Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D045757.345ON1121124325e-56
KAFR0A038708.679ON26772623.0
SAKL0A08558g6.56ON78239606.3
NOTE: 16 genes in the same pillar as TPHA0D04575 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 Skud_12.267 CAGL0A03883g Smik_12.262 YLR204W Suva_10.298 KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04575
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04575 Chr4 complement(998966..999304) [339 bp, 112 aa] {ON}     171   5e-56
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    28   3.0  
SAKL0A08558g Chr1 complement(756256..758604) [2349 bp, 782 aa] {...    28   6.3  

>TPHA0D04575 Chr4 complement(998966..999304) [339 bp, 112 aa] {ON}
          Length = 112

 Score =  171 bits (432), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 85/112 (75%), Positives = 85/112 (75%)

Query: 1   MFGIVRNCAWKAPRALHGVFNLKLRKNYLHTFVDSRASSILGNPVINSKVLVQLNLRPLA 60
           MFGIVRNCAWKAPRALHGVFNLKLRKNYLHTFVDSRASSILGNPVINSKVLVQLNLRPLA
Sbjct: 1   MFGIVRNCAWKAPRALHGVFNLKLRKNYLHTFVDSRASSILGNPVINSKVLVQLNLRPLA 60

Query: 61  PLAPVRDVPHQNIVEMELDSVXXXXXXXXXXXXXXXXXXXXXXXXXXXSQGR 112
           PLAPVRDVPHQNIVEMELDSV                           SQGR
Sbjct: 61  PLAPVRDVPHQNIVEMELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGR 112

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 18/72 (25%)

Query: 26  KNYLHTFVDSRASS-ILGNPVINSKV-------LVQLNL--------RPLAPLAPVRDVP 69
           K+Y  T VD+ ASS +L NP IN K+        +  NL          + P A     P
Sbjct: 37  KDYSETIVDAVASSSLLDNPTINKKIDDIPKNGKLNNNLLSNSALVSSSVTPTAQTSSTP 96

Query: 70  HQNIVEMELDSV 81
            +N  EMEL+S+
Sbjct: 97  IKN--EMELNSI 106

>SAKL0A08558g Chr1 complement(756256..758604) [2349 bp, 782 aa] {ON}
           similar to uniprot|Q99287 Saccharomyces cerevisiae
           YOR165W SEY1 Synthetic Enhancement with YOP1
          Length = 782

 Score = 27.7 bits (60), Expect = 6.3,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 39  SILGNPVINSKVLVQLNLRPLAPLAPVRDVPHQNIVEME 77
           S+ GN  IN KVL+   +R    + P+  +    I E+E
Sbjct: 163 SLFGNSTINHKVLLLFVIRDYVGVTPLESLQESLIAELE 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,208,155
Number of extensions: 263214
Number of successful extensions: 620
Number of sequences better than 10.0: 4
Number of HSP's gapped: 620
Number of HSP's successfully gapped: 4
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)