLEKSLKGGYDEITQLK---KVN 595

Query: 673 ENTNKQLLKEELNT------VKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEM 726
           E    QL   E NT      V++L K  E K K  +  IK L    +SQI  ++ K++  
Sbjct: 596 EQLKSQLESFEQNTHEDHSAVETLKKDFELKDKDSQEQIKAL----ESQITSWRQKMEHN 651

Query: 727 NTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLN 786
              +  ++ NLA         K++ ++  LKK  E+K +   E L    +   Q  ++LN
Sbjct: 652 ERDITQRLKNLADDLYVKYSSKHEQKVKLLKKSYESKYQSEIERLSLENKGFNQEIEQLN 711

Query: 787 EFKGTENKLRE 797
             K  EN+ RE
Sbjct: 712 --KQIENERRE 720

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
           Ashbya gossypii AER241W
          Length = 854

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 103/218 (47%), Gaps = 36/218 (16%)

Query: 604 ISELVDLKAKCKNLEKSFKDRESKFQELE---IENNNVKDELKKVLSEYNTFKSTRGTID 660
           + EL + K K   L + FKD + +F  LE    EN  V + +     +++   S R  ++
Sbjct: 160 LDELQEWKTKHHELLERFKDLQVRFDGLEQKDTENAKVAEPV-----DHSYCDSMRKELE 214

Query: 661 SFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ 720
           +      ++    +TN+Q+L     T+    K+LEAK+K    D +   E+YK  I   +
Sbjct: 215 A------ALA---DTNQQIL-----TLTETIKNLEAKLKATSKDYEAREEQYKMNIDVLK 260

Query: 721 DKIDEMNTTMEVKISNLASSAESAAMLKNK-NEID-------ELKKQIETKSKELTESLD 772
            +I+++N++   K   LA + E    L+N+  E D       EL+K+I+ K++ +     
Sbjct: 261 SEINQLNSSFISKQEALAQAEEKVNRLRNQLQEFDHNSGSLLELEKKIDEKNQGIRNLES 320

Query: 773 RFARLKKQAKD---KLNEFKGTENKLREDYCDLEKSKN 807
           +   L  Q ++   +L    G  N L+ +Y   EK KN
Sbjct: 321 KLQELNHQRQNLERQLQTSDGVVNSLKNEY---EKYKN 355

>NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON} 
          Length = 1119

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 465 GDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLED-------KIHGLNSTVT 517
           G   + +K+I++   +++ +KE N  N D +N+I+SE  LL++       K HG     +
Sbjct: 68  GSYGVVYKAINKKTSQLVAIKEINYHNNDDLNEIMSEIDLLKNLNHTNIVKYHGFIQKSS 127

Query: 518 ELNKSMEIKREPTLKNL 534
            L   +E     +LKN+
Sbjct: 128 SLYIILEFCSLGSLKNM 144

>ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239C ADY3 Protein required for spore wall formation
           thought to mediate assembly of a Don1p- containing
           structure at the leading edge of the prospore membrane
           via interaction with spindle pole body components
           potentially phosphorylated by Cdc28p
          Length = 928

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 719 YQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLK 778
           Y +K  E   T++ KI  L  S E  A+ K   E+D L+  +  K+ EL   L+    ++
Sbjct: 332 YDNKTTEFQNTIKEKIQQLEVSDE--ALRKKTQELDSLRNDMCKKNDELANKLEELEEVR 389

Query: 779 KQAKDKLNEFKGTENKLRE 797
           K  KDK +E  G   +L+E
Sbjct: 390 KNLKDKDSELAGKSKELQE 408

>KLLA0E24949g Chr5 (2212047..2213501) [1455 bp, 484 aa] {ON} similar
           to uniprot|P24031 Saccharomyces cerevisiae YBR092C PHO3
           Constitutively expressed acid phosphatase similar to
           Pho5p; brought to the cell surface by transport
           vesicles; hydrolyzes thiamin phosphates in the
           periplasmic space, increasing cellular thiamin uptake;
           expression is repressed by thiamin
          Length = 484

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 477 AKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNS-----TVTELNKSMEIKREPTL 531
           AK  +I L+EE   N D+  QIISE     D+  G NS     +    N     +   ++
Sbjct: 180 AKNVIIGLQEELGFNVDVQLQIISE-----DQASGANSLTPRNSCKNYNSEFAKQVLGSV 234

Query: 532 KNLELQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTELKEL 581
            + +L+K  + L++KN+QL +++ N   +  I    +++ IK Y+ + +L
Sbjct: 235 NDSQLKKIRERLMKKNSQLPLKLKNKDIKQLISWCAYEINIKGYSPVCDL 284

>ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa]
           {ON} highly similar to uniprot|Q02932 Saccharomyces
           cerevisiae YPL125W KAP120 Karyopherin with a role in the
           assembly or export of 60S ribosomal subunits
          Length = 1029

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 381 LITQSYLNEDNNKILTENELNFIRNLVAQPTNTWST 416
           L+TQ +L E N++  TENE   +R  V    N WST
Sbjct: 488 LLTQVFLPEANSRTSTENEAKVVRRRVCLIINEWST 523

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.125    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,538,077
Number of extensions: 5712169
Number of successful extensions: 42021
Number of sequences better than 10.0: 2714
Number of HSP's gapped: 39659
Number of HSP's successfully gapped: 4571
Length of query: 1183
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1062
Effective length of database: 39,606,813
Effective search space: 42062435406
Effective search space used: 42062435406
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 72 (32.3 bits)