Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D045805.699ON47047021950.0
Kpol_2001.735.699ON411104990.002
SAKL0E14850g5.699ON470143870.047
Skud_9.225.699ON537152770.69
Smik_9.235.699ON52749770.73
NCAS0G002605.699ON51057770.74
YIL146C (ATG32)5.699ON52940760.99
Suva_9.435.699ON51340741.8
TDEL0B022205.699ON48936723.1
KAFR0D022505.699ON556107723.2
TBLA0E020905.699ON74956688.1
CAGL0H06545g5.699ON492135689.3
NOTE: 7 genes in the same pillar as TPHA0D04580 were not hit in these BLAST results
LIST: ZYRO0G06666g KLTH0E01122g AFR283W Kwal_55.19716 Ecym_4021 KLLA0A00660g KNAG0L02100

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04580
         (470 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}            850   0.0  
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    43   0.002
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...    38   0.047
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...    34   0.69 
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...    34   0.73 
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    34   0.74 
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...    34   0.99 
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...    33   1.8  
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...    32   3.1  
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    32   3.2  
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    31   8.1  
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    31   9.3  

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/470 (89%), Positives = 422/470 (89%)

Query: 1   MRNTIMDIRSYTERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNAXXXXXX 60
           MRNTIMDIRSYTERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNA      
Sbjct: 1   MRNTIMDIRSYTERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNAIIDLSD 60

Query: 61  XXXXXXXXXXXXXXXXXXVRNGTLGRSRNANMSIHASTTSAYSHSYFDQSASDTSSSNQF 120
                             VRNGTLGRSRNANMSIHASTTSAYSHSYFDQSASDTSSSNQF
Sbjct: 61  SWQILSSSSENSEEEDIEVRNGTLGRSRNANMSIHASTTSAYSHSYFDQSASDTSSSNQF 120

Query: 121 VMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYCFMLDVSTDNSVSLLVVQNHL 180
           VMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYCFMLDVSTDNSVSLLVVQNHL
Sbjct: 121 VMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYCFMLDVSTDNSVSLLVVQNHL 180

Query: 181 ELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCNKVLSSMKERKWPMLYYPNLIIIHE 240
           ELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCNKVLSSMKERKWPMLYYPNLIIIHE
Sbjct: 181 ELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCNKVLSSMKERKWPMLYYPNLIIIHE 240

Query: 241 RANNNHGSKTKVIANLLQFLREHEPSKLNGSIRSDTVSQERSERMIKELFKPNSAPVNNK 300
           RANNNHGSKTKVIANLLQFLREHEPSKLNGSIRSDTVSQERSERMIKELFKPNSAPVNNK
Sbjct: 241 RANNNHGSKTKVIANLLQFLREHEPSKLNGSIRSDTVSQERSERMIKELFKPNSAPVNNK 300

Query: 301 KNLSRSSIRAIRNVKSMRKSKYKPRIPLTERDKSGIGXXXXXXXXXXXWFYKWXXXXXXX 360
           KNLSRSSIRAIRNVKSMRKSKYKPRIPLTERDKSGIG           WFYKW       
Sbjct: 301 KNLSRSSIRAIRNVKSMRKSKYKPRIPLTERDKSGIGKKDDKNQNDKDWFYKWSVSISIG 360

Query: 361 XXXXXXYCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTINL 420
                 YCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTINL
Sbjct: 361 IGIGVGYCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTINL 420

Query: 421 PQTWDFLTSTVRHICVIMKYIILKPISFLGSNWQNLDDSNRIIAMSYVLL 470
           PQTWDFLTSTVRHICVIMKYIILKPISFLGSNWQNLDDSNRIIAMSYVLL
Sbjct: 421 PQTWDFLTSTVRHICVIMKYIILKPISFLGSNWQNLDDSNRIIAMSYVLL 470

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 15/104 (14%)

Query: 367 YCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTINLPQTWDF 426
           YC+S+++ S   + +     S   ND+IA      D +S        NG   N    W+F
Sbjct: 323 YCISSLVVSQNSNDIQSIVPSTPNNDIIALES--QDLNSH-------NGDDYN----WNF 369

Query: 427 LTSTVRHICVIMKYIILKPISFLGSNWQNLDDSNRIIAMSYVLL 470
           L  +++++  I+K  I   I+ L   ++ L+DSN+IIAMSYVLL
Sbjct: 370 LKLSIKNVYSILKRFITTSINLLE--YKTLNDSNKIIAMSYVLL 411

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 14 RRSVIEPHYSVLDLLEANMGGPPPSANV 41
           + +++PHYSVL LLE N   P  S N+
Sbjct: 2  EKHLLDPHYSVLKLLENNFNNPNDSMNL 29

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYCFMLDVSTDN 169
           + S  +SSN FVMP+LS S++    + I VVG  A  F+    ++    Y  M D+    
Sbjct: 176 TVSLAASSNSFVMPQLSLSQRSHRFE-ILVVGKPARKFWNNVPKM----YQKMFDIGDFE 230

Query: 170 SVSLLVVQNHLELLDILRHSRDITVV--AIVLSLDHRRGDNLEIIKNCNK----VLSSM- 222
           S+S   V ++  ++ I + +++++ +  ++V  LD +      II  C +     L+S+ 
Sbjct: 231 SISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGK-----AIIPICQRGQKQQLASLL 285

Query: 223 ----KERKWPMLYYPNLIIIHER 241
               K +K  +++ P ++  H+ 
Sbjct: 286 EPFVKAKKIRLMFQPTVMSNHQE 308

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 13 ERRSVIEPHYSVLDLLEAN 31
          ++RS+++PH+SVL LLE N
Sbjct: 27 QKRSILDPHFSVLQLLERN 45

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 22/152 (14%)

Query: 100 SAYSHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEY 159
            AY       + S TSS+N FVMP+LS S+K    + + ++G    +FYQ   +    + 
Sbjct: 189 GAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLL-ILGRTGSNFYQSIPK--EHQS 245

Query: 160 CFMLDVSTDNSVS------LLVVQNHLELLDIL----RHSRDITVVAIVLSLDHRRGDNL 209
            F L    D++        +++ Q   E++ +L    ++S+   ++ I      + G  +
Sbjct: 246 LFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPIC-----QPGQTI 300

Query: 210 EIIKNCNKVLSSMKERKWPMLYYPNLIIIHER 241
           + +KN   VL S    K   L YP +++ + R
Sbjct: 301 Q-VKN---VLKSFLRNKLIKLLYPPVVVTNRR 328

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 101 AYSHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149
           AY       + S TSS+N FVMP+LS S+K    + + ++G    +FYQ
Sbjct: 184 AYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLL-ILGRTGSNFYQ 231

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 423 TWDFLTSTVRHICVIMKYIILKPISFL---------GSNWQNLDDSNRIIAMSYVLL 470
           TW+F   TV  +    K II KP +             +W+  D+ +RI+A+ Y+LL
Sbjct: 455 TWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWK-FDEQDRILALCYLLL 510

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149
           + S TSS+N FVMP+LS ++K    + + ++G    SFYQ
Sbjct: 193 TKSLTSSTNSFVMPKLSLTQKNPVFRLL-ILGRTGSSFYQ 231

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149
           + S TSS+N FVMP+LS S+K    + + ++G    +FYQ
Sbjct: 198 TKSLTSSTNSFVMPKLSLSRKNPVFRLL-ILGRTGTNFYQ 236

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 114 TSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149
           ++SSN FVMP+LS S+K   L+ I ++G     FYQ
Sbjct: 172 SNSSNSFVMPKLSLSQKSHKLR-ILILGRPGLKFYQ 206

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 57/107 (53%), Gaps = 5/107 (4%)

Query: 367 YCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTIN--LPQTW 424
           YC+S    S+ +S L++ F+  E++ + A + V    +S  +    DN         ++ 
Sbjct: 452 YCIS-YFGSSPWSSLVQYFNP-ESDSISATVPVPLSNESFVLLHDSDNDSETKKYFFKSI 509

Query: 425 DFLTSTVRHICVIMKYIILKPI-SFLGSNWQNLDDSNRIIAMSYVLL 470
           +FL  ++  + VI+K  I KP+ +F   N  N DD++ ++A+ Y+L+
Sbjct: 510 NFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNTDDASSLLALGYILI 556

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 95  HASTTSAYSHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHAD-SFYQ 149
            +++T   S++  + + S TSSSN F+MP+LS++      + I ++GS+ + +FYQ
Sbjct: 311 QSNSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFR-ILILGSNQNLTFYQ 365

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 25/135 (18%)

Query: 120 FVMPRLSYSKKEGSLKAISVVGSHADSFYQ----EYLQVSTGEYCFMLDVSTDNSVSLLV 175
           FVMP+LS + K    K + VVG  +  F+Q    EY Q       F +  S+D S     
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQY------FHISQSSDPS----E 244

Query: 176 VQNHLELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCN--------KVLSSMKERKW 227
            QN++ ++ + +  ++      +L+   +  D   II  C          +L S  +   
Sbjct: 245 FQNYIGIVIVFQELKEFVA---MLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDA 301

Query: 228 PMLYYPNLIIIHERA 242
             L+YP + I +E++
Sbjct: 302 ITLWYPPVTIANEKS 316

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,990,695
Number of extensions: 1903652
Number of successful extensions: 8006
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8296
Number of HSP's successfully gapped: 43
Length of query: 470
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 357
Effective length of database: 40,524,141
Effective search space: 14467118337
Effective search space used: 14467118337
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)