Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D045905.700ON1127112754650.0
Kpol_2001.745.700ON1113114131510.0
KAFR0D022405.700ON1187116628970.0
ZYRO0G06644g5.700ON1166115628680.0
TDEL0B022105.700ON1095113128480.0
Kwal_55.197075.700ON1143115928180.0
SAKL0E14872g5.700ON1140115127870.0
KLLA0A00638g5.700ON1155115326850.0
KNAG0L021105.700ON120093225120.0
NCAS0G002505.700ON118393124990.0
YIL147C (SLN1)5.700ON122095623940.0
Kpol_1043.685.700ON1042111823820.0
Skud_9.215.700ON122194823710.0
Smik_9.225.700ON123096623680.0
AFR284W5.700ON1103114323560.0
CAGL0H06567g5.700ON116989823520.0
Suva_9.415.700ON121995723510.0
TPHA0E002505.700ON106890620560.0
TBLA0I016805.700ON121473018330.0
KLTH0E01100g5.700ON117770418080.0
Ecym_40205.700ON112567817150.0
NDAI0F003105.700ON125948614401e-178
TBLA0E021005.700ON114067413451e-166
ADL388W4.385ON4821621852e-13
YHR206W (SKN7)4.385ON6221581782e-12
Suva_15.4124.385ON6171481764e-12
KAFR0B069904.385ON5451251754e-12
Skud_8.2734.385ON6231601764e-12
Smik_8.2964.385ON6251251747e-12
Ecym_74744.385ON4961231737e-12
TDEL0D003204.385ON5471251738e-12
TBLA0A107004.385ON5871251738e-12
KNAG0M001804.385ON6151341721e-11
CAGL0F09097g4.385ON6301401721e-11
NCAS0A064504.385ON6091251683e-11
SAKL0B12408g4.385ON4651251664e-11
Kpol_265.24.385ON5491251674e-11
Ecym_50775.230ON7951631684e-11
KLLA0A10219g4.385ON4751701647e-11
ZYRO0G00484g4.385ON6471251641e-10
TDEL0E039805.230ON7301301641e-10
CAGL0D02882g5.230ON6671371622e-10
KLTH0D17182g4.385ON4641641602e-10
KAFR0J007005.230ON6201291612e-10
Kwal_33.152885.230ON5871771541e-09
KNAG0B051405.230ON6481311542e-09
ADR343C5.230ON7491511532e-09
ZYRO0A11154g5.230ON7761761533e-09
TPHA0C001504.385ON5101231504e-09
NDAI0D034304.385ON5971221514e-09
Kwal_47.167704.385ON4611251494e-09
KLTH0B02684g5.230ON5951721497e-09
Suva_10.845.230ON6951511433e-08
KLLA0E09505g5.230ON6351181415e-08
Kpol_1004.45.230ON7141541408e-08
NCAS0D029005.230ON7621431399e-08
YLR006C (SSK1)5.230ON7121511381e-07
NDAI0I020005.230ON8901471363e-07
Smik_12.685.230ON7121511353e-07
Skud_12.725.230ON7021511344e-07
SAKL0G12100g5.230ON738941273e-06
TPHA0N008505.230ON6701381263e-06
TBLA0D031705.230ON7651541211e-05
KLLA0E04533g7.222ON4211041040.001
SAKL0F08184g7.222ON41281960.011
Klac_YGOB_Anc_8.348.34ON157174920.039
YFL033C (RIM15)8.34ON177075900.070
TBLA0B015507.222ON39486870.12
CAGL0L00869g7.222ON41996870.12
Ecym_43787.222ON44381870.12
Skud_6.388.34ON175874870.15
TBLA0G034508.34ON197285860.21
Kwal_47.181517.222ON41481850.21
SAKL0B01210g8.34ON158874850.29
Smik_6.468.34ON176074850.32
Suva_6.268.34ON175374840.38
ZYRO0D16544g7.222ON42282820.45
ADL116C7.222ON43581800.77
KLTH0G18612g8.34ON152474810.84
Suva_9.1587.222ON39378791.2
KAFR0I019307.222ON40583791.2
TDEL0H022307.222ON43081781.4
ACR218W8.34ON156974791.4
Ecym_30206.16ON94450781.7
KLTH0A03916g7.222ON41381762.6
ZYRO0F03014g8.34ON1604140763.4
Smik_4.3808.303ON1516126754.2
KNAG0A033608.604ON75679744.6
NCAS0A133907.222ON44356744.9
Suva_4.4138.515ON46460727.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04590
         (1127 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  2109   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1218   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1120   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1109   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1101   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1090   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1078   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1038   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   972   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   967   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   926   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   922   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   917   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   916   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   912   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   910   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   910   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   796   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   710   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   701   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   665   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   559   e-178
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   522   e-166
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    76   2e-13
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    73   2e-12
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    72   4e-12
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    72   4e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    72   4e-12
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    72   7e-12
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    71   7e-12
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    71   8e-12
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    71   8e-12
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    71   1e-11
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    71   1e-11
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    69   3e-11
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    69   4e-11
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    69   4e-11
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    69   4e-11
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    68   7e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    68   1e-10
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    68   1e-10
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    67   2e-10
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    66   2e-10
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    67   2e-10
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    64   1e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    64   2e-09
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    64   2e-09
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    64   3e-09
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    62   4e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     63   4e-09
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    62   4e-09
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    62   7e-09
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    60   3e-08
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    59   5e-08
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    59   8e-08
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    58   9e-08
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    58   1e-07
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    57   3e-07
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    57   3e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    56   4e-07
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    54   3e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    53   3e-06
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    51   1e-05
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    45   0.001
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    42   0.011
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    40   0.039
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    39   0.070
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    38   0.12 
CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa] ...    38   0.12 
Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar t...    38   0.12 
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    38   0.15 
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    38   0.21 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    37   0.21 
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    37   0.29 
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    37   0.32 
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    37   0.38 
ZYRO0D16544g Chr4 (1373180..1374448) [1269 bp, 422 aa] {ON} simi...    36   0.45 
ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON} S...    35   0.77 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    36   0.84 
Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON...    35   1.2  
KAFR0I01930 Chr9 complement(392954..394171) [1218 bp, 405 aa] {O...    35   1.2  
TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {O...    35   1.4  
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    35   1.4  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...    35   1.7  
KLTH0A03916g Chr1 (329926..331167) [1242 bp, 413 aa] {ON} simila...    34   2.6  
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    34   3.4  
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...    33   4.2  
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    33   4.6  
NCAS0A13390 Chr1 (2634871..2636202) [1332 bp, 443 aa] {ON} Anc_7...    33   4.9  
Suva_4.413 Chr4 complement(732582..733976) [1395 bp, 464 aa] {ON...    32   7.8  

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 2109 bits (5465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/1127 (92%), Positives = 1040/1127 (92%)

Query: 1    MQLIPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAA 60
            MQLIPKKFWKPPYRISIRAQLT                TAGVYFTANYKNLKTGRLYIAA
Sbjct: 1    MQLIPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAA 60

Query: 61   QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120
            QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL
Sbjct: 61   QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120

Query: 121  FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180
            FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG
Sbjct: 121  FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180

Query: 181  SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240
            SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS
Sbjct: 181  SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240

Query: 241  ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300
            ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV
Sbjct: 241  ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300

Query: 301  GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPL 360
            GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISG         CLLTFPLSHWAVQPL
Sbjct: 301  GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPL 360

Query: 361  IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSI 420
            IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSI
Sbjct: 361  IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSI 420

Query: 421  XXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVY 480
                              HIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVY
Sbjct: 421  TANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVY 480

Query: 481  WRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIAN 540
            WRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIAN
Sbjct: 481  WRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIAN 540

Query: 541  ISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRT 600
            ISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSG            FSKNVLQRT
Sbjct: 541  ISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRT 600

Query: 601  KLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLV 660
            KLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLV
Sbjct: 601  KLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLV 660

Query: 661  SNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDIS 720
            SNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDIS
Sbjct: 661  SNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDIS 720

Query: 721  RKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTAL 780
            RKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTAL
Sbjct: 721  RKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTAL 780

Query: 781  MKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALS 840
            MKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALS
Sbjct: 781  MKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALS 840

Query: 841  RQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDELFNDEF 900
            RQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDELFNDEF
Sbjct: 841  RQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDELFNDEF 900

Query: 901  NAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSSLNNRHXXXXXXXXXXXXXXXXNVRPSSV 960
            NAVSKKNR                TRNSIGSSLNNRH                NVRPSSV
Sbjct: 901  NAVSKKNRKVKFKFSGSSSAKSIKTRNSIGSSLNNRHSTTSIDSSSSDSDEEDNVRPSSV 960

Query: 961  RLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRML 1020
            RLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRML
Sbjct: 961  RLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRML 1020

Query: 1021 KLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQ 1080
            KLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQ
Sbjct: 1021 KLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQ 1080

Query: 1081 PIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
            PIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ
Sbjct: 1081 PIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1218 bits (3151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1141 (58%), Positives = 801/1141 (70%), Gaps = 61/1141 (5%)

Query: 6    KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
            +K +KPPYRI+IRAQLT                T GVYFT NYK L++GRL IAA+LK+S
Sbjct: 6    RKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSS 65

Query: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
            QIDQTLNYL+YQC YL+S +TLQN+L++Y AGN +  NW ES  V++KFL+SSDLF VAR
Sbjct: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125

Query: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
            LYD NF  ++NATNN +G+ +P  V+ +LF LS N SLPSSL   GI TDPVLNGS +LM
Sbjct: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185

Query: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245
            SMSLPI  NPSIILS SR+YGY++++MSA+GLK+V+ + TALENS V VISA Y+    +
Sbjct: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245

Query: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305
            + F+F+F    +N D    + Y I N T++ + LV GK G++KKT        A+GYS C
Sbjct: 246  DGFHFVFE--VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303

Query: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQK 365
            SFSL NW+A+V QPEA F   +TKLE+IISG         CL+TFPLSHWAV+P++RLQK
Sbjct: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363

Query: 366  ATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSIXXXXX 425
            ATE I++GRGL+P      +  S ++S  WR S+E+HVR+SLG     L ++GS      
Sbjct: 364  ATELISQGRGLKPTS-NFSNGDSSSTSDNWRESVESHVRASLGI-FKSLRNNGSNELQSN 421

Query: 426  XXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQ 485
                         +  G+N  S  +         SSS Q+Y TS NL++ARVPVY R LQ
Sbjct: 422  DDMNEINERSSKNNSTGDNIKSSDND-------SSSSFQRYTTS-NLVQARVPVYGRFLQ 473

Query: 486  DELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHEL 545
            DELSELTDTFN MT+ALDQHY LLE+RVRARTKQLEAAKI+AE+ANEAKTVFIANISHEL
Sbjct: 474  DELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHEL 533

Query: 546  RTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKR 605
            RTPLNGILGMTAISMEEDD DKI+ NLKLIFRSG            FSKNVL+RT LEKR
Sbjct: 534  RTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKR 593

Query: 606  DFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALK 665
            DFCITE+ALQIKSIFGK+A+DQHVKL IILMPN +RS VLWGDSNRIIQ+VMNLVSNALK
Sbjct: 594  DFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALK 653

Query: 666  FTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSET 725
            FTP+DG VDVRI LLGEYDEERS  +DYK+VY+K GTELP+        +  D+ RK   
Sbjct: 654  FTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG-----NGKKTDMVRKKIQ 708

Query: 726  ELN-NDENETHTISKDDTADSSIKIGN--EDVEISEV-------DKMGMASLVTTSSKSY 775
            EL+  D  E  T S       S KI    ED E +         + + + S+ T+S++SY
Sbjct: 709  ELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSY 768

Query: 776  DDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQG 835
            DD AL +Q  K+ DLDD E  LGVEL E KTWVISVEV+DTG GI+PKLQE+VFEPFVQG
Sbjct: 769  DDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQG 828

Query: 836  DQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL 895
            DQALSRQYGGTGLGLSIC+QL+TMM+GTM+LES VGVGSKFIFT+PLKQTREI   DDE 
Sbjct: 829  DQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHF-DDEK 887

Query: 896  FNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIG-------SSLNNRHXXXXXXXXXXX 948
            F DEFNA SKKNR                  +  G        S NN H           
Sbjct: 888  FEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNH 947

Query: 949  XXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDL-----IYI 1003
                     S VRL+RPFLQSTGTATS+Q +PTL            +NK D      I I
Sbjct: 948  ---------SKVRLDRPFLQSTGTATSSQKIPTL------------INKEDTNIEKSIRI 986

Query: 1004 LVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRL 1063
            LVAEDNHVNQEVIKRML LE I+NIDLA DGQDAFDK K L++N   YDIIFMDVQMP++
Sbjct: 987  LVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKV 1046

Query: 1064 DGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYI 1123
            DGL +TKMIR++LNY  PIVAL+AF  ++N+KECLD GM+ FL KPIKRP LK IL++YI
Sbjct: 1047 DGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106

Query: 1124 E 1124
            +
Sbjct: 1107 D 1107

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1166 (53%), Positives = 774/1166 (66%), Gaps = 78/1166 (6%)

Query: 10   KPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69
            KPPYRISIR QL                 T GVYFT++YKNL+  RLYIAAQLK+SQIDQ
Sbjct: 24   KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129
            TL YLYYQ Y++S+ +TLQ+SL ++ AGN SS+NW  +  VLEKFL+SSD FS  ++YD 
Sbjct: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 130  NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189
            NF+ +++ TNN +GN +   V++KLF LS NI L SSLET GI TDPVLNG+++LMSMSL
Sbjct: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 190  PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249
            P+FANPSIILS SR+YGY+++IM+A+GL SVFNDTTA+E S V ++SA Y+  + L+ ++
Sbjct: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263

Query: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309
             L    Y       D+++++ N +F+   L  GKGG++KKT+     A AVGYS CSF L
Sbjct: 264  -LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFEL 322

Query: 310  VNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATER 369
             NW+++V+Q E+ FS  +TKL +II+G          L+T PL+++AV+P++RL+KATE 
Sbjct: 323  ANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEI 382

Query: 370  IAEGRGLRPPQPTVGSSVSRNSSIKW----RNSLENHVRSSLGFNANKLSD-SGSIXXXX 424
            I EGRGLRP  P  GS VSR SS++     R S+ +  +S+   N+N L++ S S+    
Sbjct: 383  ITEGRGLRPTTPGSGS-VSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNENSASLSSHP 441

Query: 425  XXXXXX---XXXXXXXXHIYGNNN---------SSHSSMGINPDDDLSSSSQKYKTSANL 472
                              I  N N         S+ +++ I+ +D LS  S+   T  NL
Sbjct: 442  MVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTNL 501

Query: 473  IEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANE 532
             EARVP+  +L  DELS+LT+TFNTMTDALD+HY LLE+RVRARTKQLEAAKIQAE+ANE
Sbjct: 502  TEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAANE 561

Query: 533  AKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXF 592
            AKTVFIANISHELRTPLNGILGMTAISMEE+D+ KIR +LKLIFRSG            F
Sbjct: 562  AKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELLTF 621

Query: 593  SKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRI 652
            SKNVLQRTKLEKR+FCIT+VALQ+KSIFGK+AKDQHV+LSIIL PNI+R+ VL+GDSNRI
Sbjct: 622  SKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRI 681

Query: 653  IQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTE---LPLNIS 709
            IQVVMNLVSNALKFTPVDG V V+I LLGEYDEE SK   ++KVYVK GTE   +P  ++
Sbjct: 682  IQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSIPAELA 741

Query: 710  HLKTEENNDISRKSETELNNDEN-------------------ETHTISKDDTADSSIKIG 750
             L   E+   S  S +  +  E                    E  TI+      SS    
Sbjct: 742  ALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGTTINTSQQRTSS---- 797

Query: 751  NEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KLGVELKEQKTWVI 809
            NED     VD     S+ +TS+ SYDD     Q  K+ DL +DE+  LG EL +QKTWV 
Sbjct: 798  NEDY----VDN---ISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVF 850

Query: 810  SVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESE 869
             +EV DTG GID  LQESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+TMMNGTM LES 
Sbjct: 851  RIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLEST 910

Query: 870  VGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNRX----XXXXXXXXXXXXXXX 924
            VG GSKFIFT+PL QTR I + + E  + DEFN  SK NR                    
Sbjct: 911  VGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLI 970

Query: 925  TRNSIGSSL---NNRHXXXXXXXXXXXXXXXXNVRP-----SSVRLNRPFLQSTGTATST 976
            T NS   +     +R                 +  P     S++ L+RPFLQSTGTA S+
Sbjct: 971  TSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISS 1030

Query: 977  QNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQD 1036
             NVPT+       +  K LN      +LVAEDNHVNQEVIKRML LEG+ NIDLA DGQD
Sbjct: 1031 ANVPTV------ATLGKTLN------VLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078

Query: 1037 AFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKE 1096
            AFD  K L E    YD+IFMDVQMP++DGL+ATKMIR +L Y  PIVAL+AF  + N+KE
Sbjct: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKE 1138

Query: 1097 CLDVGMNDFLSKPIKRPDLKIILKKY 1122
            CLD GM+ FLSKPIKRP LK IL +Y
Sbjct: 1139 CLDAGMDGFLSKPIKRPQLKTILLEY 1164

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1156 (52%), Positives = 768/1156 (66%), Gaps = 82/1156 (7%)

Query: 2    QLIPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQ 61
            QL+  KF + P R+ IRAQLT                + GVYFT NYKNL++ RLY+AAQ
Sbjct: 5    QLMFGKF-QSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQ 63

Query: 62   LKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLF 121
            LK++QIDQ LNY+YYQCY+LSS +TLQ +L +Y AGN +  NW +S  V++KFLTSS LF
Sbjct: 64   LKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLF 123

Query: 122  SVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGS 181
            SVA +YD  F  +++ATNN +GN++PES +D+L  LS N  LPSSL++ GI T+PVLNG+
Sbjct: 124  SVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGT 183

Query: 182  NFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSI 241
            ++LMSMSLPIFANPSIIL+ S +YGY++++MSA+ LK+VF+DTTALE S V ++SA Y  
Sbjct: 184  SYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQ 243

Query: 242  TTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVG 301
               L  +NF+FA               I N TF+ + L  GKGGA+++T        AVG
Sbjct: 244  NETLSSYNFVFA-PLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302

Query: 302  YSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLI 361
            YS CS   VNW+A+V Q EA F E ATKL +IISG         CL+TFPL+HWAV+P++
Sbjct: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362

Query: 362  RLQKATERIAEGRGLRPPQPTVGSS-VSRNSSIKWRNS-LENHVRSSLGFNANK------ 413
            RLQKATE I EGRGLR   P  GSS VSR SS   R S   + +RS +  N N+      
Sbjct: 363  RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLH 422

Query: 414  --------LSDSGSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQK 465
                     + +GSI                       N+S  +S+  + ++ LS  S+ 
Sbjct: 423  GEQIQHGFFAMNGSI-----------------------NHSLAASIASSGNEALSDKSKG 459

Query: 466  YKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKI 525
              TSANLIEARVPVY R   DELSELTDTFNTMTDALDQHY LLE+RVRART+QLEAAKI
Sbjct: 460  LTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKI 519

Query: 526  QAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXX 585
             AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE D+DKI+ +LKLIFRSG      
Sbjct: 520  DAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHI 579

Query: 586  XXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVL 645
                  FSKNVL+RTKLEKR+F +T+VALQIKSIFGK+AKDQ V+LSI L PN++R+ VL
Sbjct: 580  LTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVL 639

Query: 646  WGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELP 705
            +GDSNRIIQ+VMNLVSNALKFTPVDG V+V ++LLGEYD ERS+ E++KKVYV  GTE  
Sbjct: 640  FGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPK 699

Query: 706  LNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISE------- 758
             N      ++   I  K    + N  N+T + S +  +D+    G  D +  +       
Sbjct: 700  GN----DEKDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDG 755

Query: 759  ----VDKMGMASLVTTSSKSYDDTALMKQLIKSTDL-DDDENKLGVELKEQKTWVISVEV 813
                V+     S  +TS+ SY+DT    Q  K+  + DD   +LGVE+K++K WVIS+ V
Sbjct: 756  GEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVV 815

Query: 814  KDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVG 873
            +DTG GID  L ESVFEPFVQGDQALSRQYGGTGLGLSIC+QL+TMMNGTM+L+S++GVG
Sbjct: 816  EDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVG 875

Query: 874  SKFIFTLPLKQTREISIPD-DELFNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRN-SIGS 931
            S+F FT+PL QTREI+  D    F DEFN  SKKNR                +   ++G 
Sbjct: 876  SRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGP 935

Query: 932  SLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSK 991
              ++                       SVRL+RPFLQSTGTA+S  N+ T          
Sbjct: 936  KSSSSDKSLSQLKLTDSD--------RSVRLDRPFLQSTGTASSNTNLGT---------- 977

Query: 992  NKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNY 1051
               +NK     ILVAEDN VNQEVIKRML LEG++NI+L  DGQ+A DK K L EN  +Y
Sbjct: 978  TSTINK-----ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHY 1032

Query: 1052 DIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIK 1111
            ++IFMDVQMP++DGL +TKMIR +LNYT PIVAL+AF  + N++ECLD GM+ FL+KPIK
Sbjct: 1033 NLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIK 1092

Query: 1112 RPDLKIILKKYIEDFQ 1127
            R  L+ I++++  D Q
Sbjct: 1093 RAQLRKIIEEFCPDKQ 1108

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1131 (53%), Positives = 764/1131 (67%), Gaps = 58/1131 (5%)

Query: 4    IPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLK 63
            I K+ + PP+RISIR QLT                T GVYFT+NYK+L++ RLY+AAQLK
Sbjct: 6    IAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLK 65

Query: 64   ASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSV 123
            +SQIDQ LNYLYYQCY+LSS  TLQ SL +Y +GN +  NW +SS VL+KFL+SS LFSV
Sbjct: 66   SSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSV 125

Query: 124  ARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNF 183
            AR+YD +F  ++NATNN +G+ + + V+ KL  LS N++LP+SLE+ G+ TDPVLNG+++
Sbjct: 126  ARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSY 185

Query: 184  LMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITT 243
            LMSMSLPI+ANPSIIL++SR+YGY+++IMSA+ LKSV++D TALE S V ++SA Y    
Sbjct: 186  LMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQ 245

Query: 244  NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYS 303
             L  + F+FA  Y       D  + I+N++F+   L  GK G+ ++T+ F    +AVGYS
Sbjct: 246  GLGSYRFVFA-PYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYS 304

Query: 304  SCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRL 363
             CSF  VNW+AI++Q EA F E +T+L +II G         C+ TFPL+HWAVQP++RL
Sbjct: 305  PCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRL 364

Query: 364  QKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDS-GSIXX 422
            QKATE I EGRGLR   P   S    +S I+ R         S    +  L+D  G++  
Sbjct: 365  QKATEIITEGRGLRSGTPGSSSVSRNSSFIRRR------FSGSSSVRSPSLADEKGAVGR 418

Query: 423  XXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSS-SQKYKTSANLIEARVPVYW 481
                               G+ N   +   +N + ++SS  ++KY TS+NL+EARVPVY 
Sbjct: 419  ASTE---------------GSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYR 463

Query: 482  RLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANI 541
                DE SELTDTFNTMT+ALDQHY LLE+RVRARTKQLEAAK++AE+ANEAKTVFIANI
Sbjct: 464  IFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANI 523

Query: 542  SHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTK 601
            SHELRTPLNGILGMTAISMEE D+DKI+ +LKLIFRSG            FSKNVLQRTK
Sbjct: 524  SHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTK 583

Query: 602  LEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVS 661
            LEKRDF IT+VA+QIKSIFGK+AKDQ VK SI L PN +R  VL+GDSNRIIQ+VMNLVS
Sbjct: 584  LEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVS 643

Query: 662  NALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTE------LPLNISHLKTEE 715
            NALKFTPVDG V VR+ LLGEYD++RS+ ED+K VYV  GTE      +P  +   + +E
Sbjct: 644  NALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQE 703

Query: 716  NNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSY 775
              D+ ++  +E +N+E      S  D+  +++     D + S+ D     SL++ S+ SY
Sbjct: 704  --DLEKEKISEKHNEEEA----STSDSEKTNLDDKTPDSKRSDADD--QVSLISISTSSY 755

Query: 776  DDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQG 835
            DDT    Q  K T    DEN  G  L+  K W ISVEV+DTG GIDP L ESVFEPFVQG
Sbjct: 756  DDTIFHTQFKKHTSSSGDEN--GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQG 813

Query: 836  DQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL 895
            DQALSRQYGGTGLGLSIC+QL+TMMNGTM+L+S++GVGSKF FTLPL QTREI   D+  
Sbjct: 814  DQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFEDENA 873

Query: 896  FNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSSLNNRHXXXXXXXXXXXXXXXXNV 955
            F DEFN +SKKNR                +  S  S                        
Sbjct: 874  FEDEFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGGSSDKSSKQLKGSESEFSVG- 932

Query: 956  RPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIY-ILVAEDNHVNQE 1014
               +V L+RPFLQSTGTA+S++NV              V++ ++  Y ILVAEDNHVNQE
Sbjct: 933  ---NVSLDRPFLQSTGTASSSKNV-------------TVVSNVNKSYRILVAEDNHVNQE 976

Query: 1015 VIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIRE 1074
            VIKRML LEGI+ IDLA DGQDAFDK K L E   +Y++IFMDVQMP++DGL ATKMIR+
Sbjct: 977  VIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRK 1036

Query: 1075 ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
            +L+Y  PIVAL+AF  + N++ CL+ GMN FLSKPIKRP LK I+ +Y  D
Sbjct: 1037 DLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1159 (51%), Positives = 767/1159 (66%), Gaps = 89/1159 (7%)

Query: 6    KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
            ++  + P  +SIR QLT                  GVYFT+++K+L+  RL++AAQLK+S
Sbjct: 14   QRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSS 73

Query: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
            QIDQ LNYLYYQCY+LS+ + LQN+L  Y AGN S+ NW ++S  L+KFL SS+LFS+AR
Sbjct: 74   QIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLAR 133

Query: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
            +YD++F  ++N +NN SGN +PE+++ +LF LS +++LPSSLE  G+ TDPVLNGS +LM
Sbjct: 134  VYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLM 193

Query: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245
            SMSLPIFANPSIILS +++YGY++V++SAEGLKSV+NDTTAL++S V ++S  Y     L
Sbjct: 194  SMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYD-DHEL 252

Query: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305
              ++ +F   Y+      + HY+I+N +F+ + + +GKGG++K T  F     AVGYS C
Sbjct: 253  AGYHLVFP-PYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311

Query: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQK 365
            + +L  W+AI+ QPEA F   +T+L +II G         C++TFPLSHWAVQP++RLQK
Sbjct: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371

Query: 366  ATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLG------FNANKLSDSGS 419
            ATE I  GRGLR          S NSS     +L +H R+S        F    +  SGS
Sbjct: 372  ATEIITAGRGLR----------SDNSS-----TLFSHKRTSTAESFSSIFGTGSVRRSGS 416

Query: 420  IXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPD--------------------DDL 459
            +                        NSS +   +N +                    +  
Sbjct: 417  VARAGRDKYIPDSSKEVP-----RGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQ 471

Query: 460  SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQ 519
            +  S++Y TS NLIEARVPVY RL  DELSELT+TFNTMTD LD+HY LLE+RVRART+Q
Sbjct: 472  AVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQ 531

Query: 520  LEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSG 579
            LEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAI+M E+D  K++ +LKLIFRSG
Sbjct: 532  LEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSG 591

Query: 580  XXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNI 639
                        FSKNVL+RTKLE+RDF I ++ALQ++SIFGKLAKDQHV L+I ++PN+
Sbjct: 592  ELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNL 651

Query: 640  LRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVK 699
            LRS VLWGDSNRI+Q+VMNLVSNALKFTPVDG VDV+  LLGEYDEE+SKA +YK+V+V 
Sbjct: 652  LRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVL 711

Query: 700  QGTELPLNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSS----IKIG----- 750
              TE   + +  K E+N      +E+ +++D   T+ +S   TA+S+    +KIG     
Sbjct: 712  PPTESRTSSTEAKDEKN------AESCVDSD---TNVLSLPSTAESTDEKNVKIGQRSES 762

Query: 751  ----NEDVEISEVDKMG--MASLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGVELKEQ 804
                +E +E S+ D       S+ + ++ SYDD     +L K  D  ++EN+ G  L+  
Sbjct: 763  EAIDSEAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRK--DSSNEENEEGRALESP 820

Query: 805  KTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTM 864
            K WVIS+EV DTG GIDP L ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+TMM+GTM
Sbjct: 821  KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM 880

Query: 865  ELESEVGVGSKFIFTLPLKQTREISIPDDE-LFNDEFNAVSKKNRXXXXXXXXXXXXXXX 923
            +L+S+VGVGSKF FT+PL QT+E+   D E  F DEFN  SKKNR               
Sbjct: 881  KLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKS 940

Query: 924  XTRNSIGSSLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLN 983
             + +S G+  N  +                 V   SVR++RPFLQSTGTA ST  V T  
Sbjct: 941  RSESS-GTEGNGGNSPGVEGSGGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTTLVTT-- 997

Query: 984  AHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKM 1043
            +   D+ K           ILVAEDN+VNQEVIKRML LEG+ +++LA DGQDAFDK K 
Sbjct: 998  SSLADRRK-----------ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKA 1046

Query: 1044 LSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMN 1103
                  +YD+IFMDVQMPR+DGL AT+MIR+EL Y+ PIVAL+AF  + N+KECLD GMN
Sbjct: 1047 QDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMN 1106

Query: 1104 DFLSKPIKRPDLKIILKKY 1122
             FLSKPIKRP +K ILK+Y
Sbjct: 1107 GFLSKPIKRPKIKAILKEY 1125

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1151 (52%), Positives = 765/1151 (66%), Gaps = 66/1151 (5%)

Query: 10   KPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69
            KPP+++ IR QL                 T GVYFTANYK+L+  RL++AAQLK+SQIDQ
Sbjct: 12   KPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71

Query: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129
             LNYLYYQCY+LS+ +TLQ+SL+ Y AGN +  NW E+ +VLEKFL SSDLFSVAR+YD+
Sbjct: 72   NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131

Query: 130  NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189
             F  ++NATNN SGN VPE V+  LF LS +  L SSL+T GI TDPVLN + ++MSMSL
Sbjct: 132  TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191

Query: 190  PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249
            PIFA+PSI+L++S I GY++V+MSAE LK VFNDTTAL+ S+V ++SA+YS  +    ++
Sbjct: 192  PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251

Query: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309
            F+F      AD   D  + I+N +F+ +   + K G+VK+T+ F G   AVGYS C F  
Sbjct: 252  FVFPPHGVGADI-IDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310

Query: 310  VNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATER 369
            V W+A+++QPE  F   +T+L  II G         CL+TFPL+HWAV+P++RLQKATE 
Sbjct: 311  VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370

Query: 370  IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSIXXXXXXXXX 429
            I   RGLR    +  +  SR +S + R S      SS+G     ++D             
Sbjct: 371  ITARRGLRSYNQS--APASRTNSFRKRPS----TSSSIGSVFRTITD-------RPHERD 417

Query: 430  XXXXXXXXXHIYGNNNSSHSSM------GINPD-----------DDLSSSSQKYKTSANL 472
                     H   N+  S  +       G  PD           D  S  S  +  S NL
Sbjct: 418  NGHSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNL 477

Query: 473  IEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANE 532
            I+ARVPVY RL  DELSELTDTFNTMTD LD+HY LLE+RVRARTKQLEAAKI+AE+ANE
Sbjct: 478  IDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANE 537

Query: 533  AKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXF 592
            AKTVFIANISHELRTPLNGILGMTAISM E D+ K++ +LKLIFRSG            F
Sbjct: 538  AKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTF 597

Query: 593  SKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRI 652
            SKNVLQRTKLE+R+F I +VALQ+KSIFGKLAKDQHV LSIIL PN++R+ +LWGDSNRI
Sbjct: 598  SKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRI 657

Query: 653  IQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELP------L 706
            IQ+VMNLVSNALKF+PVDG V VRI LLGEYD ++SK  +Y  V++K GTE+P       
Sbjct: 658  IQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKS 717

Query: 707  NISHLKTEENNDISRKSETELNNDEN-ETHTISKDDTADSSIKIGNEDVEISEVDKMGMA 765
            ++S L+  + + I R+  ++ ++ +  +   I+  D + S  K  +E    ++ DK   +
Sbjct: 718  SLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNS 777

Query: 766  SL------VTTSSKSYDDTALMKQLIKSTDL---DDDENKLGVELKEQKTWVISVEVKDT 816
             +      V++++ SYDD  L  QL K       +D  + LG +L+  KTWVI++EV+DT
Sbjct: 778  EISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDT 837

Query: 817  GSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKF 876
            G GI+P L ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM GTM+LES+VGVGSKF
Sbjct: 838  GPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKF 897

Query: 877  IFTLPLKQTREISIPDDE-LFNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSSLNN 935
             FT+PL QTRE+S  D E  F DEFNA SKKNR                +R S+ +SLN+
Sbjct: 898  TFTVPLTQTREVSFDDVENPFEDEFNAHSKKNR--KVKFKMNKNSGGSKSRPSVNTSLNS 955

Query: 936  RHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVL 995
                               V   SVR++RPFLQSTGTATST+++ T+      KS  +  
Sbjct: 956  ----GTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTV------KSLERPF 1005

Query: 996  NKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIF 1055
                   ILVAEDN+VNQEV+KRML LEG+++IDLA DGQ+AFDK K L E N +Y IIF
Sbjct: 1006 K------ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059

Query: 1056 MDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDL 1115
            MDVQMPR+DGL +TKMIR+EL Y+ PIVAL+AF  + N+K CLD GMN FLSKPIKRP L
Sbjct: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119

Query: 1116 KIILKKYIEDF 1126
            K +L ++  DF
Sbjct: 1120 KSVLSEFCPDF 1130

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1153 (50%), Positives = 754/1153 (65%), Gaps = 58/1153 (5%)

Query: 6    KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
            ++ + PP+ + +R QL                 T GVYFT NYK+++  RL +AAQLK+S
Sbjct: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
            Q+DQ LNYLYYQ Y+LS+ +TLQ++LV++ AGN S  NW  +   LEKFL SS LFS AR
Sbjct: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
            +YDT+FN +IN+TNN SG+ +PE+V+ +LF LS    L SSL T GI TDPV N +N+L+
Sbjct: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245
            SMSLP+  NPSIIL+ + I GY++VI SAE LK+V NDT AL+ S V ++SA +   ++L
Sbjct: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305
              ++F+F   +  +     + + I N TF+ +   NGK G+V KTN       AVGYS  
Sbjct: 255  TGYHFVFP-PHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313

Query: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQK 365
            +F LVNW+A+V QPE  F     +L +II+G         CLLTFP++HWAVQP++RLQK
Sbjct: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373

Query: 366  ATERIAEGRGLRPPQPTVGS------SVSRNSSIKWRNSLENHVRSSL--GFNANKLSDS 417
            ATE I  GR L+    T  S      + SR  S   +N +      S+  G  +N L+ +
Sbjct: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433

Query: 418  GSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHS-SMGINP--DDDLSSSSQKYKTSANLIE 474
             ++                     G  + + S + G  P  +D  S +S++Y  S NL+E
Sbjct: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVE 493

Query: 475  ARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAK 534
            A VPVY R  QDELSELTDTFNTMTD LD+HY LLEERVRARTKQLEAAKIQAESANEAK
Sbjct: 494  AYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAK 553

Query: 535  TVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSK 594
            TVFIANISHELRTPLNGILGMTAI+M E D+ K++ +LKLIFRSG            FSK
Sbjct: 554  TVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSK 613

Query: 595  NVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQ 654
            NVL+RTKLE+RDF + ++ALQIKSIFGKLAKDQHVKLSI L PN +R+ VLWGDSNRIIQ
Sbjct: 614  NVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQ 673

Query: 655  VVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTE----------- 703
            +VMNLVSNALKFTPVDG VDVRI LLGEYD +RS++ DY++V+V  G+E           
Sbjct: 674  IVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTS 733

Query: 704  -----LPLNISHLKTE---ENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVE 755
                 LP N S        ++   S  ++T+  + + E+ T ++ +  D S  +     E
Sbjct: 734  TTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESKHE 793

Query: 756  ISEVDKMGMASLVTTSSKSYDDTAL---MKQLIKSTDLDDDENKLGVELKEQKTWVISVE 812
             +E +K  M+ L T++S SYDD       K+++ STD D +EN    +LK  KTWVIS+E
Sbjct: 794  ENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFR-DLKVPKTWVISME 852

Query: 813  VKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGV 872
            V+DTGSGIDP LQESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM GTM+L+S+VGV
Sbjct: 853  VEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGV 912

Query: 873  GSKFIFTLPLKQTREISIPDDE-LFNDEFNAVSKKNRXXX-XXXXXXXXXXXXXTRNSI- 929
            GSKFIFT+PL+QT+EI     E  F DEFN  S+KNR                 +++SI 
Sbjct: 913  GSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSID 972

Query: 930  GSSLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDK 989
            G S NN                       +VR++RPFLQSTGTATST+++          
Sbjct: 973  GHSDNNVSERKASNSTENSV--------GNVRVDRPFLQSTGTATSTRSI---------- 1014

Query: 990  SKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNG 1049
              + V +++    +LVAEDN+VNQEVIKRML+LEG+ ++D+A DGQ+A++K + + +N  
Sbjct: 1015 --SSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGE 1072

Query: 1050 NYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKP 1109
            +Y +IFMDVQMPR+DGL ATKMIR +L Y  PIVAL+A+  + N+K CL+ GM+ FL KP
Sbjct: 1073 SYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKP 1132

Query: 1110 IKRPDLKIILKKY 1122
            IKRP LK I+ +Y
Sbjct: 1133 IKRPLLKKIIAQY 1145

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/932 (55%), Positives = 651/932 (69%), Gaps = 58/932 (6%)

Query: 10  KPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69
           KPPYR+ IRAQLT                T GVYFT+NYKNL++ RLYIAAQLK+SQIDQ
Sbjct: 11  KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 70  TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129
            LNYLYYQCY+++S +TLQ  L +Y AGN S  NW +S  VLEKFL SS+LFSVAR+YD+
Sbjct: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 130 NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189
           +F  ++N TNN++G+ +PE V+ +L  LS N+ LPSSLET GI T+PV NGS++LMSMSL
Sbjct: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 190 PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249
           PIFANPSIIL+DSR+YGY++V+MSAEGL SVFNDTTALE S V ++SA Y+  T L+ + 
Sbjct: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250

Query: 250 FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309
           F+F   + +     +  + ++N+TF+ + L  GKGGA+K T  F     AVGYS  + +L
Sbjct: 251 FVFP-PFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNL 309

Query: 310 VNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATER 369
            NW+AIVAQ E+ F   ATKL +II+G          L+TFPL+HWAV+P++RLQKATE 
Sbjct: 310 ANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATEL 369

Query: 370 IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSIXXXXXXXXX 429
           I E RGLRP  PT GS    NS ++ ++SL       + F  + +S +            
Sbjct: 370 ITESRGLRPTTPTSGSRA--NSILRDKSSL-------ISFPLHPVSTNNINNNNSNEKAQ 420

Query: 430 XXXXXXXXXHIYGNNNSSHSSMGI-------NPDDD-----------------LSSSSQK 465
                        N N+S SS+ +       +P  D                 LS++S+ 
Sbjct: 421 PPSDQDT------NTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKH 474

Query: 466 YKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKI 525
           Y T+ NLI+ARVP Y  L +DELS+LT+TFNTMTDALDQHY LLEERVRARTKQLEAAKI
Sbjct: 475 YTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKI 534

Query: 526 QAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXX 585
           +AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE D+DKIR +LKLIFRSG      
Sbjct: 535 EAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHI 594

Query: 586 XXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVL 645
                 FSKNVL+RTKLEKR+FCIT+VALQIKSIFGK+AKDQHV+LSIIL PN++RS VL
Sbjct: 595 LTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVL 654

Query: 646 WGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELP 705
           +GDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ +LG YDE  S+  ++ KVYVK GTE+ 
Sbjct: 655 YGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEI- 713

Query: 706 LNISHLKTEENNDISRKSETELNNDENETHTISKD----DTADSSIKIGNEDVEISEVDK 761
                  T+    ++ KSE +   D+  + T SK+    DTA  +    +   + S+ D 
Sbjct: 714 -------TDSTPSLNVKSEGQ-GKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDN 765

Query: 762 M--GMASLVTTSSKSYDDTALMKQLIKSTDL--DDDENKLGVELKEQKTWVISVEVKDTG 817
           M     S++++++ SYDD     Q  K+T+L  +DDE+++GVEL+  KTWVIS EV+D+G
Sbjct: 766 MYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSG 825

Query: 818 SGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFI 877
            GID  LQESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM G M LES+VGVGSKF 
Sbjct: 826 PGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFT 885

Query: 878 FTLPLKQTREISIPD-DELFNDEFNAVSKKNR 908
           FTLPL QTREI+  + ++ F DEFNA SKKNR
Sbjct: 886 FTLPLTQTREINFANVEDPFEDEFNAKSKKNR 917

 Score =  207 bits (527), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 134/181 (74%), Gaps = 13/181 (7%)

Query: 958  SSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLN------------KMDLIY-IL 1004
            S++ L+RPFLQSTGTATST+++P L++  ++K  + +LN            + +  Y IL
Sbjct: 1009 STMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKIL 1068

Query: 1005 VAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLD 1064
            VAEDNHVNQEVIKRML+LEG+ +IDLA DGQDAFDK K L +    Y++IFMDVQMP++D
Sbjct: 1069 VAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVD 1128

Query: 1065 GLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
            GL +TKMIR +L+   PIVAL+AF  + N+KECLD GM+ FLSKPIKR  LK ILK++  
Sbjct: 1129 GLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188

Query: 1125 D 1125
            D
Sbjct: 1189 D 1189

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/931 (55%), Positives = 648/931 (69%), Gaps = 35/931 (3%)

Query: 10  KPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69
           KPP+R+ IR QLT                T GVYFT+NYKNL++ RLYIAAQLK+SQIDQ
Sbjct: 12  KPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 71

Query: 70  TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129
            LNYLYYQ Y+LSS +TLQ  L +Y AGN ++ NW +S  V++KFLTS++LFS A+LYD+
Sbjct: 72  NLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDS 131

Query: 130 NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189
           +FN ++ ATNN +G+ +PESV+ KL+ L+ N  L SSLETIGI TDPVLNGS ++MSMSL
Sbjct: 132 SFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSL 191

Query: 190 PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249
           PIFANPSIIL+DS++YGY++++MSAEGLK+VFNDTTALE S V ++S  Y+  + L  ++
Sbjct: 192 PIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYH 251

Query: 250 FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309
           F+FA  Y       +  +RI N++F+   L  GKGG+VKKT  F     AVGYS C+FS 
Sbjct: 252 FVFA-PYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 310 VNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATER 369
           VNW+AIV+Q E+ F   +TKL +IISG          L+TFPL+HWAV+P++RLQKATE 
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 370 IAEGRGLRPPQPTVGS-SVSRNSSIKW--RNSLENHVRSSLGFNANKLSDS--GSIXXXX 424
           ++EGRGL+   P  GS +VSR+SSIK   R+++ +   S   F+ + LS +  G +    
Sbjct: 371 MSEGRGLKSTTP--GSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRG 428

Query: 425 XXXXXXXXX-------XXXXXHIYGNNNSSHSSMGIN---PDDDLSSSSQKYKTSANLIE 474
                                 +  N N+S  +  I+      DLS+ S+K  TSANLIE
Sbjct: 429 LTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIE 488

Query: 475 ARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAK 534
           ARVP Y RL  DELS+LTDTFN MTDALDQHY LLE+RVRARTKQLEAAKI+AE+ANEAK
Sbjct: 489 ARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAK 548

Query: 535 TVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSK 594
           T+FIANISHELRTPLNGILGMTAISMEE D+ KIR +LKLIFRSG            FSK
Sbjct: 549 TIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTFSK 608

Query: 595 NVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQ 654
           NVL+RT LEKRDFCIT+VALQIKSIFGK+AKDQ V+LSI+L+PNI+R+ +L+GDSNRIIQ
Sbjct: 609 NVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQ 668

Query: 655 VVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISH--LK 712
           +VMNLVSNALKFTPVDG V+VRI L+GEYDE  S+  ++KKV VK GTE     +   L 
Sbjct: 669 IVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAKAILG 728

Query: 713 TEENNDISRKSETELNNDEN-------------ETHTISKDDTADSSIKIGNEDVEISEV 759
             + +D    +E+ +   EN              T +  K           +     ++ 
Sbjct: 729 APKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEEDNSDNDNDD 788

Query: 760 DKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KLGVELKEQKTWVISVEVKDTGS 818
             M   S+V+TS+ SYDD     Q  K+ +L +DE+  LG+EL   KTWVI++EV+DTG 
Sbjct: 789 TSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGP 848

Query: 819 GIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIF 878
           GIDP LQ+SVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MMNGTMEL+SEVGVGS F F
Sbjct: 849 GIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTF 908

Query: 879 TLPLKQTREISI-PDDELFNDEFNAVSKKNR 908
           T+PL QTRE+ +  DD  F DEFN  S+KNR
Sbjct: 909 TVPLMQTRELELNEDDHPFEDEFNPASRKNR 939

 Score =  207 bits (527), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 101/169 (59%), Positives = 129/169 (76%), Gaps = 12/169 (7%)

Query: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018
            +V ++RPFLQSTGTATST+ + T+    D   K K         ILVAEDNHVNQEVIKR
Sbjct: 1015 TVNMDRPFLQSTGTATSTRTIQTV---PDAGKKFK---------ILVAEDNHVNQEVIKR 1062

Query: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078
            ML LEG+ NI+LARDGQDAF++ K + E   ++D+IFMDVQMP++DGL +TKMIR +L+Y
Sbjct: 1063 MLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHY 1122

Query: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
            T PIVAL+AF  + N+KECL+ GMN FLSKPIKRP +K IL++Y  ++Q
Sbjct: 1123 TYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/956 (55%), Positives = 661/956 (69%), Gaps = 58/956 (6%)

Query: 4   IPKKF-WKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQL 62
           +P K    PP+RI IR QLT                T GVYFT+NYKNL++ RLYIAAQL
Sbjct: 5   LPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 64

Query: 63  KASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFS 122
           K+SQIDQTLNYLYYQ YYL+S + LQ+SL SY AGN S+ NW +S  V++KFL+SS+LF 
Sbjct: 65  KSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFY 124

Query: 123 VARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSN 182
           VA++YD++FN ++NATNN +G+ +PE V+D LF LS +  LPSSLETIGI TDPVLN ++
Sbjct: 125 VAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTD 184

Query: 183 FLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSIT 242
           +LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE+S + +ISA Y+  
Sbjct: 185 YLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQ 244

Query: 243 TNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGY 302
                ++F+F      +D    + + I NDTF+ +   NGKGG++K+TN       A+GY
Sbjct: 245 GKASGYHFVFPPYGSRSDLPQKV-FSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGY 303

Query: 303 SSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIR 362
           S CSF+LVNW+AIV+QPE+ F   ATKL +II+G          LLT PL+HWAVQP++R
Sbjct: 304 SPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVR 363

Query: 363 LQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANKLSDSGSIX 421
           LQKATE I EGRGLRP  P    ++SR SS K   S    V SSL  FN  +   + S+ 
Sbjct: 364 LQKATELITEGRGLRPSTP---RTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 422 XXXXXXXXXXXXXXXXXHI-----YGNNNSS-----------HSSMGINPDDDL------ 459
                             +      GN   S           H+   I+ D  L      
Sbjct: 421 GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480

Query: 460 ------------SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYC 507
                       S+ S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQHY 
Sbjct: 481 PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 508 LLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDK 567
           LLEERVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE DV+K
Sbjct: 541 LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 568 IRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQ 627
           IR +LKLIFRSG            FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AKDQ
Sbjct: 601 IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 628 HVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEER 687
            V+LSI L PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD+E 
Sbjct: 661 RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720

Query: 688 SKAEDYKKVYVKQGTELPLNIS-----HLKTEENNDIS---RKSETELNNDENETHTISK 739
           S+ + YK+VY+K+GTE+  N+       L T  N+  S     S T L ++  +T TI +
Sbjct: 721 SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNR-DTSTIQE 779

Query: 740 DDTADSSIKIGNEDV--EISEVDKMG---MASLVTTSSKSYDDTALMKQLIKSTDLDDDE 794
           + T  ++  + NE +  ++++ +K     ++S+V+T++ SYD+     Q  K+   DD+E
Sbjct: 780 EITKRNT--VANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEE 837

Query: 795 -NKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSIC 853
              LG  ++  KTWVIS+EV+DTG GIDP LQESVF PFVQGDQ LSRQYGGTGLGLSIC
Sbjct: 838 GGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSIC 897

Query: 854 KQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNR 908
           +QL+ MM+GTM+LES+VGVGSKF FTLPL QT+EIS  D E  F DEFN  S+KNR
Sbjct: 898 RQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNR 953

 Score =  214 bits (546), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 129/169 (76%), Gaps = 9/169 (5%)

Query: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018
            SV L+RPFLQSTGTATS++N+PT+    DDK++  V        ILV EDNHVNQEVIKR
Sbjct: 1055 SVNLDRPFLQSTGTATSSRNIPTV--KDDDKNETSV-------KILVVEDNHVNQEVIKR 1105

Query: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078
            ML LEGI NI+LA DGQ+AFDK K L+    NY++IFMDVQMP++DGL +TKMIR +L Y
Sbjct: 1106 MLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1165

Query: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
            T PIVAL+AF  + N+KECL+ GMN FLSKPIKRP LK IL ++   +Q
Sbjct: 1166 TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1214

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1118 (45%), Positives = 690/1118 (61%), Gaps = 91/1118 (8%)

Query: 8    FWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQI 67
             WK PY++ +R QLT                + GVYFT NY++L+  +LYIAA+LK+SQI
Sbjct: 9    IWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQI 68

Query: 68   DQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLY 127
            DQT+N LYYQC +L+  + ++++L  Y+AGN S+ NW  +S VL  FL SS +F    LY
Sbjct: 69   DQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLY 128

Query: 128  DTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSM 187
            D+ FN+++N TNN + +Y+P+ V+  L  LS   SLPS L T G+ TDPVLN S +LMSM
Sbjct: 129  DSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSM 188

Query: 188  SLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEY 247
            SLPI ANPS+ LSDSR++GYL+V+MSAE +++V NDTTALE S V VIS+  +  T+ + 
Sbjct: 189  SLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQE 248

Query: 248  FNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSF 307
            ++F+F   +  +D   +  Y ++N TF+ +   + +GG++ K+      A A+GY  CSF
Sbjct: 249  YHFVFP-PHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSF 307

Query: 308  SLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKAT 367
             L NW+  V+QPE  F  S+ KL +II+G         C++TFPLS W+VQP++RLQKAT
Sbjct: 308  GLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKAT 367

Query: 368  ERIA--EGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSIXXXXX 425
            E I+  +G  +     +  S  + +S+ + ++   N    +L  +  K ++ G       
Sbjct: 368  EVISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEKYTEIGKA----- 422

Query: 426  XXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQ 485
                              N S+ S    N  D  SS+S       NL + +VP   R ++
Sbjct: 423  ------------------NKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVK 464

Query: 486  DELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHEL 545
            DELSELT+T+  MTDALD+H  LLE RV+ RTKQLEAAKI+AESANEAKTVFIAN++HEL
Sbjct: 465  DELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHEL 524

Query: 546  RTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKR 605
            RTPLNGILGMTAI+MEE D+++I+ +LKLI+RSG            FSKNVL++TKLEK 
Sbjct: 525  RTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKT 584

Query: 606  DFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALK 665
             FC+ ++ALQI+SIFGK++KDQHVKLSI ++PN LRS VLWGD NRI+QV+MNLVSNALK
Sbjct: 585  HFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALK 644

Query: 666  FTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSET 725
            FTPVDG + V I LLGEYD++RS AE+YK VY+K+               N D  +   T
Sbjct: 645  FTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMKE-----------IRNSNGDKIKPLMT 693

Query: 726  ELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLI 785
                       IS  DT             +S  D +   S+ + + +S ++T    +  
Sbjct: 694  ----------LISSKDT-------------MSVADNISNKSVASDTERSTNNTIYSNKFK 730

Query: 786  KSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGG 845
              ++  D ++ +GV L +++ WVISVEV+DTG GI+P LQ+SVFEPFVQGDQ LSRQYGG
Sbjct: 731  NGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGG 790

Query: 846  TGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVS 904
            TGLGLSIC+QL+ +M+GTM+LESEVGVGSKFIFT+PL QTREI    +EL F DEFN  S
Sbjct: 791  TGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINS 850

Query: 905  KKNRXXXXXXXXXXXXXXXXTRNSIGSSLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNR 964
            KKNR                  NS                          V P   +   
Sbjct: 851  KKNREVKFQEITDEVDQVNIEGNS-----------------------GVEVEPG--KCTE 885

Query: 965  PFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEG 1024
            P       +T +++   + + +  +  N +   +    +L+ EDN VNQ V+ RMLKLEG
Sbjct: 886  P-----KKSTESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEG 940

Query: 1025 INNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVA 1084
            I N  +A DGQ+A +K K +      Y ++ MD+QMP++DG+ ATK+IR+EL Y +PIVA
Sbjct: 941  IENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVA 1000

Query: 1085 LSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122
            L+AF  + N++ C   GM+ FL+KPIKR  LK IL ++
Sbjct: 1001 LTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/948 (55%), Positives = 649/948 (68%), Gaps = 57/948 (6%)

Query: 11  PPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQT 70
           PP+RI IRAQLT                T GVYFT+NYKNL++ RLYIAAQLK+SQ+DQT
Sbjct: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 71  LNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDTN 130
           LNYLYYQ YYL+S + LQ+SL SY AGN S  NW +S  V++KFL+SS+LF VAR+YD++
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 131 FNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSLP 190
           F  ++NATNN +G+ +PE V+D LF LS +I LPSSLET GI TDP++N +++LMSMSLP
Sbjct: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192

Query: 191 IFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFNF 250
           IFANPSIIL+DSR+YGY++++MSAEGLKSVFNDTTALE S V +ISA Y+       ++F
Sbjct: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252

Query: 251 LFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSLV 310
           +F   Y          + I+N+TF+ +   NGKGG++KKTN F     A+GYS CSF LV
Sbjct: 253 VFP-PYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLV 311

Query: 311 NWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATERI 370
           NW+A+V+QPE+ F   ATKL +II+G          LLT PL+HWAV+P++RLQKATE I
Sbjct: 312 NWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELI 371

Query: 371 AEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANK---------------- 413
            EGRGLRP  P    +VSR SS +   S      SSL  FN  +                
Sbjct: 372 TEGRGLRPSTP---RTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGSSGHG 428

Query: 414 ----LSDSGSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDL---------- 459
               LS   S+                   I  N+N    SM  + + DL          
Sbjct: 429 SGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPNSLRNND 488

Query: 460 ----SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRA 515
               SS S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQHY LLE+RVRA
Sbjct: 489 TDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRA 548

Query: 516 RTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLI 575
           RTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE DV+KIR NLKLI
Sbjct: 549 RTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLI 608

Query: 576 FRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIIL 635
           FRSG            FSKNVLQRTKLE+RDFCIT+VALQIKSIFGK+AKDQ V+LSI L
Sbjct: 609 FRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISL 668

Query: 636 MPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKK 695
            PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD++ S+   +K+
Sbjct: 669 FPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKE 728

Query: 696 VYVKQGTE------------LPLNISHLKTEENNDISRKSETELNNDENETHTISKDDT- 742
           V+VK+GTE            LP ++   K   N + +  S T   ++      I+K +T 
Sbjct: 729 VHVKKGTEITDVVESIDKRDLPTSLGRRKY-VNLESTTASITSCRDNSAIQEEITKRNTA 787

Query: 743 ADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KLGVEL 801
           A+ +I     D E S  D   ++S+V+T++ SYDD     Q  K+ D D DE+  +G  +
Sbjct: 788 ANENIYKKANDREKSSNDD--VSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPI 845

Query: 802 KEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMN 861
           +  KTWVIS+EV+DTG GI+P LQESVF+PFVQGDQ LSRQYGGTGLGLSIC+QL+ MM+
Sbjct: 846 ENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 905

Query: 862 GTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNR 908
           GTM+LES+VGVGSKF FTLPL QT+EIS  + E  F DEFN  SKKNR
Sbjct: 906 GTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNR 953

 Score =  209 bits (532), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/169 (59%), Positives = 125/169 (73%), Gaps = 9/169 (5%)

Query: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018
            SV ++RPFLQSTGTATS++NVPT+     D +          I ILV EDNHVNQEVI+R
Sbjct: 1056 SVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTS---------IKILVVEDNHVNQEVIRR 1106

Query: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078
            ML LEGI+NI+LA DGQ+AFDK K L+    NY++IFMDVQMP++DGL +TKMIR +L Y
Sbjct: 1107 MLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1166

Query: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
              PIVAL+AF  + N+KECL+ GMN FLSKPIKRP L  IL ++   +Q
Sbjct: 1167 KSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQ 1215

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/966 (54%), Positives = 656/966 (67%), Gaps = 73/966 (7%)

Query: 1   MQLIPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAA 60
           ++L  K  + PP+RI IRAQLT                T GVYFT+NYKNL++ RLYIAA
Sbjct: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120
           QLK+SQIDQTLNYLYYQ YYL+S + LQ+SL S+ AGN S+ NW +S  V++KFL+SS+L
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122

Query: 121 FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180
           F VA++YD++F  ++NATNN +G+ +PE V+D LF LS +  LPSSLET GI TDPV+N 
Sbjct: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182

Query: 181 SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240
           +++LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE S V +ISA Y+
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242

Query: 241 ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300
                  ++F+F   Y  A       + I N+TF+ +   NGKGG++K+TN F     A+
Sbjct: 243 NQGKASGYHFIFP-PYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301

Query: 301 GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPL 360
           GYS CSF LVNW+A+V+QPE+ F   ATKL +II+G          LLT PL+HWAVQP+
Sbjct: 302 GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361

Query: 361 IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANK------ 413
           +RLQKATE I EGRGLRP  P    +VSR SS K        V SSL  FN  +      
Sbjct: 362 VRLQKATELITEGRGLRPSTP---RTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTIS 418

Query: 414 --------------LSDSGSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDL 459
                          S   S+                   I  NN  +  SM  + + DL
Sbjct: 419 ASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDL 478

Query: 460 --------------SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQH 505
                         S+ S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQH
Sbjct: 479 LAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538

Query: 506 YCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDV 565
           Y LLE+RVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE DV
Sbjct: 539 YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 566 DKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAK 625
           +KIR +LKLIFRSG            FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AK
Sbjct: 599 NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658

Query: 626 DQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDE 685
           DQ V+LSI L PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD+
Sbjct: 659 DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718

Query: 686 ERSKAEDYKKVYVKQGTE------------LPLNISHLK----TEENNDISRKSETELNN 729
           + S+ + +K+V+VK+GTE            +P++ +H K          I+   +T +  
Sbjct: 719 DLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQ 778

Query: 730 DENETHTISKDDTADSSIKIGNEDV--EISEVDKM---GMASLVTTSSKSYDDTALMKQL 784
           +E     I+K +TA       NE++   +++ +K+    ++S+V+T++ SYDD     Q 
Sbjct: 779 EE-----ITKRNTA------ANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQF 827

Query: 785 IKSTDLDDDE-NKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQY 843
            K+   D+DE   LG  ++  KTWVIS+EV+DTG GIDP LQESVF PFVQGDQ LSRQY
Sbjct: 828 NKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQY 887

Query: 844 GGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPD-DELFNDEFNA 902
           GGTGLGLSIC+QL+ MMNGTM LES+VGVGSKF FTLPL QT+EIS  + D  F DEFN 
Sbjct: 888 GGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNP 947

Query: 903 VSKKNR 908
            S+KNR
Sbjct: 948 ESRKNR 953

 Score =  215 bits (547), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 9/169 (5%)

Query: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018
            SV L+RPFLQSTGTATS++NVPT+     D  KN        I ILV EDNHVNQEVIKR
Sbjct: 1056 SVNLDRPFLQSTGTATSSRNVPTI----QDNDKNDTS-----IKILVVEDNHVNQEVIKR 1106

Query: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078
            ML LEGI NI+LA DGQ+AFDK K L+   GNY++IFMDVQMP++DGL +TKMIR +L Y
Sbjct: 1107 MLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1166

Query: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
              PIVAL+AF  + N+KECL+ GMN FLSKPIKRP LK IL ++   +Q
Sbjct: 1167 KSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1215

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1143 (46%), Positives = 695/1143 (60%), Gaps = 89/1143 (7%)

Query: 10   KPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69
            KPP++  +R QLT                T GVYFT+NY+ L+  RL++AA+L +SQ+DQ
Sbjct: 14   KPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVDQ 73

Query: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129
            +L  LYYQC  LS+ +T+QN+L  Y AGN S+ NW E+  +L  FL  S  F +A LYD 
Sbjct: 74   SLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDE 133

Query: 130  NFNIMINATNNASGNYVPESVIDKLFTLSL-----NISLPSSLETIGICTDPVLNGSNFL 184
             +  +++  NN +   + E  + +L  L +     N +L   +ET+    +  LN    L
Sbjct: 134  MYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY--NKTLN----L 187

Query: 185  MSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTN 244
            MSM+LP+ A  S I+    + G+L+++MSA+ + +V NDT+ L  S V +++   +   N
Sbjct: 188  MSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGN 244

Query: 245  LEYFNFLFASAYDNADKDY-DLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAA----- 298
            L  + F+F       D+   +  Y I N +F+ +  +N     V  T+ F    A     
Sbjct: 245  LVKYRFVFPPG--ETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDF 302

Query: 299  ---AVGYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHW 355
               AVGYS+C F  ++W+A+V+Q E+ F   A KL +II G         C++TF L+ W
Sbjct: 303  KKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASW 362

Query: 356  AVQPLIRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNS-----------LENHVR 404
            AV+P++RLQKATE IA GRGLR    + G S S+N+SI   NS            E    
Sbjct: 363  AVKPIVRLQKATEFIAAGRGLRTYNHS-GRSSSQNTSIDRSNSRGSDHSLPRELFEKKHH 421

Query: 405  SSLGFNANKLSDSGSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQ 464
             S     N  ++SGS                   H     +   +S  I  D +  S+S 
Sbjct: 422  VSPFVTENHAANSGSCSSMSDHERYL--------HHIARYHDGETSTNILSDHEKGSTS- 472

Query: 465  KYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAK 524
                + N I+ RVPVY RL  DELSELTDTFNTMTD LD+ Y +LE+RVRARTKQLEAAK
Sbjct: 473  ----ATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAK 528

Query: 525  IQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXX 584
            IQAE+ANEAKTVFIANI HELRTPLNGILGMTAI+M E D +KI+ +LKLIFRSG     
Sbjct: 529  IQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLH 588

Query: 585  XXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYV 644
                   FSKNVL+RTKLE+R F I ++ALQ+KSIFGKLAKDQHVKLSI LMPN +R+ V
Sbjct: 589  ILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMV 648

Query: 645  LWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTEL 704
            LWGDSNRIIQ+VMNLVSNALKFTPVDG VDVRI L+GEYD  RS+A ++ +VY+  GTE+
Sbjct: 649  LWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEV 708

Query: 705  PLNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGM 764
                       N+ ++         ++      + DDT +   K   +   + + D + +
Sbjct: 709  ----------TNSSVNNIPTVVEEEEKACEEEPTADDTPERKKK---DSETVDDADAISI 755

Query: 765  ASLVTTSSKSYDDTALMKQLIK---STDLDDDENKLGV-ELKEQKTWVISVEVKDTGSGI 820
            +S V T   SYDD  L  QL K     DL+D +N + + +L++ ++WVI +EV+DTG GI
Sbjct: 756  SSSVAT---SYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGI 812

Query: 821  DPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTL 880
            +P L ESVF+PFVQGDQ LSRQYGGTGLGLSIC+QL+TMM GTM+LES+VG GSKF FT+
Sbjct: 813  EPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTV 872

Query: 881  PLKQTREISIPD-DELFNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSSLNNRHXX 939
            PL+QT  +   D D LF DEFN  SKKNR                  NS G+        
Sbjct: 873  PLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAG------S 926

Query: 940  XXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMD 999
                               SVR++RPFLQSTGTATST++VPTL++               
Sbjct: 927  IAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESS----------- 975

Query: 1000 LIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQ 1059
             + ILVAEDN+VNQEVIKRML LEG +NIDLA DG+DA+ K   L E   +YD+IFMDVQ
Sbjct: 976  -LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQ 1034

Query: 1060 MPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIIL 1119
            MPR+DGL  TK++R++L+Y  PIVAL+AF  + N+KECL+ GMN FL+KPIKRP LK IL
Sbjct: 1035 MPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKIL 1094

Query: 1120 KKY 1122
             ++
Sbjct: 1095 LEH 1097

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/898 (55%), Positives = 625/898 (69%), Gaps = 40/898 (4%)

Query: 6   KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
           ++F KPP+RI IRAQLT                T GVYFT+NYKNL++ RLYIAAQLK+S
Sbjct: 11  RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
           Q+DQ LNYLYYQCY+L+S +TLQN+L SY AGN +  NW ES+ V++KFL+SS+LF ++R
Sbjct: 71  QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
           +YD +F  ++N TNN +G+ VPES+ ++LF LS ++ LPSSL T G+ TDPVLNG+++LM
Sbjct: 131 VYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLM 190

Query: 186 SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245
           SMSLPIFANPSII SD ++YGY++V+MSAEGL+SVFNDTTALE S V ++SA YS  T +
Sbjct: 191 SMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI 250

Query: 246 EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305
           + + F+F   Y  +    +  + +D+ +F+       KGG++KKT  F     A+GY  C
Sbjct: 251 DSYRFVFP-PYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPC 309

Query: 306 SFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQK 365
           SF+ VNW+A+V+Q E+ F   +TKL +IISG          LLTFPL+ WAV+P++RLQK
Sbjct: 310 SFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQK 369

Query: 366 ATERIAEGRGLRPPQPTVGSSVSRNSSIKWR--NSLENHVRSSLG-FNANKLSDSGSIXX 422
           ATE IAEGRGLRP     GS     +S   +  N L    R SL   N     DS S   
Sbjct: 370 ATELIAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYDSAS--- 426

Query: 423 XXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWR 482
                            +  +  +S +S   + +D  SS S+   TS NL EAR+P Y R
Sbjct: 427 --------DSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRR 478

Query: 483 LLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANIS 542
           L  DELS+LT+TFN MTDALDQHY LLE+RVRARTKQLEAAKIQAE+ANEAKTVFIANIS
Sbjct: 479 LFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIS 538

Query: 543 HELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKL 602
           HELRTPLNGILGMTAISMEE D+ KIR +LKLIFRSG            FSKNVL+RT L
Sbjct: 539 HELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTAL 598

Query: 603 EKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSN 662
           EKR+FCIT+VALQIKSIFGK+AKDQHV+LSI L PN++R+ VLWGDSNRIIQ+VMNLVSN
Sbjct: 599 EKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSN 658

Query: 663 ALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTEL----PLN-------ISHL 711
           ALKFTPVDG V+VRI LLGEYDEE +KA+++K+++    ++     P++       + HL
Sbjct: 659 ALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHL 718

Query: 712 KTEENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTS 771
            T  +++ +     + N       T  +DD   S   I +            ++SLV++S
Sbjct: 719 STSSDSNSNLSDSDKYNE-----KTYDEDDDEHSITNISDH--------SDDLSSLVSSS 765

Query: 772 SKSYDDTALMKQLIKSTDLDDDENK-LGVELKEQKTWVISVEVKDTGSGIDPKLQESVFE 830
           + SYD+     Q  K+ DL +D N  LG EL +QKTWV ++EV+DTG GIDPKL ESVFE
Sbjct: 766 TSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFE 825

Query: 831 PFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREI 888
           PFVQGDQ LSRQYGGTGLGLSIC+QL+TMM+GTM+LES+VGVGSKF FT+PLKQTR I
Sbjct: 826 PFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVI 883

 Score =  213 bits (542), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 129/167 (77%), Gaps = 12/167 (7%)

Query: 960  VRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRM 1019
            V L+RPFLQSTGTATS++NVPT+    D   + K         ILVAEDNHVNQEVIKRM
Sbjct: 991  VHLDRPFLQSTGTATSSRNVPTM---ADVTMRFK---------ILVAEDNHVNQEVIKRM 1038

Query: 1020 LKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYT 1079
            L LEGINNIDLA DGQDAFDK + L E N +YD+IFMD+QMP++DGL +TKMIR +LNY 
Sbjct: 1039 LNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYK 1098

Query: 1080 QPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDF 1126
              IVAL+AF  + N+KEC++ GMN FLSKPIKRP LK+IL++Y  ++
Sbjct: 1099 GSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/957 (55%), Positives = 657/957 (68%), Gaps = 55/957 (5%)

Query: 1   MQLIPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAA 60
            +L  +  + PP+RISIRAQLT                T GVYFT+NYKNL++ RLYIAA
Sbjct: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120
           QLK+SQIDQTLNYLYYQ YYL+S + LQNSL  Y AGN SS NW +S  +++KFL+SS+L
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122

Query: 121 FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180
           F VA++YD++F  ++NATNN +G+ +P+ + D+LF LS +++LPSSLET GI TDP+LN 
Sbjct: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182

Query: 181 SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240
           +++LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE S V +ISA Y+
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242

Query: 241 ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300
             +    ++F+F   Y  +       + I N+TF+ +   NGKGG++KKTN F     A+
Sbjct: 243 NQSKAYAYHFVFP-PYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLAL 301

Query: 301 GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPL 360
           GYS CSF LVNW+A+V+QPE+ F   +TKL +II+G          LLT PL+HWAVQP+
Sbjct: 302 GYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361

Query: 361 IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANK------ 413
           +RLQKATE I EGRGLRP  P    +VSR SS K   S    V SSL  FN+ +      
Sbjct: 362 VRLQKATELITEGRGLRPSTP---RTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTS 418

Query: 414 --------------LSDSGSIXXXXXXXXXXXXXXXXXXHIYGNNNSSHSSMGINPDDDL 459
                         +S   S+                      ++N++  SM  + + DL
Sbjct: 419 ASGHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDL 478

Query: 460 --------------SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQH 505
                         SS S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQH
Sbjct: 479 LAPNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538

Query: 506 YCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDV 565
           Y LLE+RVRARTKQLEAAKI+AE+ANEAKTVFIANISHELRTPLNGILGMTAISMEE DV
Sbjct: 539 YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 566 DKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAK 625
           +KIR +LKLIFRSG            FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AK
Sbjct: 599 NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658

Query: 626 DQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDE 685
           DQ V+LSI L PN +R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG V+VR+ LLGEYD+
Sbjct: 659 DQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDK 718

Query: 686 ERSKAEDYKKVYVKQGTELPLNISHL-----KTEEN--NDISRKSETELNNDENETHTIS 738
           E S+ + +K+V+V++GTE+  +I ++     K  EN    +  +S T       +T TI 
Sbjct: 719 ELSEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQ 778

Query: 739 KDDT-----ADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDD 793
           ++ T     A+ +I     D E S  D   ++S+V+TS+ SYDD     Q  K+   DDD
Sbjct: 779 EEITKRNTAANENIYKKTRDREKSSNDD--ISSIVSTSTSSYDDAIFNSQFNKALGSDDD 836

Query: 794 E-NKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSI 852
           E   LG  ++  KTW IS+EV+DTG GIDP LQESVF PFVQGDQ LSRQYGGTGLGLSI
Sbjct: 837 EGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSI 896

Query: 853 CKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNR 908
           C+QL+ MM+GTM+LES+VGVGSKF FTLPL QT+EIS  +    F DEFN  S++NR
Sbjct: 897 CRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNR 953

 Score =  212 bits (540), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 128/169 (75%), Gaps = 9/169 (5%)

Query: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018
            SV L+RPFLQSTGTATS +N+PT++    DKS +        I ILV EDNHVNQEVIKR
Sbjct: 1056 SVNLDRPFLQSTGTATSNRNIPTVS--NSDKSDSS-------IKILVVEDNHVNQEVIKR 1106

Query: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078
            ML LEGI NI+LA DGQDAFDK K L+    +Y++IFMDVQMP++DGL +TKMIR +L Y
Sbjct: 1107 MLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1166

Query: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
            T PIVAL+AF  + N+KECL+ GMN FLSKPIKRP LK IL ++   +Q
Sbjct: 1167 TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/906 (47%), Positives = 586/906 (64%), Gaps = 44/906 (4%)

Query: 11  PPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKASQIDQT 70
           PPY +++RAQL                 + GVYFT NYK+L+  +L+IAAQLK+SQ+DQ+
Sbjct: 12  PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 71  LNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDTN 130
           LNYLYYQ  +    + L ++L+ Y +GN ++ NW ES   +  FLTSS +FS A +YDTN
Sbjct: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 131 FNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSLP 190
           F  + N +NN +G ++P+ +I +L  LS +  LP+S+ TIG  TDPVLN SN+LMS+SLP
Sbjct: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 191 IFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADY-SITTNLEYFN 249
           IF NPSIILSDSR+YGY+++I  A  + +VFNDTTALENS V +ISA Y + TT  + ++
Sbjct: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 250 FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309
           F+F   Y +     D+ Y + N++F+++       G+V  T  F  +  AVGYS+C+FSL
Sbjct: 252 FVFP-PYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSL 310

Query: 310 VNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQKATER 369
            NW+A+V+QPE+ F+ S  KL +IISG         C +TF +S++ V+P+I+L++ATE 
Sbjct: 311 ANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATEL 370

Query: 370 IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANKLSDSGSIXXXXXXXX 428
           I+ GRGLRP    +    S++++   R +++    S L G+   K     S+        
Sbjct: 371 ISRGRGLRPYYENLSDRTSQDNT-STRTTID---LSDLDGYTNEK---EKSLPTCTEDER 423

Query: 429 XXXXXXXXXXHIYGN-----NNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRL 483
                      I+         SS S M       LS +S  +  + +    RVPV+   
Sbjct: 424 SKSLSNIASKSIFTTLRKILGFSSRSGM-------LSPTSTNFIVNNDTKTVRVPVHSTY 476

Query: 484 LQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISH 543
           + DEL+EL +TFN M D+LD+H  LLEERV+ARTK+LEAAKI AE+ NEAKTVFIANISH
Sbjct: 477 ITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISH 536

Query: 544 ELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLE 603
           ELRTPLNGILGMTAI++EEDD +K++G+LKLI+RSG            FSKNVLQ+TKLE
Sbjct: 537 ELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLE 596

Query: 604 KRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNA 663
           K  FCI ++ALQIKSIFGK+AKDQ V  SI++ PN++R+ V +GDSNRIIQV+MNLVSNA
Sbjct: 597 KIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNA 656

Query: 664 LKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKS 723
           LKFTP+DGNVDVRI LLGEYDEE+S   +Y KVY+K+GT    +   + TE    IS K 
Sbjct: 657 LKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEP---ISDKI 713

Query: 724 ETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQ 783
                +     +    D+  +   +I ++D  IS+                Y +  +M  
Sbjct: 714 SFAGGSSSIHDYCSKTDENDNIKTEIKSDDSTISD----------------YSEENIMGS 757

Query: 784 LIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQY 843
             ++   +  +  LGV + + K WVISV+V+DTG GI P LQ+SVFEPFVQGDQ LSRQY
Sbjct: 758 YYENK--NPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQY 815

Query: 844 GGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDE-LFNDEFNA 902
           GGTGLGLSIC+QL+++M+GTMEL+S  G+GSKF FT+PL Q R+I   + E  F DEFN 
Sbjct: 816 GGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNF 875

Query: 903 VSKKNR 908
            SKKNR
Sbjct: 876 NSKKNR 881

 Score =  143 bits (360), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 69/120 (57%), Positives = 87/120 (72%)

Query: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062
            +L+ EDN VNQEVIKR+LKLE I  I+ A DGQ+A D  K        +DIIFMD+QMP 
Sbjct: 942  VLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPN 1001

Query: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122
            +DG  AT++IR ELNY  PIVAL+AF  + N KEC + GMN FL+KPIKR +LK I+K++
Sbjct: 1002 VDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/730 (56%), Positives = 492/730 (67%), Gaps = 72/730 (9%)

Query: 470  ANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAES 529
            + ++E +VPVY RL  DELSELTDTFNTM+DALDQHY LLEERVRARTKQLEAAKI+AE+
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 530  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXX 589
            ANEAKTVFIANISHELRTPLNGILGMTAISMEEDD+D I+ +LKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 590  XXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDS 649
              FSKNVLQRTKLE+RDFCIT+VALQIKSIFGK+AKDQHVKLSI L+PN +R+ VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 650  NRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNIS 709
            NRIIQ+VMNLVSNALKFTP+DG V VR++LLGEYD+E+SKA DYK+V+VK GTE   N S
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 710  HLKTEENND--ISRKSETELNNDENETHTIS-KDDTADSSIKIGNE--DVEISEVDKMGM 764
             +  + N +  I+ +S    +N+E     I  K+D   ++ +  N   D+ I    +   
Sbjct: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDT 771

Query: 765  ASLVTTSSKSYDDTALMKQLIKSTDLDD-DENKLGVELKEQKTWVISVEVKDTGSGIDPK 823
             SL++TS+ SYD+T    Q  K T L D DE +LGVE+KE KTWVI +EV+DTG GI P 
Sbjct: 772  LSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPA 831

Query: 824  LQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLK 883
            LQESVFEPFVQGDQALSRQYGGTGLGLSIC+QL+TMMNGTM LES+VG GSKF FT+PL 
Sbjct: 832  LQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLT 891

Query: 884  QTREISIPDD----ELFNDEFNAVSKKNRXXX----XXXXXXXXXXXXXTRNSIGS---- 931
            QTREI I +D    E F+DEFN  SKKNR                    +R S GS    
Sbjct: 892  QTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLNSS 951

Query: 932  --------------SLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQ 977
                          + N++                 +   S   L+RPFLQSTGTATST 
Sbjct: 952  FVGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTM 1011

Query: 978  NVPTLNAHTDDKSKNKVLN---KMDL--------------------------------IY 1002
             +P L   ++  +K+ V N   K DL                                I 
Sbjct: 1012 KIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIR 1071

Query: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLS-----ENNGNYDIIFMD 1057
            ILV EDNHVNQEVIKRMLKLE ++NIDLA DG++A+ K K ++     +    YD+IFMD
Sbjct: 1072 ILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMD 1131

Query: 1058 VQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKI 1117
            VQMPR+DGL +TK+IR EL YT+PIVAL+AF  E N+KECLDVGM+ FLSKPIKRP LK 
Sbjct: 1132 VQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKD 1191

Query: 1118 ILKKYIEDFQ 1127
            IL ++   + 
Sbjct: 1192 ILNEFCPGYH 1201

 Score =  419 bits (1077), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/391 (51%), Positives = 276/391 (70%), Gaps = 5/391 (1%)

Query: 6   KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
           +   +PP  I IR QLT                  G+YFT NYK+++  RL IAA+LK+S
Sbjct: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67

Query: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
           Q+DQTLN+LYYQCY+LS  +TLQ ++ +Y AGN SS+ WY+S +V+EKFL+SSD+FS++R
Sbjct: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127

Query: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
           LYD NFN+++NATNN +GN VP  V+ KL  LS +  LP+SL + G+ TDPVLN + +LM
Sbjct: 128 LYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLM 187

Query: 186 SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS-ITTN 244
           SMSLPI ANPSIIL+DS++YGY+++IMSAE L SV+NDTTALE S V ++S +YS  + +
Sbjct: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247

Query: 245 LEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSS 304
           L  ++F+F   Y    K  D++Y + N +F+Y+ + N K G++ KT  F     A+GYS 
Sbjct: 248 LTEYHFVFP-PYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSP 306

Query: 305 CSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQ 364
           CSF LV+W+AIV+QPE+ F   +TKL RII+G         C +TFPLSHWAV+P++RLQ
Sbjct: 307 CSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQ 366

Query: 365 KATERIAEGRGLRPPQPTVGSSVSRNSSIKW 395
           KATE IAEGRGLR    +   ++SRN S+K+
Sbjct: 367 KATELIAEGRGLR---SSSNRTLSRNGSLKF 394

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/704 (53%), Positives = 480/704 (68%), Gaps = 38/704 (5%)

Query: 6   KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
           K+  KPP+ ISIR QLT                  GVYFT+++K+++  RLY+A+QLKAS
Sbjct: 14  KRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKAS 73

Query: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
           QIDQ L YLYYQCYYLS+ + LQN+L  Y AGN ++ NW ++   L+KFL SS+LFS+AR
Sbjct: 74  QIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133

Query: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185
           +YD++F  ++NA+NNASGN VPESV+ +LF LS N+SLPSSLE  G+ TDPVLN + +LM
Sbjct: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193

Query: 186 SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245
           SMSLPIFANPSIILS S++YGY++V++SAEGLK+VFNDTTALE+S V ++S  Y     L
Sbjct: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252

Query: 246 EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305
             ++ +F   Y       D  Y I ND+F+ +     KGG++K T+     A A+GYS C
Sbjct: 253 AGYHLVFP-PYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311

Query: 306 SFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRLQK 365
           S  LV W+AI+ QPE+ F   +T+L RII G         C +TFPLSHWAVQP++RLQK
Sbjct: 312 SSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQK 371

Query: 366 ATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL------GFNANKLSDSGS 419
           ATE I  GRGLR          S N S     +L +H RSS         +   +  SGS
Sbjct: 372 ATEIITAGRGLR----------SDNGS-----TLYSHKRSSTAESFSSALHPASIRRSGS 416

Query: 420 IXXXXXXXXXXXXXXXXXXH----------IYGNNNSS----HS-SMGINPDDDLSSSSQ 464
           +                             I  N +++    HS + G    +  S+ S+
Sbjct: 417 VARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSE 476

Query: 465 KYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAK 524
           +Y TS NLIEARVP Y RL  DELSELT+TFNTMTD LD+HY LLE+RVRART+QLEAAK
Sbjct: 477 RYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAK 536

Query: 525 IQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXX 584
           I+AE ANEAKTVFIANISHELRTPLNGILGMTAI+M E+D+ K++ +LKLIFRSG     
Sbjct: 537 IEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLH 596

Query: 585 XXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYV 644
                  FSKNVL+RTKLE+RDF + E+ALQ++SIFGKLAKDQHV L+I ++PN+LR+ V
Sbjct: 597 IMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMV 656

Query: 645 LWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERS 688
           LWGDSNRI+Q+VMNLVSNALKFTPVDG V+V+  LLGEYDE ++
Sbjct: 657 LWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKA 700

 Score =  348 bits (893), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 239/362 (66%), Gaps = 28/362 (7%)

Query: 766  SLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQ 825
            S+ + ++ SYDD     +L K    +  EN+ G  L+  +   I++EV+DTG GI+P LQ
Sbjct: 828  SIESENASSYDDAIFHSRLRKG---NSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQ 884

Query: 826  ESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQT 885
            ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MMNG+M L+S+VGVGSKF FT+PL QT
Sbjct: 885  ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQT 944

Query: 886  REISIPDDE-LFNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSSLNNRHXXXXXXX 944
            +E+   +DE  F DEFN  SKKNR                ++N+     ++         
Sbjct: 945  KELCFEEDENPFEDEFNPDSKKNRKVKFKV----------SKNNK-RKKSHSSSSGQNSS 993

Query: 945  XXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYIL 1004
                      V   SVR++RPFLQSTGTA ST++V T            V NK     +L
Sbjct: 994  VGTPTVSESEVSVGSVRVDRPFLQSTGTALSTRSVTT----------TSVANKCK---VL 1040

Query: 1005 VAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLD 1064
            VAEDN+VNQEVIKRML LEG++++DLA DGQDAFDK K  +E    YD+IFMDVQMPR+D
Sbjct: 1041 VAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVD 1100

Query: 1065 GLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
            GL+AT+MIR EL+YT PIVAL+A+  + N+KEC+D GMN FL+KPI+RP +K IL +Y  
Sbjct: 1101 GLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCP 1160

Query: 1125 DF 1126
             +
Sbjct: 1161 TY 1162

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/678 (54%), Positives = 462/678 (68%), Gaps = 41/678 (6%)

Query: 450  SMGIN-PDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCL 508
            ++GI  P    S     + TSAN IE RVPVY RL  DELSELTDTFN+MTD LD+HY L
Sbjct: 458  AIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYAL 517

Query: 509  LEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKI 568
            LE+RVRARTKQLEAAKIQAESANEAKT+FIANISHELRTPLNGILGMTAI+M E+D++K+
Sbjct: 518  LEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKV 577

Query: 569  RGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQH 628
            + +LKLIFRSG            FSKN+L+R KLE+R+F + +VALQ+KSIFGKLAKDQ+
Sbjct: 578  QNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQN 637

Query: 629  VKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERS 688
            VK SI LMPN++R  VLWGDSNRIIQ+VMNLVSNALKFTPVDG V +RI LLGEYDEE S
Sbjct: 638  VKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEES 697

Query: 689  KAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSSIK 748
            +  +  +V++KQGTE               IS +++   +    E +     ++ D +I+
Sbjct: 698  EKCNNAEVFIKQGTE---------------ISDETKNVFDTITEEKYVSCSGESTDDTIE 742

Query: 749  IGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIK-STDLDDDENKLGV--ELKEQK 805
             G E  +  + DK    S+V++ + SYDD     +  K    LD DE  L    + +++K
Sbjct: 743  TGQEGAQ--KPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKK 800

Query: 806  TWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTME 865
             WVIS+EV+DTG GIDP LQESVF+PFVQGDQ LSRQYGGTGLGLSIC+QLSTMM GTM+
Sbjct: 801  VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860

Query: 866  LESEVGVGSKFIFTLPLKQTREI-SIPDDELFNDEFNAVSKKNRXXXXXXXXXXXXXXXX 924
            L SEVGVGSKFIFT+PL+QT  +  + D++LF DEFNA SK NR                
Sbjct: 861  LHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSS 920

Query: 925  TRNSIGSSLNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNA 984
                  S + +                   V       +RPFLQSTGTATST+++PT+ +
Sbjct: 921  LSVPEISGVPDSPLNSMGRSESELSVSSVRV-------DRPFLQSTGTATSTRSIPTVGS 973

Query: 985  HTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKML 1044
               +              +LVAEDN+VNQEVIKRML+LEGI +I+LA DG++A +K   L
Sbjct: 974  LESN------------FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANL 1021

Query: 1045 SENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMND 1104
            +    +Y+I+FMDVQMP++DGL AT+ IR+ELNYT PIVAL+AF  + N+K CL+ GM+ 
Sbjct: 1022 TNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDG 1081

Query: 1105 FLSKPIKRPDLKIILKKY 1122
            FLSKPIKR  L+ IL +Y
Sbjct: 1082 FLSKPIKREKLRKILLEY 1099

 Score =  294 bits (753), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 230/373 (61%)

Query: 4   IPKKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLK 63
           I K  ++PPY+  +  QLT                T GVYFT NYK+L+  RL +AAQL 
Sbjct: 18  IRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLT 77

Query: 64  ASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSV 123
           ++QI+QTLN +YYQCY+LSS +++QN+LVSY  GN SS N   +  VL KFL SS+    
Sbjct: 78  SAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFR 137

Query: 124 ARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNF 183
             LYD+ FN +++ + N++GN + + ++  L  LS N  LPSS+   G+ ++PV NGS+F
Sbjct: 138 THLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSF 197

Query: 184 LMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITT 243
            MSMSLP+ A  SI+   S   GY++++MSA+ + SV     AL  S V V++  Y    
Sbjct: 198 FMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENN 257

Query: 244 NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYS 303
            L  +  LF  +     +  ++ + I N++F+YN  VN   G+V KTN F     AVGY+
Sbjct: 258 ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYA 317

Query: 304 SCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLIRL 363
           +CSF LVNW+A+VAQ EA F   +TKL +II G         C++TF +++WAV+P++RL
Sbjct: 318 ACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRL 377

Query: 364 QKATERIAEGRGL 376
           QKATE IA GRGL
Sbjct: 378 QKATELIAAGRGL 390

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  559 bits (1440), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/486 (62%), Positives = 350/486 (72%), Gaps = 28/486 (5%)

Query: 449 SSMGINPDD-DLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYC 507
           SS+G+  D  + S+ S    TSANLIEARVP Y RL  DELS+LTDTFNTMTDALDQHY 
Sbjct: 502 SSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYA 561

Query: 508 LLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDK 567
           LLE+RVRARTKQLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAISMEE D+ K
Sbjct: 562 LLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISK 621

Query: 568 IRGNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQ 627
           IR +LKLIFRSG            FSKNVL+RT LEKRDFCIT+VALQIKSIFGK+AKDQ
Sbjct: 622 IRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQ 681

Query: 628 HVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEER 687
            VKLSI L PN +R+ VL+GDSNRIIQ+VMNLVSNALKFTPVDG V+V++ L+GEYDE  
Sbjct: 682 RVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEAL 741

Query: 688 SKAEDYKKVYVKQGTEL-----PL-----NISHLKTEENNDISRKSETELNNDENETH-T 736
           S   ++K+VYVKQGTEL     P+     +I   K+E NN  S  S  +  N E      
Sbjct: 742 SAKNNFKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDE 801

Query: 737 ISKDDTADSSIKIGNEDVEISEVDK-----------MGMASLVTTSSKSYDDTALMKQLI 785
            S DD  D   KI  +D E    D                SLV+TS+ SYDD     Q  
Sbjct: 802 KSADDLDDE--KIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFK 859

Query: 786 KSTDL-DDDENK-LGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQY 843
           KS  L DDDEN   GV +++ KTWVI + V+DTG GID  LQESVF+PFVQGDQ LSRQY
Sbjct: 860 KSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQY 919

Query: 844 GGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNA 902
           GGTGLGLSIC+QL+ MM+GTM+L+SEVGVGS F FT+PLKQTREI+  D E  F DEFN 
Sbjct: 920 GGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNP 979

Query: 903 VSKKNR 908
            S+KNR
Sbjct: 980 ESRKNR 985

 Score =  444 bits (1141), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 290/404 (71%), Gaps = 7/404 (1%)

Query: 4   IPKKF-WKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQL 62
           IP KF  KPP+RI IRAQLT                T GVYFTANYKNL++ RLYIAAQL
Sbjct: 3   IPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQL 62

Query: 63  KASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFS 122
           K+SQIDQTLNYLYYQCYY+SS +TLQ +L +Y AGN S+ NW +S+ +L+KFL+SS+LFS
Sbjct: 63  KSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFS 122

Query: 123 VARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSN 182
           VA++YD +F  ++N TNN +G+ +P+S++ KL  LS NI L SSLET GI TDPVLN S 
Sbjct: 123 VAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSST 182

Query: 183 FLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSIT 242
           +LMSMSLPIFANPS+IL++SR+YGYL+V+MSAEGL++VFNDTTALE S V ++SA Y+  
Sbjct: 183 YLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNV 242

Query: 243 TNLEYFNFLFASAYDNADKDYDLH--YRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300
           + L  + F+FA         Y ++  YR+ N +F+ + L  GKGG++K T  F     A+
Sbjct: 243 SALTAYRFVFAPM---GAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAI 299

Query: 301 GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPL 360
           GYS C+FS VNW+A+V+Q E+ F   +TKL +II+G          ++TFPL+HWAV+P+
Sbjct: 300 GYSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPI 359

Query: 361 IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVR 404
           +RLQKATE I+EGRGL+   P    SVSRN+S+K  +   +H R
Sbjct: 360 VRLQKATELISEGRGLKSTNPD-SRSVSRNNSLKLPSRNTSHYR 402

 Score =  219 bits (559), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 131/168 (77%), Gaps = 6/168 (3%)

Query: 960  VRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRM 1019
            V L+RPFLQSTGTATS++NVP L+    D+      +    I ILVAEDNHVNQEVIKRM
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDE------DPAQNIKILVAEDNHVNQEVIKRM 1147

Query: 1020 LKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYT 1079
            L LEG+N IDLA DGQ+AFDK K LSE N +Y+IIFMDVQMP++DGL +TKMIR++L+Y 
Sbjct: 1148 LNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYD 1207

Query: 1080 QPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127
             PIVAL+AF  + N+KECL+ GMN FLSKPIKRP L+ I+K+Y   ++
Sbjct: 1208 HPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  522 bits (1345), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 316/674 (46%), Positives = 417/674 (61%), Gaps = 36/674 (5%)

Query: 474  EARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEA 533
            E +VPVY +L  DEL+ELTDTFN M++ALD+HY LLE+RV  RTKQLEAAK+QAE+ANEA
Sbjct: 482  EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 534  KTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGXXXXXXXXXXXXFS 593
            KTVFIANISHELRTPLNGILGMT+ S+EE+D+ KI+  LKLIFRSG            FS
Sbjct: 542  KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 594  KNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMP-NILRSYVLWGDSNRI 652
            KNVL +TKLE R+F I E+  QIK+IF KL + Q VKL I L+P   L+S + +GDSNRI
Sbjct: 602  KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 653  IQVVMNLVSNALKFTP-VDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHL 711
            +QV+MNL+SNA+KFTP V+G V+V + LLGEYDEE SK E+Y KV +K  T++      L
Sbjct: 662  LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

Query: 712  -KTEENNDISRK----------SETELNNDENE-----THTISKDDTADSSIKIGNEDVE 755
             K++    I++           +   + ++ N+     +HT ++  T   +    N +V 
Sbjct: 722  IKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSNV- 780

Query: 756  ISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKD 815
             S V+     SL + SSK YD+    + + +  D D ++ K   +++  K WVI  EV D
Sbjct: 781  -STVNNS-SISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVID 838

Query: 816  TGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSK 875
             G GID  L +SVF+PFVQGDQ LSRQYGGTGLGLSICKQL  MM GT+ELESE+G GSK
Sbjct: 839  NGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSK 898

Query: 876  FIFTLPLKQ---TREISIPDDELFNDEFNAVSKKNRXXXXXXXXXXXXXXXXTRNSIGSS 932
            FI+T+PL Q   T++ +  ++E  ND  N+    +                   NS+ S+
Sbjct: 899  FIYTIPLLQVGGTKKDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSDLNSLQSN 958

Query: 933  LNNRHXXXXXXXXXXXXXXXXNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKN 992
              N                      +   L++  LQ   T    Q V        D    
Sbjct: 959  STNEVGLDDSFSEAENDS-------TVASLDKSVLQK--TRMDAQKVEANEIDDIDHCNK 1009

Query: 993  KVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYD 1052
             + +K+    +LVAEDN VNQEVIKRMLKLE I++I+LA DG +AF+K K    +   YD
Sbjct: 1010 GIPSKLK---VLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYD 1066

Query: 1053 IIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKR 1112
            IIFMD+QMP++DGL +T  IR+EL Y   IVAL+AF  E N+KEC D GM+ F+ KPIKR
Sbjct: 1067 IIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKR 1126

Query: 1113 PDLKIILKKYIEDF 1126
              L  +L+++ +D 
Sbjct: 1127 VALHTLLEEFQQDL 1140

 Score =  308 bits (788), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 227/376 (60%), Gaps = 5/376 (1%)

Query: 6   KKFWKPPYRISIRAQLTXXXXXXXXXXXXXXXXTAGVYFTANYKNLKTGRLYIAAQLKAS 65
           K+  KPPYR S+RAQLT                  GVYFT +YK+L   RLYIA+QLK+S
Sbjct: 14  KQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSS 73

Query: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125
           QIDQTLNYLYYQCY+++S  T+Q  + S   G  +++   ES  VL+KF+ +SDLF    
Sbjct: 74  QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133

Query: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTL-SLNISLPSSLETIGICTDPVLNGSNFL 184
           +YD N   ++N+TNN SG+ V  S++ +L  L S N ++P  +   GI TDP+LN + +L
Sbjct: 134 IYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYL 193

Query: 185 MSMSLPI---FANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSI 241
           MSMSLPI   ++  + I + S IYGYL+V+MSAE LKSVFNDT  L +S   ++SA Y+ 
Sbjct: 194 MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253

Query: 242 TTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVG 301
            T   YF+F+F   +D  D   D    I N TF Y      K G+ KK         A+G
Sbjct: 254 DTLPRYFHFVFP-PFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIG 312

Query: 302 YSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGXXXXXXXXXCLLTFPLSHWAVQPLI 361
           Y+  +F L  W+A+VA P+  F   + KL +II G          L++ PLS+WAVQP++
Sbjct: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372

Query: 362 RLQKATERIAEGRGLR 377
           RLQ+A+E I + RGLR
Sbjct: 373 RLQRASELITKRRGLR 388

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 85/162 (52%), Gaps = 8/162 (4%)

Query: 964  RPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLE 1023
            +P +   GT   T ++P   A    +  N   +     ++L+ ED+ V  ++  + L+  
Sbjct: 282  QPHVSPLGTVAPT-SIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLRKY 340

Query: 1024 GINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIV 1083
            G + +++  DG  A +  +        YD++ MD+ MP LDG  AT +IR   N T PI+
Sbjct: 341  GCS-VEVVTDGLSAIETVEKF-----QYDLVLMDIVMPNLDGATATSVIRSFDNQT-PII 393

Query: 1084 ALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
            A++   +++++   L  GMND L+KP  + DL  +L +Y++D
Sbjct: 394  AMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYLKD 435

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (51%), Gaps = 13/158 (8%)

Query: 973  ATST-----QNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINN 1027
            ATST      N+P  N+ T +   N V  +    ++L+ ED+ V+ ++  + L+  G   
Sbjct: 345  ATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGF-HVLLVEDDAVSIQLCSKFLRKYGCT- 402

Query: 1028 IDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSA 1087
            + +  DG  A    +        YD++ MD+ MP LDG  AT ++R   N T PI+A++ 
Sbjct: 403  VQVVSDGLSAISTLEKYR-----YDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTG 456

Query: 1088 FPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
                +++   L  GMND L+KP  R DL  IL +Y++D
Sbjct: 457  NIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKD 494

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 78/148 (52%), Gaps = 8/148 (5%)

Query: 978  NVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDA 1037
            N+P  N+ T +   N V  +    ++L+ ED+ V+ ++  + L+  G   + +  DG  A
Sbjct: 356  NLPDENSLTPNAQGNAVTLRKGF-HVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSA 413

Query: 1038 FDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKEC 1097
                +        YD++ MD+ MP LDG  AT ++R   N T PI+A++     +++   
Sbjct: 414  ISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITY 467

Query: 1098 LDVGMNDFLSKPIKRPDLKIILKKYIED 1125
            L  GMND L+KP  R DL  IL +Y++D
Sbjct: 468  LQHGMNDILAKPFTRDDLHSILIRYLKD 495

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 71/125 (56%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ ++ ++  + L+  G   +++  DG  A    +        YD++ MD+ M
Sbjct: 353  FHVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMDIVM 406

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT +IR   N T PI+A++   +++++   L  GMND L+KP  R DL  +L 
Sbjct: 407  PNLDGATATSIIRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 466  RYLKD 470

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 11/160 (6%)

Query: 969  STGTATSTQNVPTL---NAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGI 1025
            S  T+T +  +P+L   N+ T +   N V  +    ++L+ ED+ V+ ++  + L+  G 
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGF-HVLLVEDDVVSIQLCSKFLRKYGC 403

Query: 1026 NNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVAL 1085
              + +  DG  A    +        YD++ MD+ MP LDG  AT ++R   N T PI+A+
Sbjct: 404  T-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRSFDNET-PIIAM 456

Query: 1086 SAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
            +     +++   L  GMND L+KP  R DL  IL +Y++D
Sbjct: 457  TGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKD 496

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V+ ++  + L+  G   + +  DG  A    +        YD++ MD+ M
Sbjct: 379  FHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   N T PI+A++     +++   L  GMND L+KP  R DL  IL 
Sbjct: 433  PNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 492  RYLKD 496

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 71/123 (57%), Gaps = 7/123 (5%)

Query: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062
            +L+ ED+ V  ++  + L+  G + +++  DG  A +  +        YD++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPN 384

Query: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122
            LDG  AT +IR   N T PI+A++   +++++   L  GMND L+KP  + DL  +L +Y
Sbjct: 385  LDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1123 IED 1125
            ++D
Sbjct: 444  LKD 446

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 71/125 (56%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V  ++  + L+  G   +++  DG  A    +        YD++ MD+ M
Sbjct: 334  FHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 387

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   N+T PI+A++   +++++   L  GMND L+KP  + DL  +L 
Sbjct: 388  PNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 446

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 447  RYLKD 451

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V  ++  + L+  G   + +  DG  A    +     N  +D++ MD+ M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLE-----NHRFDLVLMDIVM 469

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   NYT PI+A++   +++++   L  GMND L+KP  + DL  +L 
Sbjct: 470  PNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1121 KYIED 1125
            +Y+ D
Sbjct: 529  RYLRD 533

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 10/134 (7%)

Query: 995  LNKMDL---IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNY 1051
            LN ++L    ++L+ ED+ ++ ++  + L+  G   + +  DG  A    +     N  Y
Sbjct: 394  LNNVELRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRY 447

Query: 1052 DIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIK 1111
            D++ MD+ MP LDG  AT +IR   N T PI+A++    + ++   L  GMND L+KP  
Sbjct: 448  DLVLMDIVMPNLDGATATSIIRSFDNQT-PIIAMTGNIDDGDLITYLQHGMNDILAKPFT 506

Query: 1112 RPDLKIILKKYIED 1125
            R DL  +L +Y++D
Sbjct: 507  RDDLHSMLIRYLKD 520

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 77/140 (55%), Gaps = 9/140 (6%)

Query: 986  TDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLS 1045
            T +  +N VL K    ++L+ ED+ V+ ++  + L+  G   + +  DG  A    +   
Sbjct: 392  TKEVDQNIVLRKG--FHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKFR 448

Query: 1046 ENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDF 1105
                 YD++ MD+ MP LDG  AT ++R   N T PI+A++   +++++   L  GMND 
Sbjct: 449  -----YDLVLMDIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDI 502

Query: 1106 LSKPIKRPDLKIILKKYIED 1125
            L+KP  R DL  IL ++++D
Sbjct: 503  LAKPFTRNDLHSILIRHLKD 522

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V+  +  + L+  G   +++  DG  A    +        YD++ MD+ M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 434

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT +IR   N T PI+A++   +++++   L  GMND L+KP  + DL  +L 
Sbjct: 435  PNLDGATATSIIRNFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 494  RYLKD 498

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 71/125 (56%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V  ++  + L   G + +++  DG  A    +        YD++ MD+ M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKFR-----YDLVLMDIVM 360

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   N T PI+A++   +++++   L+ GMND L+KP  + DL  +L 
Sbjct: 361  PNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 420  RYLKD 424

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V+ ++  + L+  G   + +  DG  A    +        +D++ MD+ M
Sbjct: 382  FHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKFR-----FDLVLMDIVM 435

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT +IR   N T PI+A++   + +++   L  GMND L+KP  R DL  IL 
Sbjct: 436  PNLDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILI 494

Query: 1121 KYIED 1125
            +Y++D
Sbjct: 495  RYLKD 499

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 80/163 (49%), Gaps = 37/163 (22%)

Query: 976  TQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQ 1035
            T   P        ++++KV  K++   +L+ EDN +NQ ++   LK   I+  ++A++G 
Sbjct: 527  TDGSPNYRPSPIKRTRDKVFPKIN---VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGA 582

Query: 1036 DAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIR--EELN---------------- 1077
            +A +K +      G   +I MD+Q+P L GL ATK IR  E+LN                
Sbjct: 583  EAVEKWRQ-----GGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDT 637

Query: 1078 --------YTQP--IVALSAFPKEENVKECLDVGMNDFLSKPI 1110
                    +  P  IVAL+AF    + +E L  G ND+L+KP+
Sbjct: 638  SLDLDRSKFRSPVIIVALTAFSSHADRREALVAGCNDYLTKPV 680

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 16/170 (9%)

Query: 964  RPFLQSTGTATSTQNVPTLNAHTDDKSKNKV-LNKMDL-------IYILVAEDNHVNQEV 1015
            R    STG +T   N+P L+ +T  + +  + L  MD         ++L+ ED+ V  ++
Sbjct: 285  RQISDSTG-STPNANIPGLSVNTTLQKQEPIELLPMDQHPVLRPGFHVLLVEDDSVCIQL 343

Query: 1016 IKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREE 1075
              + L+  G + +++  DG  A    +        +D++ MD+ MP LDG  AT ++R  
Sbjct: 344  CSKFLRKYGCS-VEVVTDGLSAISTLE-----KQRFDLVLMDIVMPNLDGATATSIVRSF 397

Query: 1076 LNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
             N T PI+A++    ++++   L  GMND L+KP  + DL  +L +Y++D
Sbjct: 398  DNET-PIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYLKD 446

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 68/125 (54%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ V  ++  + L+  G   +++  DG  A    +        YD++ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   +   PI+A++   +++++   L  GMND L+KP  + DL  +L 
Sbjct: 430  PNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1121 KYIED 1125
            +Y+ D
Sbjct: 489  RYLRD 493

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 26/130 (20%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ +++  LK   I+   +A++GQ+A D+ K      G  D+IFMD+Q+
Sbjct: 501  ITVLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWK-----EGGIDLIFMDLQL 554

Query: 1061 PRLDGLAATKMIR--EELNY---TQP---------------IVALSAFPKEENVKECLDV 1100
            P   G+ A K IR  E+LN    T P               IVA +A     + +E L  
Sbjct: 555  PVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLS 614

Query: 1101 GMNDFLSKPI 1110
            G ND+L+KP+
Sbjct: 615  GCNDYLTKPV 624

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 33/137 (24%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A DK K      GN  +IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWK-----EGNLHLIFMDLQL 516

Query: 1061 PRLDGLAATKMIRE---------------------------ELNYTQPIVALSAFPKEEN 1093
            P L G+ A K IRE                             N    IVAL+A   +E+
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1094 VKECLDVGMNDFLSKPI 1110
             +E L  G ND+L+KP+
Sbjct: 577  KREALISGCNDYLTKPV 593

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 84/164 (51%), Gaps = 10/164 (6%)

Query: 965  PFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDL---IYILVAEDNHVNQEVIKRMLK 1021
            P + S     S +   T++++    + N +L+   L    ++L+ ED+ +  ++  + L 
Sbjct: 266  PQMSSAVPTLSVRKPSTMDSNPASTTPNMILDHPILRPGFHVLLVEDDSICIQLCSKFLM 325

Query: 1022 LEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQP 1081
              G   +++  DG  A    +        YD++ MD+ MP LDG  AT ++R   N T P
Sbjct: 326  KYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVRSFDNQT-P 378

Query: 1082 IVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125
            I+A++   +++++   L  GMND L+KP  + DL  +L +Y+ +
Sbjct: 379  IIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYLRN 422

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 72/129 (55%), Gaps = 14/129 (10%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A +  K     NG   +IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWK-----NGGLHLIFMDLQL 528

Query: 1061 PRLDGLAATKMIRE---ELNYTQP--IVALSAFPKEENVKECLDVGMNDFLSKPIKRPDL 1115
            P L G+ A K IR+   E     P  IVAL+A    E+ +  L  G ND+L+KP+   +L
Sbjct: 529  PVLSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPV---NL 585

Query: 1116 KIILKKYIE 1124
              + KK  E
Sbjct: 586  HWLSKKITE 594

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 86/177 (48%), Gaps = 42/177 (23%)

Query: 957  PSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVI 1016
            P   R + PFL+S     +T+++          +++KV  K   I +LV EDN +NQ ++
Sbjct: 388  PVVQREDSPFLRSAMETFTTESI----------TRDKVFPK---ISVLVVEDNMINQTIL 434

Query: 1017 KRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIR--E 1074
               L+   I+   +A++G +A D+ K      G   +I MD++MP L G+ A K IR  E
Sbjct: 435  SSFLRKHKIS-YKVAKNGIEAVDRWK-----EGGMHLILMDLEMPLLSGIDAAKEIRRLE 488

Query: 1075 ELN---YTQP------------------IVALSAFPKEENVKECLDVGMNDFLSKPI 1110
            +LN     +P                  IVAL+A   + +  E L  G ND+L+KP+
Sbjct: 489  KLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPV 545

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A D  K      G   +IFMD+Q+
Sbjct: 517  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK-----EGGLHLIFMDLQL 570

Query: 1061 PRLDGLAATKMIRE-------ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRP 1113
            P L G+ A K IR+         N    IVAL+A    E+ ++ L  G ND+L+KP+   
Sbjct: 571  PVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPV--- 627

Query: 1114 DLKIILKKYIE 1124
            +L  + KK  E
Sbjct: 628  NLHWLSKKITE 638

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 75/151 (49%), Gaps = 37/151 (24%)

Query: 988  DKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSEN 1047
            ++++++V  K   I +L+ EDN +NQ ++   L+   I+  ++A++G +A +K +     
Sbjct: 499  NQTRDRVFPK---INVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR----- 549

Query: 1048 NGNYDIIFMDVQMPRLDGLAATKMIR-----------------------EELN---YTQP 1081
             G   +I MD+Q+P L G+ A K IR                        ELN   +  P
Sbjct: 550  KGGIHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAP 609

Query: 1082 --IVALSAFPKEENVKECLDVGMNDFLSKPI 1110
              IVAL+AF    +  E L  G ND+L+KP+
Sbjct: 610  VIIVALTAFSSHADRNEALVAGCNDYLTKPV 640

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 80/176 (45%), Gaps = 40/176 (22%)

Query: 961  RLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRML 1020
            RL+R F    G++         +A +D     KV  K   I +L+ EDN +NQ ++   L
Sbjct: 533  RLSRSFAPKNGSSREKPFPGEWSATSD-----KVFPK---INVLIVEDNVINQTILSSFL 584

Query: 1021 KLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIRE------ 1074
            +   I    +A++GQ+A D  +      G   +IFMD+Q+P L G+ A K IRE      
Sbjct: 585  RKHKIF-YKVAKNGQEAIDVWR-----EGGIHLIFMDLQLPVLSGIDAAKKIRELEREHG 638

Query: 1075 --------------------ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPI 1110
                                ++N    IVA +A   + + KE L  G ND+L+KP+
Sbjct: 639  IGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPV 694

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 7/123 (5%)

Query: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062
            +L+ ED+ V+ ++  + L   G   + +  DG  A    +        +D++ MD+ MP 
Sbjct: 352  VLLVEDDEVSIQLCSKFLIKYGCT-VQVVTDGLAAISTLEKYR-----FDLVLMDIVMPN 405

Query: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122
            LDG  AT +IR   N T PI+A++   + +++   L  GMND L+KP  R DL  +L +Y
Sbjct: 406  LDGATATSIIRNFDNET-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTRY 464

Query: 1123 IED 1125
            +++
Sbjct: 465  LKN 467

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1002 YILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMP 1061
            ++L+ ED+ V+ ++  + L+  G   +++  DG  A    +        YD++ MD+ MP
Sbjct: 425  HVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAF-----RYDLVLMDIVMP 478

Query: 1062 RLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKK 1121
             LDG  AT +IR   +   PI+A++   +++++   L  GM D L+KP  R DL  +L +
Sbjct: 479  NLDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIR 537

Query: 1122 YI 1123
            ++
Sbjct: 538  HL 539

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
             ++L+ ED+ +  ++  + L ++    +++  DG  A    +        +D++ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1061 PRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILK 1120
            P LDG  AT ++R   N T PI+A++   +++++   L  GMND L+KP  + DL  +L 
Sbjct: 356  PNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1121 KYIED 1125
            +Y+ +
Sbjct: 415  RYLRN 419

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 41/172 (23%)

Query: 961  RLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRML 1020
            R   PF+ S   + +T+++          +++KV  K   I +LV EDN +NQ ++   L
Sbjct: 379  REGSPFILSAMESVTTESI----------TRDKVFPK---ISVLVVEDNMINQAILSSFL 425

Query: 1021 KLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIR------- 1073
            +   I+   +A++G +A D+ K      G   +I MD++MP L G+ A K IR       
Sbjct: 426  RKHKIH-YKVAKNGVEAVDRWK-----EGGMHLILMDLEMPLLSGIDAAKEIRKLEKQNG 479

Query: 1074 -------------EELNYTQP--IVALSAFPKEENVKECLDVGMNDFLSKPI 1110
                         + L    P  IVAL+A   + +  E L  G ND+L+KP+
Sbjct: 480  IGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPV 531

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 36/151 (23%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   LA++GQ+A +  K      G   +IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 539

Query: 1061 PRLDGLAATKMIRE-----------ELNYTQP----------------IVALSAFPKEEN 1093
            P L G+ A K IR+            LN + P                IVAL+A   + +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1094 VKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
             ++ L  G ND+L+KP+   +L  + KK  E
Sbjct: 600  KRKALVSGCNDYLTKPV---NLHWLSKKITE 627

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (52%), Gaps = 20/118 (16%)

Query: 958  SSVRLNRPFLQSTGTATSTQ-NVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVI 1016
            SS  L RP  + T  +   Q N+P          K KV  +   I +L+ EDN +NQ ++
Sbjct: 363  SSPELPRPLSRRTTPSLDKQGNLP----------KYKVFPR---INVLIVEDNAINQAIL 409

Query: 1017 KRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIRE 1074
               L+  GI+   +A+DG +A +K K      G+  +I MD+Q+P L GL ATK IRE
Sbjct: 410  ALFLRKNGIS-YKVAKDGVEAIEKWK-----EGDSHLILMDLQLPLLSGLEATKKIRE 461

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 72/154 (46%), Gaps = 39/154 (25%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A DK K      G   +IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWK-----EGGLHLIFMDLQL 564

Query: 1061 PRLDGLAATKMIRE---------------------------ELNYTQPIVALSAFPKEEN 1093
            P L G+ A K IRE                           + N T   V + AF    +
Sbjct: 565  PVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNS 624

Query: 1094 V---KECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
            +   +E L  G ND+L+KP+   +L  + KK  E
Sbjct: 625  LTDKREALISGCNDYLTKPV---NLHWLSKKITE 655

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 73/143 (51%), Gaps = 28/143 (19%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A D  K      G   +IFMD+Q+
Sbjct: 545  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK-----EGGLHLIFMDLQL 598

Query: 1061 PRLDGLAATKMIRE----------------ELNYTQP---IVALSAFPKEENVKECLDVG 1101
            P L G+ A + IR                 + N T+    IVAL+A   +++ +  L  G
Sbjct: 599  PVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISG 658

Query: 1102 MNDFLSKPIKRPDLKIILKKYIE 1124
             ND+L+KP+   +L  + KK  E
Sbjct: 659  CNDYLTKPV---NLHWLSKKITE 678

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (49%), Gaps = 36/151 (23%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   LA++GQ+A +  K      G   +IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 557

Query: 1061 PRLDGLAATKMIRE-----------ELN-------------YTQP---IVALSAFPKEEN 1093
            P L G+ A K IR+            LN             ++Q    IVAL+A   + +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1094 VKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
             ++ L  G ND+L+KP+   +L  + KK  E
Sbjct: 618  KRKALLSGCNDYLTKPV---NLHWLSKKITE 645

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 73/147 (49%), Gaps = 32/147 (21%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A D  K      G   +IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK-----EGGLHLIFMDLQL 723

Query: 1061 PRLDGLAATKMIR----------EELNYTQP-------------IVALSAFPKEENVKEC 1097
            P L G+ A + IR          +E N  Q              IVAL+A    ++ ++ 
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1098 LDVGMNDFLSKPIKRPDLKIILKKYIE 1124
            L  G ND+L+KP+   +L  + KK  E
Sbjct: 784  LLSGCNDYLTKPV---NLHWLSKKITE 807

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 36/151 (23%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   LA++GQ+A +  K      G   +IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 556

Query: 1061 PRLDGLAATKMIRE----------------ELNYTQP-----------IVALSAFPKEEN 1093
            P L G+ A K IR+                  N+ +            IVAL+A   + +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1094 VKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
             ++ L  G ND+L+KP+   +L  + KK  E
Sbjct: 617  KRKALLSGCNDYLTKPV---NLHWLSKKITE 644

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (49%), Gaps = 36/151 (23%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   LA++GQ+A +  K      G   +IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 546

Query: 1061 PRLDGLAATKMIR--EELN----------------------YTQP---IVALSAFPKEEN 1093
            P L G+ A K IR  E+ N                      ++Q    IVAL+A   + +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1094 VKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
             ++ L  G ND+L+KP+   +L  + KK  E
Sbjct: 607  KRKALLSGCNDYLTKPV---NLHWLSKKITE 634

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 8/94 (8%)

Query: 986  TDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLS 1045
            T   +KN   N    I +L+ EDN +NQ ++   L+   I+   +A++G++A DK K   
Sbjct: 447  TKKNTKNTRENVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWKQ-- 503

Query: 1046 ENNGNYDIIFMDVQMPRLDGLAATKMIR--EELN 1077
               G   +I +D+Q+P L G+ ATK IR  E+LN
Sbjct: 504  ---GGIHLILLDLQLPILSGIEATKEIRNLEKLN 534

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 34/138 (24%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I +L+ EDN +NQ ++   L+   I+   +A++G++A +K K      G   +IFMD+Q+
Sbjct: 471  ITVLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWK-----EGGIHLIFMDLQL 524

Query: 1061 PRLDGLAATKMIRE-----ELNYTQP-----------------------IVALSAFPKEE 1092
            P + G+ A K IRE      +    P                       +VA +A     
Sbjct: 525  PVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLT 584

Query: 1093 NVKECLDVGMNDFLSKPI 1110
            + +E L  G ND+L+KP+
Sbjct: 585  DKREALVSGCNDYLTKPV 602

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 69/154 (44%), Gaps = 39/154 (25%)

Query: 1001 IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQM 1060
            I IL+ EDN +NQ ++   L+   I    +A++G++A DK K      G   +IFMD+Q+
Sbjct: 565  INILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK-----EGGIHLIFMDLQL 618

Query: 1061 PRLDGLAATKMIRE----------------------------ELNYTQP--IVALSAFPK 1090
            P L G  A K IR+                            + +   P  IVA +A   
Sbjct: 619  PVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNS 678

Query: 1091 EENVKECLDVGMNDFLSKPIKRPDLKIILKKYIE 1124
              + +  L  G ND+L+KP+   +L  + KK  E
Sbjct: 679  LADKRAALIAGCNDYLTKPV---NLHWLSKKITE 709

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 23/104 (22%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFV------QGDQALS---------RQYGGTGLGLSIC 853
           + + ++D G GIDP++++ VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 854 KQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDELFN 897
           K    + NGT++++S  G G+     L          P D LF+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGTDVYIRL--------HGPSDRLFD 420

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P++++ +FE      QA ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M +G+++++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIRE--ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P+L  +   K+IR    +N T PIVAL+ +  +    +  D    D L K
Sbjct: 1484 FDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKVFD----DVLEK 1539

Query: 1109 PIKRPDLKIILKKY 1122
            P+    L+ ++ KY
Sbjct: 1540 PVSVEQLRKLVSKY 1553

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 1050 NYDIIFMDVQMPRLDGLAATKMIREE--LNYTQPIVALSAFPKEENVKECLDVGMNDFLS 1107
            ++D+I   +++P+L  +   +++++    N T PIVA++ + +E       D    D L 
Sbjct: 1679 SFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVFD----DVLE 1734

Query: 1108 KPIKRPDLKIILKKY 1122
            KP+K  +LK ++ KY
Sbjct: 1735 KPVKLDELKKLVAKY 1749

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 25/86 (29%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFV------------QGDQALS--------RQYGGTGL 848
           +S+ V+D G GI P+      EPF+            +GD A           +  G G 
Sbjct: 301 LSIRVRDHGGGIPPER-----EPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGF 355

Query: 849 GLSICKQLSTMMNGTMELESEVGVGS 874
           GL +C+  + +  G++ ++S  G+G+
Sbjct: 356 GLPLCRMYAELFGGSLSIQSLWGLGT 381

>CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa]
           {ON} similar to uniprot|P40530 Saccharomyces cerevisiae
           YIL042c
          Length = 419

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 17/96 (17%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P ++  +FE      ++  ++ G               G G GL +C
Sbjct: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378

Query: 854 KQLSTMMNGTMELESEVGVGSKFIFTL--PLKQTRE 887
           K    M +G ++++S  G G+     L  P K+  E
Sbjct: 379 KAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKMLE 414

>Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar to
           Ashbya gossypii ADL116C
          Length = 443

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + V ++D G GI P +++ +F+      +  ++  G               G G GL +C
Sbjct: 345 LEVRIRDFGGGIPPDVEDKMFDYSYSTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLC 404

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M NG ++++S  G G+
Sbjct: 405 KAYLEMFNGQLDIQSLWGWGT 425

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIREE--LNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P+L  +   +++R+    N T PIVA++ + +E    +  D    D L K
Sbjct: 1668 FDLIMTALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNYFQEAITSKVFD----DVLEK 1723

Query: 1109 PIKRPDLKIILKKY 1122
            P+   +LK ++ KY
Sbjct: 1724 PVNLDELKKLVAKY 1737

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 48/85 (56%), Gaps = 8/85 (9%)

Query: 1042 KMLSENNG--NYDIIFMDVQMPRLDGLAATKMIREE--LNYTQPIVALSAFPKEENVKEC 1097
            +++S  NG   +D+I   +++P++D +   K+I++   +N   PI+A + + +E    E 
Sbjct: 1873 ELVSRANGVIKFDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQE---AET 1929

Query: 1098 LDVGMNDFLSKPIKRPDLKIILKKY 1122
              V  ND + KPI+   L+ ++ +Y
Sbjct: 1930 CHV-FNDIMEKPIQLDILRRVVSRY 1953

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P +++ +F+         ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M NGT++++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIRE--ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P+L  +   K++R     N   PIVA++A+  E    +  D    D L K
Sbjct: 1485 FDLIITALKLPKLGAVDIAKLLRHTNSANCNTPIVAVTAYYGEAESTQVFD----DVLEK 1540

Query: 1109 PIKRPDLKIILKKY 1122
            P+    ++ ++ KY
Sbjct: 1541 PVGIEQIRCLIAKY 1554

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIREE--LNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P+L  +   +++++    N T PIVA++ + +E    +  D    D L K
Sbjct: 1670 FDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAITSKVFD----DVLEK 1725

Query: 1109 PIKRPDLKIILKKY 1122
            P+   +LK ++ KY
Sbjct: 1726 PVNLDELKKLVAKY 1739

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIREE--LNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P+L  +   +++++   +N T PIV+++ + +E    +  D    D L K
Sbjct: 1663 FDLIMTALKLPKLGAIDIVQLLKQTNGVNSTTPIVSITNYFQEAIASKAFD----DVLEK 1718

Query: 1109 PIKRPDLKIILKKY 1122
            P+   +LK ++ KY
Sbjct: 1719 PVNLDELKRLVAKY 1732

>ZYRO0D16544g Chr4 (1373180..1374448) [1269 bp, 422 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 422

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 17/82 (20%)

Query: 809 ISVEVKDTGSGIDPKLQESVF----------------EPFVQGDQALSRQYGGTGLGLSI 852
           + + ++D G GI P ++E +F                E ++   + ++    G G GL +
Sbjct: 328 LQIRIRDFGGGIPPAVEEKMFDYSYSTVAEKKNDTGAEAYILPGENVN-NVSGMGFGLPM 386

Query: 853 CKQLSTMMNGTMELESEVGVGS 874
           CK    M +G ++++S  G G+
Sbjct: 387 CKAYMEMFDGRLDIQSLWGWGT 408

>ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL042C
          Length = 435

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P +++ +F+      +  ++  G               G G GL +C
Sbjct: 337 LEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLC 396

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M NG +++ S  G G+
Sbjct: 397 KAYVEMFNGELDIVSLWGWGT 417

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIR--EELNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+IF  +++P+L  +   K++R    +N T  I+A++A+ +E   + C     ++ L +
Sbjct: 1434 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLER 1489

Query: 1109 PIKRPDLKIILKKY 1122
            P+    L+ +L KY
Sbjct: 1490 PVSVQQLRSLLLKY 1503

>Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON}
           YIL042C (REAL)
          Length = 393

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 12/78 (15%)

Query: 809 ISVEVKDTGSGIDPKLQESVF---------EPFVQGDQALSRQ---YGGTGLGLSICKQL 856
           + + ++D G GI P+++  +F         +P  +       Q     G G GL +CK  
Sbjct: 298 LYIRIRDHGGGITPEVEALMFDYSYSTHSQQPSEEATDLPGEQINNVSGMGFGLPMCKTY 357

Query: 857 STMMNGTMELESEVGVGS 874
             +  G M+++S  G G+
Sbjct: 358 LELFGGKMDIQSLPGWGT 375

>KAFR0I01930 Chr9 complement(392954..394171) [1218 bp, 405 aa] {ON}
           Anc_7.222 YIL042C
          Length = 405

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 19/83 (22%)

Query: 809 ISVEVKDTGSGIDPKLQESVF-----------------EPFVQGDQALSRQYGGTGLGLS 851
           ++++++D G GI P +++ +F                 E    G+Q       G G GL 
Sbjct: 310 LTIKIRDYGGGIPPDVEDKIFDYSYSTNDFDDSLNANEEAMNPGEQF--NNVAGMGFGLP 367

Query: 852 ICKQLSTMMNGTMELESEVGVGS 874
           + K    +  G +E++S  G+G+
Sbjct: 368 LSKAYLELFGGKLEIQSLYGLGT 390

>TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {ON}
           Anc_7.222 YIL042C
          Length = 430

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P ++E +++         ++  G               G G GL +C
Sbjct: 334 MQIRIRDYGGGISPAVEERMYDYSYSTVSEKAKDTGAEAYMIPGEDVNNVSGMGFGLPMC 393

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M +G ++++S +G G+
Sbjct: 394 KAYIDMFDGGLDVQSLLGWGT 414

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 1051 YDIIFMDVQMPRLDGLAATKMIRE--ELNYTQPIVALSAFPKEENVKECLDVGMNDFLSK 1108
            +D+I   +++P++  +  T+++R+   +N T PIVA++      N  +      +D L +
Sbjct: 1483 FDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTV-----NYHDAGTHIFDDVLER 1537

Query: 1109 PIKRPDLKIILKKY 1122
            PI    L+ ++ KY
Sbjct: 1538 PIGTEQLRKLVSKY 1551

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 457 DDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHY 506
           D  S+S Q++K +   ++ +V  Y   L ++L+E+T+  N M + LD+H+
Sbjct: 627 DQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHF 676

>KLTH0A03916g Chr1 (329926..331167) [1242 bp, 413 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 413

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 809 ISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYG---------------GTGLGLSIC 853
           + + ++D G GI P +++ +F+       + ++  G               G G GL +C
Sbjct: 318 LKIRIRDFGGGIPPDVEDRMFDYSYSTVNSDAKDSGMSAYVIPGEDVCNVSGMGFGLPMC 377

Query: 854 KQLSTMMNGTMELESEVGVGS 874
           K    M  G+++++S  G G+
Sbjct: 378 KAYMEMFGGSVDIQSLWGWGT 398

>ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1604

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 65/140 (46%), Gaps = 16/140 (11%)

Query: 989  KSKNKVLNKMDLIY---ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLS 1045
            +S  K  N  D+ Y   +LV E   +++  + R L+  G   I +      A D+    +
Sbjct: 1458 RSGRKSSNTEDVRYYMDVLVCEPISIHRYRVTRELEDLGCAVIAVG-----AGDELIGRA 1512

Query: 1046 ENNGNYDIIFMDVQMPRLDGLAATKMIR--EELNYTQPIVALSAFPKEENVKECLDVGM- 1102
             +   +D+I   +++P+L       +++     N T P+VAL+ +      +E + + + 
Sbjct: 1513 TSGIKFDLIMTALKLPKLGAADIVSLLKYTNGTNSTTPVVALTNY-----YQEAVSLNLF 1567

Query: 1103 NDFLSKPIKRPDLKIILKKY 1122
            ND L KP+    L+ I+ KY
Sbjct: 1568 NDVLEKPVLADSLRKIVAKY 1587

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
           YDR135C (REAL)
          Length = 1516

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 15/126 (11%)

Query: 717 NDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYD 776
           ND  +K+    NN ++E    SK+   +SSI +  E  ++ +++ +   S  T S +   
Sbjct: 854 NDYGKKN----NNKQSEECDSSKNSVRESSIPVEGELEQLQKLNDLDFGSPDTVSLRRAS 909

Query: 777 DTALMKQLIKSTDLDDDENKLGVELKEQK--TWVISVEVKDTGSGIDPKLQESVFEPFVQ 834
           D  L     +S D  DDEN    E +EQ    W I +E        +PK    VF  F+ 
Sbjct: 910 DATL-----RSIDFGDDENIAKREHREQGKVKWNIYLEY---AKACNPK-SVCVFLLFIV 960

Query: 835 GDQALS 840
               LS
Sbjct: 961 ISMLLS 966

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
           Anc_8.604 YOR195W
          Length = 756

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 464 QKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAA 523
           ++ K S N  ++ +      L+++ SEL DT   + DA + +  L+ E +  RTK++++ 
Sbjct: 464 EQVKKSENQFQSEISELQDTLKEKESELLDTTRALNDAKEDNTKLINEMM-DRTKEVQSL 522

Query: 524 KIQAESANEAKTVFIANIS 542
           K   E AN+  +V  A ++
Sbjct: 523 KKTYEEANDHASVRTAEVT 541

>NCAS0A13390 Chr1 (2634871..2636202) [1332 bp, 443 aa] {ON}
           Anc_7.222
          Length = 443

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 32/56 (57%)

Query: 775 YDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFE 830
           Y  T ++K  +K+   +D    + + + E  +  ++V ++D G GIDPK++  +F+
Sbjct: 287 YVLTEILKNSMKAHIENDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQ 342

>Suva_4.413 Chr4 complement(732582..733976) [1395 bp, 464 aa] {ON}
           YBR162C (REAL)
          Length = 464

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 192 FANPSIILSDSRIYGYL--SVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249
           FAN     S    Y     ++I S  GL S + D T ++ S      ADY+++ +L  FN
Sbjct: 20  FANADCTYSGGNYYCAQTDAIIYSNVGLSSTYQDVTNMDESSCACTQADYTVSGSLAPFN 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,013,419
Number of extensions: 4901779
Number of successful extensions: 18638
Number of sequences better than 10.0: 274
Number of HSP's gapped: 19413
Number of HSP's successfully gapped: 312
Length of query: 1127
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1007
Effective length of database: 39,721,479
Effective search space: 39999529353
Effective search space used: 39999529353
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)