Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D045707.343ON73673638170.0
Kpol_2001.717.343ON72672023330.0
Smik_4.747.343ON84574123130.0
TDEL0C020407.343ON70572022960.0
Skud_4.937.343ON75575522960.0
Suva_4.827.343ON75576722890.0
YDL164C (CDC9)7.343ON75573722850.0
NCAS0A141107.343ON75374722780.0
CAGL0I03410g7.343ON72471822580.0
NDAI0A019407.343ON76573622620.0
KAFR0B008307.343ON71071622130.0
KNAG0C037407.343ON72772622120.0
ZYRO0F11572g7.343ON73174622090.0
SAKL0F10912g7.343ON69370721830.0
Kwal_56.246167.343ON71573621240.0
ACL155W7.343ON69771420920.0
KLLA0D12496g7.343ON70070020860.0
KLTH0H01408g7.343ON72365820560.0
TBLA0E020507.343ON72075320120.0
ACR008W6.18ON9814283112e-28
KLTH0C11286g6.18ON9513923004e-27
TPHA0M002606.18ON9664282834e-25
KLLA0D01089g6.18ON9073822809e-25
ZYRO0C07854g6.18ON9443962809e-25
TBLA0G010406.18ON9724212736e-24
CAGL0E02695g6.18ON9463952692e-23
KNAG0F028706.18ON9544092649e-23
Kwal_56.224146.18ON9632522621e-22
NCAS0D026506.18ON9504002612e-22
Smik_15.1746.18ON9454222602e-22
Kpol_1032.76.18ON9653782593e-22
TDEL0G045106.18ON9694062567e-22
YOR005C (DNL4)6.18ON9444252531e-21
Skud_15.1666.18ON9472772522e-21
NDAI0I022606.18ON9672542461e-20
Suva_15.1806.18ON9484232423e-20
KAFR0A050506.18ON9483982211e-17
Skud_8.2155.102ON52671771.4
CAGL0J09350g7.288ON83088771.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04570
         (736 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...  1474   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   903   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   895   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   889   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   889   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   886   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   884   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   882   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   874   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   875   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   857   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   856   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   855   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   845   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   822   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   810   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   808   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   796   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   779   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   124   2e-28
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   120   4e-27
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   113   4e-25
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   112   9e-25
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   112   9e-25
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   109   6e-24
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   108   2e-23
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   106   9e-23
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   105   1e-22
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   105   2e-22
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   104   2e-22
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   104   3e-22
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   103   7e-22
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   102   1e-21
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   101   2e-21
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    99   1e-20
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    98   3e-20
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    90   1e-17
Skud_8.215 Chr8 complement(370644..372224) [1581 bp, 526 aa] {ON...    34   1.4  
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...    34   1.5  

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score = 1474 bits (3817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/736 (97%), Positives = 718/736 (97%)

Query: 1   MAIGRLQTTIFRQLSYCRPFVSSLRFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKK 60
           MAIGRLQTTIFRQLSYCRPFVSSLRFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKK
Sbjct: 1   MAIGRLQTTIFRQLSYCRPFVSSLRFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKK 60

Query: 61  TPPAVEVATKQESPENHVDKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQ 120
           TPPAVEVATKQESPENHVDKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQ
Sbjct: 61  TPPAVEVATKQESPENHVDKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQ 120

Query: 121 IEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKT 180
           IEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINR                  IKT
Sbjct: 121 IEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKT 180

Query: 181 ISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGK 240
           ISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGK
Sbjct: 181 ISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGK 240

Query: 241 DSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKG 300
           DSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKG
Sbjct: 241 DSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKG 300

Query: 301 ESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLK 360
           ESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLK
Sbjct: 301 ESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLK 360

Query: 361 PMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPEL 420
           PMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPEL
Sbjct: 361 PMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPEL 420

Query: 421 DVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDL 480
           DVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDL
Sbjct: 421 DVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDL 480

Query: 481 KDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQ 540
           KDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQ
Sbjct: 481 KDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQ 540

Query: 541 TFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFG 600
           TFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFG
Sbjct: 541 TFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFG 600

Query: 601 KGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYD 660
           KGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYD
Sbjct: 601 KGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYD 660

Query: 661 SSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720
           SSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT
Sbjct: 661 SSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720

Query: 721 SEDIIEFYESQSHIQN 736
           SEDIIEFYESQSHIQN
Sbjct: 721 SEDIIEFYESQSHIQN 736

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/720 (63%), Positives = 552/720 (76%), Gaps = 46/720 (6%)

Query: 44  SKKQATLARFFTSMGK-KTPPAVEVATKQESPENHVDKKRKVEVH----PSQSVGASEKA 98
           +KKQATLARFF+SM K K        +   + ++  D  +K++++    P+ S G+    
Sbjct: 26  AKKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSDETPTTSAGSVTSK 85

Query: 99  ESP----------------PDQTK-----STVLYSEVCNLFQQIEETSSRLAIIKLCSEF 137
           + P                P  TK     STV Y+++C +FQ++E TSSRL+IIK+CS+F
Sbjct: 86  DEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDF 145

Query: 138 FIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELK 197
            I+V+K +P +++ + YLFIN+                  +KTISE+ GKS++Q+K + +
Sbjct: 146 LIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQLKNQYR 205

Query: 198 ETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSAS 257
           E GDLG IA+DARN+QPTMFKPKPLT+ +VF NLK IA + GKDSQ RK++LIK+ML+A 
Sbjct: 206 EIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTAC 265

Query: 258 KGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQ 317
           KG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLL+E+   K  S         M+LIE 
Sbjct: 266 KGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPS---------MELIET 316

Query: 318 AEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAF 377
           AE K+R+A CQVPNYEI+I  CL DGI+ +D  C LRPGIPLKPMLAKPTKAI EVL+AF
Sbjct: 317 AEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAF 376

Query: 378 QGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITN-DQ 436
           QG+EF  EYKYDGER QVHLL  GEMRIYSRNGENMTERYPEL ++DFL  VK  +N D+
Sbjct: 377 QGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFL--VKDESNTDK 434

Query: 437 EGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLY 496
           E          +ILDCEVVAWD EQ KILPFQVL+TRKRK V+LKDVKVRVCLFAFD+LY
Sbjct: 435 E--------VSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILY 486

Query: 497 LNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMV 556
            N EG+I K+LRER++IL +VT  VPGEFQYATSLIT+++DE+Q FLDQA+K+SCEGLMV
Sbjct: 487 YNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMV 546

Query: 557 KMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCY 616
           K+LDGEES YEPSKRSRNWLKLKKDYL GVGDSLDL VMGAY+GKGKRTG+YGGFLLGCY
Sbjct: 547 KILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCY 606

Query: 617 NEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFE 676
           N+D+ E+ETCCKIGTGFSDEML  L+ L +  EI+ P   Y +DSSAEPD+WF+ KVLFE
Sbjct: 607 NQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFE 666

Query: 677 VLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736
           VLTADLSLSP+YKAG++ YDKGISLRFPRFLRIR+DK V D T+S+ IIE YE+QSHIQ+
Sbjct: 667 VLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS 726

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/741 (61%), Positives = 537/741 (72%), Gaps = 71/741 (9%)

Query: 46  KQATLARFFTSM-----GKKTPPAVEVATKQESPENHVDKKRKV---EVHPSQSVGASEK 97
           KQATLARFFTSM     G  +PP     + +   ++ VD    V    V  SQ V  ++ 
Sbjct: 126 KQATLARFFTSMKNKPSGNTSPPD---KSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQA 182

Query: 98  AESPP------------------------------------------DQTKSTVLYSEVC 115
           A   P                                          D   S + YS+VC
Sbjct: 183 ATVQPFMSSFPSSLPSSAPSSSGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVC 242

Query: 116 NLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXX 175
            +F QIE  SSRL II++CS+FFI+V+K +  ++I   YLFINR                
Sbjct: 243 EVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGEN 302

Query: 176 XXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIA 235
             +KTISE+ GKS+ QIKL+ KE GDLG IA  ARN+QPTMFKPKPLT+ +VF NL+ IA
Sbjct: 303 LLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIA 362

Query: 236 SATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEH 295
              GKDSQLRKIKLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALLLH+ 
Sbjct: 363 KTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE 422

Query: 296 WKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRP 355
            +E    K    D+  MD++E A+ K+R+A CQVPNYEIVIN CL+ GI+N+DK CTLRP
Sbjct: 423 NRENSADK----DI-PMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRP 477

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTE 415
           GIPLKPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G MRIYSRNGENMTE
Sbjct: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTE 537

Query: 416 RYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKR 475
           RYPE+ + DF+               +   K++ILDCE VAWD +Q KILPFQVL+TRKR
Sbjct: 538 RYPEIKITDFI-------------QDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKR 584

Query: 476 KNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSD 535
           K+V+L DVKVRVCLFAFD+L  N+E +IN SLRER+E L KVT +VPGEFQYAT +IT++
Sbjct: 585 KDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNN 644

Query: 536 MDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVM 595
           +DELQ FLD++V +SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V+
Sbjct: 645 LDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704

Query: 596 GAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPM 655
           GAY+G+GKRTG+YGGFLLGCYN+DT EFETCCKIGTGFSDEML  LH  L PT ID P  
Sbjct: 705 GAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKA 764

Query: 656 TYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDV 715
           TY++DSSAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SLRFPRFLRIREDK V
Sbjct: 765 TYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGV 824

Query: 716 TDGTTSEDIIEFYESQSHIQN 736
            D T+S+ I+E YE+QSH+QN
Sbjct: 825 EDATSSDQIVELYENQSHVQN 845

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/720 (62%), Positives = 541/720 (75%), Gaps = 43/720 (5%)

Query: 31  LLYTRTMSNSLEPSKKQATLARFFTSMGK-----KTPPAVEVATKQESPENHVDKKRKVE 85
           LL  + MS+     KKQATLARFF+++ K     K    V++   +++ +  V KK K  
Sbjct: 12  LLINKGMSSG----KKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSS 67

Query: 86  ---------VHPSQSVGASEKAESP--PDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLC 134
                    + P +S G  E  + P  PD   S V YS+VCN+FQ+IE TSSRL+IIK+C
Sbjct: 68  SPVKLQTSSLSPVKSAGV-ESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKIC 126

Query: 135 SEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKL 194
           SEFF R++K+NP ++I   YLFINR                  +KTISEA GKS+ Q+K 
Sbjct: 127 SEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKN 186

Query: 195 ELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQML 254
             +E GDLG IA +ARN+QPTMFKPKPLT+ +VF NL+ IA + GKDSQ RKIKLIK+ML
Sbjct: 187 RYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRML 246

Query: 255 SASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDL 314
           +A +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL +E     GE+  +     SM+L
Sbjct: 247 TACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNE-----GETGKEP----SMEL 297

Query: 315 IEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVL 374
           +EQAEAK+R+A CQVPNYEIVIN CL  GI+ +DK C LRPGIPLKPMLAKPTK+ITEVL
Sbjct: 298 VEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVL 357

Query: 375 NAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITN 434
           + FQG+ F SEYKYDGERAQVHLLE G MRIYSRNGENMTERYPE+ ++DF+        
Sbjct: 358 DRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVA------- 410

Query: 435 DQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDL 494
                  ++  K +ILDCE VAWD  Q+KILPFQVL+TRKRK+V+ KDVKVRVCLFAFD+
Sbjct: 411 ------DLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDI 464

Query: 495 LYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGL 554
           +  N E  INKSLRER+E+L +VT  V GEFQYA  L TS ++ELQ FLDQ+VK+SCEGL
Sbjct: 465 ICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGL 524

Query: 555 MVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLG 614
           MVKMLDG ESHYEPSKRSRNWLKLKKDYLDGVGDSLDL V+GAY+G+GKRTG+YGGFLLG
Sbjct: 525 MVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 584

Query: 615 CYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVL 674
           CYN+D+ EFETCCKIGTGFSDEML  L+     T +D P  TY++DSSAEPDVWF+   L
Sbjct: 585 CYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644

Query: 675 FEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734
           FEVLTADLSLSPVYKAG S YDKG+SLRFPRF+R+R+DK V D T+S  I+E Y+ QSH+
Sbjct: 645 FEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/755 (59%), Positives = 547/755 (72%), Gaps = 68/755 (9%)

Query: 30  SLLYTRTMSNSLEPSKKQATLARFFTSMGKKTPPAVEVATKQESP----ENHVDK----- 80
           SLL   ++ +S     KQATLARFF+SM  K  P+   ++ +++P    EN++D      
Sbjct: 21  SLLMPPSLPSSAGKKPKQATLARFFSSM--KNEPSGSSSSPEKAPKHKLENNIDNNSSEG 78

Query: 81  ----KRKVEVHPSQSVGA-----------------------------------SEKAESP 101
               K+  +V   Q++ A                                    E + + 
Sbjct: 79  ADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVSQESREFTPQVEKEPSSND 138

Query: 102 PDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXX 161
            D   S + YSEVC +F +IE  SSRL II++CS+FFI+++  +  ++I   YLFINR  
Sbjct: 139 NDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLG 198

Query: 162 XXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKP 221
                           +KTISE+ GKS+ QIKL+ KE GDLG IA  ARN+QPTMFKPK 
Sbjct: 199 PDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKA 258

Query: 222 LTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKT 281
           LT+ +VF NL+ IA   GKDSQLRK+KLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKT
Sbjct: 259 LTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKT 318

Query: 282 VLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQ 341
           VLISLSKALLLH+  KE    K        MD++E A+ ++R+A CQVPNYEIVIN CL 
Sbjct: 319 VLISLSKALLLHDENKENSPDK-----EIPMDVLESAQQRIRDAFCQVPNYEIVINSCLN 373

Query: 342 DGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGG 401
            GI+N+DK CTLRPGIPLKPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G
Sbjct: 374 HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG 433

Query: 402 EMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQ 461
            MRIYSRNGENMTERYPE+ + DF+               +   K++ILDCE VAWD EQ
Sbjct: 434 TMRIYSRNGENMTERYPEIKITDFI-------------QDLNSTKNLILDCEAVAWDKEQ 480

Query: 462 KKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLV 521
           KKILPFQ+L+TRKRK+V+L DVKV+VCLFAFD+L  N+E +INKSLRER+E L KVT +V
Sbjct: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540

Query: 522 PGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKD 581
           PGEFQYAT +IT+++DELQ FLD++V NSCEGLMVKMLDG ESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600

Query: 582 YLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNL 641
           YL+GVGDSLDL V+GAY+G+GKRTG+YGGFLLGCYN+DT EFETCCKIGTGFSDEML  L
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 642 HTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISL 701
           H  L PT ID P  T+++D+SAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SL
Sbjct: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 702 RFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736
           RFPRFLRIREDK V D T+S+ IIE YE+QSH+QN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/767 (60%), Positives = 551/767 (71%), Gaps = 70/767 (9%)

Query: 20  FVSSLRFGTASLLYTRTMSNSLEPSK----KQATLARFFTSM-----GKKTPPAVEVATK 70
            ++S+R  ++ LL    MS+SL  S     KQATLARFFTSM     G  + P   V  K
Sbjct: 9   ILTSVRPSSSKLLLF--MSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHK 66

Query: 71  QESPENHVD-------KKRK----VEVHPSQS------------------VGASEKA--- 98
            E+  N +        KK K    V+    QS                  V AS+K+   
Sbjct: 67  IENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSREL 126

Query: 99  ------ESPP---DQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDI 149
                 E  P   D   S + YSEVC +F +IE  SSRL II++CS+FFI+++K +  ++
Sbjct: 127 TPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNL 186

Query: 150 IIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDA 209
           I   YLFINR                  +KTISE+ GKS+ QIKL+ KE GDLG IA  A
Sbjct: 187 IPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGA 246

Query: 210 RNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSL 269
           RN+QPTMFKPKPLT+ +VF NL+ IA   GKDSQLRK+KLIK+ML+A +G+EAKFLIRSL
Sbjct: 247 RNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSL 306

Query: 270 ESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQV 329
           ESKLRIGLAEKTVLISLSKALLLH      G  +    +   MD++E A+ K+R+A CQV
Sbjct: 307 ESKLRIGLAEKTVLISLSKALLLH-----GGNGENSHVNDIPMDVLESAQQKIRDAFCQV 361

Query: 330 PNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYD 389
           PNYEIVIN CL+ GI+N+DK CTL+PGIPLKPMLAKPTKAI EVL+ FQG+ F SEYKYD
Sbjct: 362 PNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYD 421

Query: 390 GERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDII 449
           GERAQVHLL+ G MRIYSRNGENMTERYPE+ + DF+               +   K++I
Sbjct: 422 GERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFI-------------QDLDATKNLI 468

Query: 450 LDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRE 509
           LDCE VAWD EQ KILPFQVL+TRKRK+V+L DVKVRVCLFAFD+L  N E +INKSLRE
Sbjct: 469 LDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRE 528

Query: 510 RQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPS 569
           R+E L KVT +VPGEFQYAT ++T ++DELQ FLD++V  SCEGLMVKML+G ESHYEPS
Sbjct: 529 RRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPS 588

Query: 570 KRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKI 629
           KRSRNWLKLKKDYL+GVGDSLDL V+GAY+G+GKRTG+YGGFLLGCYN+DT EFETCCKI
Sbjct: 589 KRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKI 648

Query: 630 GTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYK 689
           GTGFSDE L  LH  L PT ID P  T+++DSSAEPDVWF+   LFEVLTADLSLSP+YK
Sbjct: 649 GTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYK 708

Query: 690 AGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736
           AG++ + KG+SLRFPRFLRIREDK V D T+SE I+E YE+QSH+QN
Sbjct: 709 AGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/737 (61%), Positives = 539/737 (73%), Gaps = 64/737 (8%)

Query: 46  KQATLARFFTSMGKKTP---PAVEVATKQ---------ESPENHVDKKRK---------- 83
           KQATLARFFTSM  K     P+ + ++K             E +  KK K          
Sbjct: 37  KQATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAA 96

Query: 84  -------------------VEVHPSQS---VGASEKAESPP--DQTKSTVLYSEVCNLFQ 119
                              V   P QS   VG  E A S    D   S + YSEVC +F 
Sbjct: 97  PSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFN 156

Query: 120 QIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIK 179
           +IE  SSRL II++CS+FFI+++K +  ++I   YLFINR                  +K
Sbjct: 157 KIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMK 216

Query: 180 TISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATG 239
           TISE  GKS+ QIKL+ K+ GDLG IA  ARN+QPTMFKPKPLT+ +VF NL+ IA   G
Sbjct: 217 TISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQG 276

Query: 240 KDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEK 299
           KDSQL+K+KLIK+ML+A KG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLLH+  +E 
Sbjct: 277 KDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRED 336

Query: 300 GESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPL 359
              K    DV  MD++E A+ K+R+A CQVPNYEIVIN CL+ GI+N+DK CTLRPGIPL
Sbjct: 337 SPDK----DV-PMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPL 391

Query: 360 KPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPE 419
           KPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G MRIYSRNGENMTERYPE
Sbjct: 392 KPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPE 451

Query: 420 LDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVD 479
           +++ DF+               +   K++ILDCE VAWD +Q KILPFQVL+TRKRK+V+
Sbjct: 452 INITDFI-------------QDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498

Query: 480 LKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDEL 539
           L DVKV+VCLFAFD+L  N+E +INKSL+ER+E L KVT +VPGEFQYAT + T+++DEL
Sbjct: 499 LNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDEL 558

Query: 540 QTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYF 599
           Q FLD++V +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V+GAY+
Sbjct: 559 QKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYY 618

Query: 600 GKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIY 659
           G+GKRTG+YGGFLLGCYN+DT EFETCCKIGTGFSDEML  LH  L PT ID P  T+++
Sbjct: 619 GRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVF 678

Query: 660 DSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGT 719
           DSSAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SLRFPRFLRIREDK V D T
Sbjct: 679 DSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDAT 738

Query: 720 TSEDIIEFYESQSHIQN 736
           +S+ I+E YE+QSH+QN
Sbjct: 739 SSDQIVELYENQSHMQN 755

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/747 (60%), Positives = 538/747 (72%), Gaps = 78/747 (10%)

Query: 45  KKQATLARFFTSMGKKTP-----PAVEVATKQE----SPENHVDKK-------RKVEVHP 88
           +KQATLA+FF+SM  + P     P     T  E    SP     KK       R      
Sbjct: 29  QKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNLA 88

Query: 89  SQSVGASEKAESP------------PDQTK----------------------------ST 108
           S S G S+ A +P            PD  K                            S+
Sbjct: 89  SSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFSS 148

Query: 109 VLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXX 168
           + Y EVCNLFQ+IE TSSRLAIIKLCS+FFI+++K NP ++I V YLFIN+         
Sbjct: 149 IPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPGL 208

Query: 169 XXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVF 228
                    +KTISE+ GKS+ Q++ + +E GDLG IA DARN+QPTMFKPKPLT+ +VF
Sbjct: 209 ELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVF 268

Query: 229 NNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSK 288
            NL+ IA + GKDSQ RKIKLIK+ML+A +G EAKFLIRSLESKLRIGLAEKTVLISLSK
Sbjct: 269 ENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSK 328

Query: 289 ALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNID 348
           ALL+HE    K    FD      M+L+E AE K+R+A CQVPNYEIVIN CL+ GI+ ++
Sbjct: 329 ALLVHEC---KDNKDFD------MELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELE 379

Query: 349 KTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSR 408
             C+LRPGIPLKPMLAKPTKAI E+L+ FQG+ F SEYKYDGERAQVHLL  G MRIYSR
Sbjct: 380 THCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSR 439

Query: 409 NGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQ 468
           NGENMTERYPE+ ++DF+      +              +ILDCE VAWD EQ KILPFQ
Sbjct: 440 NGENMTERYPEIHIRDFIADPLVTST-------------LILDCEAVAWDNEQNKILPFQ 486

Query: 469 VLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYA 528
           VL+TRKRK+VDLKDVKV+VCLFAFD+L  N+E +INKSLRER++IL++VT  V GEFQYA
Sbjct: 487 VLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYA 546

Query: 529 TSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGD 588
           T + +S++DELQ FLDQ+V +SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+G+GD
Sbjct: 547 TEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGD 606

Query: 589 SLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPT 648
           SLDL V+GAY+G+GKRTG YGGFLLGCYN+DT EFETCCKIGTGFSDEML  L+T L PT
Sbjct: 607 SLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPT 666

Query: 649 EIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR 708
            +D P  T++YDSSAEPDVWF+  +LFEVLTADLSLSP+YKAG+S YDKGISLRFPRF+R
Sbjct: 667 VLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIR 726

Query: 709 IREDKDVTDGTTSEDIIEFYESQSHIQ 735
            REDK V D T+SE IIE YE+Q+H Q
Sbjct: 727 TREDKGVEDATSSEQIIELYENQAHTQ 753

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/718 (61%), Positives = 540/718 (75%), Gaps = 47/718 (6%)

Query: 45  KKQATLARFFTSM-----GKKTPPAVEVATKQESPENH-VD------KKRKVEVHPSQSV 92
           K+QATLARFF+S+     G K     +V T      +H VD      KK K+E   S + 
Sbjct: 28  KRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGSLTA 87

Query: 93  ------GASEKAESP----PDQTKST----VLYSEVCNLFQQIEETSSRLAIIKLCSEFF 138
                 G  E   +P    P Q  S     V YS++CNLF++IE TSSRLAIIKLCS+FF
Sbjct: 88  TKNGNQGKEEHEGTPIASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFF 147

Query: 139 IRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKE 198
           I+++K +P ++I V YLFIN+                  +KTISE+ GKS++QIK + +E
Sbjct: 148 IKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYRE 207

Query: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258
            GDLG IA +ARN+QPTMFKPKPL + +VF NLK IA + GKDSQ +K+KLIK+ML+A +
Sbjct: 208 IGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQ 267

Query: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318
           G EAKFLIRSLESKLRIGLAEKTVLI+LSKALL+H+      E         SMD++EQA
Sbjct: 268 GTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEP--------SMDVVEQA 319

Query: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378
           E K+R+A CQVPNYE+VIN CL  GI+ +D+ CT++PGIPLKPMLAKPTKAI EVL+ FQ
Sbjct: 320 EQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQ 379

Query: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438
           G+ F SEYKYDGERAQVHLL+ G MRIYSRNGENMTERYPE+ +KDFL    + T+    
Sbjct: 380 GQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTS---- 435

Query: 439 ENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLN 498
                    +ILDCE VAWD EQ KILPFQVLTTRKRK+V++ +VKVRVCLFAFD+L  N
Sbjct: 436 ---------LILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHN 486

Query: 499 NEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKM 558
           +  +IN+ L +R+E+L +VT  V GEFQYAT + TS++DELQ FLD++VKNSCEGLMVKM
Sbjct: 487 DMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKM 546

Query: 559 LDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNE 618
           +DG ES+YEPSKRSRNWLKLKKDYL+GVGDSLDL V+GAYFG+GKRTG+YGGFLLGCYN 
Sbjct: 547 MDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNA 606

Query: 619 DTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVL 678
           D+++FETCCKIGTGFS+EML  L+  L PT ID P  TY++DSSAEPDVWF+  +LFEVL
Sbjct: 607 DSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVL 666

Query: 679 TADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736
           TADLSLSP+YKAG+S YDKGISLRFPRFLRIR+DK V D T+SE IIE Y++QSH+ N
Sbjct: 667 TADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN 724

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/736 (61%), Positives = 538/736 (73%), Gaps = 69/736 (9%)

Query: 45  KKQATLARFFTSMGKKTPP---AVEVATKQESPENHVD--------KKRKVEVHPSQSVG 93
           K+QATL RFF+S+  K P    A++  +K+E+ E + D        K R      S S+ 
Sbjct: 49  KQQATLGRFFSSINHKKPTKDTALKNESKEETKEENKDDSDSIPRKKIRLSTSSSSPSIM 108

Query: 94  ASEKAESP------------------------PDQTKS-----------TVLYSEVCNLF 118
           A  K +SP                         D T              + Y EVC LF
Sbjct: 109 AESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYKEVCQLF 168

Query: 119 QQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXI 178
           Q+IE TSSRL+IIKLCS+F I+++K +P ++I V YLFIN+                  +
Sbjct: 169 QEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLM 228

Query: 179 KTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASAT 238
           KTISE+ GKS+ QI+ + +E GDLG IA +ARN+QPTMFKPKPLT+ +VFNNLK IA A 
Sbjct: 229 KTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMIAKAA 288

Query: 239 GKDSQLRKIKLIKQMLSASK-GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWK 297
           GKDSQ +KIKLIK+ML+A + G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL+ E   
Sbjct: 289 GKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVKE--- 345

Query: 298 EKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGI 357
                 FD      M+L+E AE K+R+A CQVPNYEIVIN CLQ GI+N+++ C+LRPGI
Sbjct: 346 ------FDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGI 399

Query: 358 PLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERY 417
           PLKPMLAKPTKAI E+L+ FQG+ F SEYKYDGERAQVHLLE G MRIYSRNGENMTERY
Sbjct: 400 PLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERY 459

Query: 418 PELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKN 477
           PE+ + DF      + +  E        K +ILDCE VAWD EQ+KILPFQVL+TRKRK+
Sbjct: 460 PEIHIGDF------VKDRNE-------TKTLILDCEAVAWDKEQQKILPFQVLSTRKRKD 506

Query: 478 VDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMD 537
           V  KDVKVRVCLFAFD+L  N+  +IN SL+ER+EIL +VT   PGEFQYAT L TS++D
Sbjct: 507 VLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLD 566

Query: 538 ELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGA 597
           ELQ FLDQ+V +SCEGLMVKML+GEESHYEPSKRSRNWLKLKKDYL+G+GDSLDL V+GA
Sbjct: 567 ELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGA 626

Query: 598 YFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTY 657
           Y+G+GKRTG+YGGFLLGCYN++T EFETCCKIGTGFSDEML  LH  L+ T ID P  TY
Sbjct: 627 YYGRGKRTGTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATY 686

Query: 658 IYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTD 717
           IYDSSAEPDVWF+  +LFEVLTADLSLSP+YKAG+S YDKG+SLRFPRF+RIREDK V D
Sbjct: 687 IYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVED 746

Query: 718 GTTSEDIIEFYESQSH 733
            T+SE IIE YE+QSH
Sbjct: 747 ATSSEQIIELYENQSH 762

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/716 (60%), Positives = 538/716 (75%), Gaps = 41/716 (5%)

Query: 32  LYTRTMSNSLEPSKKQATLARFFTSMGKKTPPA-----VEVATKQESPENHVDKKRKVEV 86
           +Y+  MS++   SK+QATLARFFTS+    P A        ++    P +          
Sbjct: 21  IYSGIMSSN---SKRQATLARFFTSI---KPSADDQNSKTSSSPVPPPSSSSSSTTANGS 74

Query: 87  HPSQSVGASEKAESPPDQTKSTVL--------YSEVCNLFQQIEETSSRLAIIKLCSEFF 138
            P +    S    S  D +++TV         Y++VC LFQ+IE  SSRL IIKLCSEFF
Sbjct: 75  SPLKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFF 134

Query: 139 IRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKE 198
            + +K N +++I + YLFIN+                  +KTISE+ GKS++Q+KL+ K+
Sbjct: 135 TKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKD 194

Query: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258
            GDLGTIA +ARN+QPTMFKPKPLT+  VF NLK IA ++GKDSQL+KI+LIK++L+A K
Sbjct: 195 IGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACK 254

Query: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318
           G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL++E+      +  D +    M+LIE+A
Sbjct: 255 GIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEY-----NNTLDPD----MELIEKA 305

Query: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378
           E K+R+A CQ+PNYEIVIN CL+ GI+N+D+ C+LRPGIPLKPMLAKPTK I EV + FQ
Sbjct: 306 EQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQ 365

Query: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438
              F SEYKYDGERAQVHL+  G MRIYSRNGENMTERYPE++V DF+            
Sbjct: 366 NIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFI------------ 413

Query: 439 ENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLN 498
              +   K +I+DCE VAWD E+KKILPFQVL+TRKRK+VD+KD+KVR+CLFAFD+L  N
Sbjct: 414 -KDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHN 472

Query: 499 NEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKM 558
           +E +INKSLRER+EIL  VT  V GEF YA  L T+++DELQ FLDQ+VK+SCEGLMVK+
Sbjct: 473 DEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKV 532

Query: 559 LDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNE 618
           LDGE+SHYEPSKRSRNWLKLKKDYLDGVGDSLDL V+GA++G+GKRTG+YGGFLLGCYN+
Sbjct: 533 LDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQ 592

Query: 619 DTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVL 678
           DT EFET CKIGTGFSDE+L +L+  L+ T ID P  TYIYDSSA+PDVWF+  +LFEVL
Sbjct: 593 DTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVL 652

Query: 679 TADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734
           TADLS+SP+YKAG S Y KGISLRFPRF+R+REDK V + T+SE IIE YE+QSH+
Sbjct: 653 TADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/726 (59%), Positives = 540/726 (74%), Gaps = 56/726 (7%)

Query: 45  KKQATLARFFTSMGKK--------TPPAVE---------VATKQESPEN----------- 76
           K+Q TL  FFTS+ K         TP  +E           T +E  EN           
Sbjct: 22  KRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEEKHENMDVDTDPVISS 81

Query: 77  -HVDKKRKVEV---HPSQSVGASEKAESPPDQTK---STVLYSEVCNLFQQIEETSSRLA 129
             V  KR   +    P+  V    K +   + TK   STV Y+++CNLFQ+IE  SSRLA
Sbjct: 82  SEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLA 141

Query: 130 IIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSI 189
           IIKLCS F I V+K +P ++I + YLFIN+                  IKTI+E+ G+S+
Sbjct: 142 IIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSL 201

Query: 190 KQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKL 249
           +QIK +  E GDLG IA +AR +QPTMFKPKPLT+ +VF NLK IAS+ GKDSQ +KIKL
Sbjct: 202 QQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKL 261

Query: 250 IKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDV 309
           IK+ML++ +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALL++E+    GES   ++D+
Sbjct: 262 IKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEY----GES---DKDI 314

Query: 310 ESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKA 369
           + M+ +E AE K+R+A CQVPNYE+VI+ CL+ GI+N+D+ C+LRP IPLKPMLAKPTK+
Sbjct: 315 D-METVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKS 373

Query: 370 ITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVV 429
           I+E+ + FQ ++F  EYKYDGERAQVHLLE G MRIYSRNGENMTERYPE+ ++DF+   
Sbjct: 374 ISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFV--- 430

Query: 430 KAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCL 489
                       +   K +ILDCE VAWD EQ KILPFQVL+TRKRK+VD+ ++KVRVCL
Sbjct: 431 ----------TDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCL 480

Query: 490 FAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKN 549
           FAFD+L  N+E +INKSL+ER++IL  +T  V GEFQ+AT + T++++ELQ+FLDQ+VKN
Sbjct: 481 FAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKN 540

Query: 550 SCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYG 609
           SCEGLMVKML+GEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+GAYFG+GKRTG+YG
Sbjct: 541 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYG 600

Query: 610 GFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWF 669
           GFLLGCYN+DT EFET CKIGTGFSDE+L  LH  L+ T ID P  TY++D SAEPDVWF
Sbjct: 601 GFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWF 660

Query: 670 QAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYE 729
           +  +LFEVLTADLSLSPVYKAG+S YDKG+SLRFPRFLR+REDK V D T+SE I+E YE
Sbjct: 661 EPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYE 720

Query: 730 SQSHIQ 735
           +Q+++Q
Sbjct: 721 NQANLQ 726

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/746 (58%), Positives = 541/746 (72%), Gaps = 66/746 (8%)

Query: 25  RFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKKTPPAVEVAT---------KQESPE 75
           RFG A      T S+  +   KQATLA+FF+S+  +  P  + AT         K+ESP 
Sbjct: 15  RFGMA------TSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPV 68

Query: 76  NHVDKKRKVEVHPSQSVGAS----------EKAESPP----------------DQTKSTV 109
                +++       S G S          E A +P                 D   STV
Sbjct: 69  RSNSNEKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTV 128

Query: 110 LYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXX 169
            Y++VCN+FQ+IE TSSRL+IIK+CS+FF +++K +  +++   YLFIN+          
Sbjct: 129 PYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGME 188

Query: 170 XXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFN 229
                   +KTISE+ GKS+ Q+K   +E GDLG IA +ARN+QPTMFKPKPLT+ +VF 
Sbjct: 189 LGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFV 248

Query: 230 NLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKA 289
           NL+ IA+A GKDSQ +KIKLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTVLISLS A
Sbjct: 249 NLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNA 308

Query: 290 LLLHEHWKEKGESKFDEEDVESMD-LIEQAEAKLREAHCQVPNYEIVINLCLQDGILNID 348
           LL HE             DVE  D  +++AE  +R+A CQVPNYEIVIN CL+ GI  + 
Sbjct: 309 LLRHEQGL----------DVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLH 358

Query: 349 KTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSR 408
           K C L PGIPLKPMLAKPTKAITEVL+ FQG+ F+SEYKYDGERAQ+HLL  G MRIYSR
Sbjct: 359 KHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSR 418

Query: 409 NGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQ 468
           NGENMTERYPE+D++DFL       +D   E+       +ILDCE VAWD EQ KILPFQ
Sbjct: 419 NGENMTERYPEIDIRDFL-------SDPSTES-------LILDCEAVAWDKEQGKILPFQ 464

Query: 469 VLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYA 528
           VL+TRKRK+VD KDVKVRVCLFAFDLL  N E +INKSLRERQ+ L+KVT  V GEF+YA
Sbjct: 465 VLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYA 524

Query: 529 TSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGD 588
             LIT++++ELQ FLDQ+VK+SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGD
Sbjct: 525 NKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGD 584

Query: 589 SLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPT 648
           SLDL V+GAY+G+GKRTG+YGGFLLGCYN+DT E+ETCCKIGTGFS+E+L  L+  L+PT
Sbjct: 585 SLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPT 644

Query: 649 EIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR 708
            ++ P   Y+YDS+ +PDVWF+  +LFEVL ADLSLSPVYKAG+++YDKGISLRFPRFLR
Sbjct: 645 AMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLR 704

Query: 709 IREDKDVTDGTTSEDIIEFYESQSHI 734
           IR+DK V + T+SE +++ YE+Q+H+
Sbjct: 705 IRDDKSVEEATSSEQVVDLYEAQAHL 730

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/707 (58%), Positives = 529/707 (74%), Gaps = 40/707 (5%)

Query: 44  SKKQATLARFFTSMGKKTPPAVEVATKQESPENHVDKKRKVEVHPSQSVG------ASEK 97
           +KKQ TLARFF+S  K      E   + ++    VD     E+  +++V           
Sbjct: 11  TKKQVTLARFFSSAKKGG--NKEDKLEPQAKRAKVDPANTSELITNEAVARSVSPPTPVV 68

Query: 98  AESPPDQTKSTVL---------YSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSD 148
             +P   T + V+         YS+VCN+F +IE TSSRL+I+K+CS FF  V+K NPS+
Sbjct: 69  PVAPIISTSTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSN 128

Query: 149 IIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARD 208
           ++ + YLFINR                  +KTI+E+ GKS++Q++ + +E GDLG +A++
Sbjct: 129 LVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQE 188

Query: 209 ARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRS 268
           AR +QPTMFKPKPLT+ +VFNNLK IA + GKDSQ RKI+LIK+ML+A +G+EAKFLIRS
Sbjct: 189 ARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRS 248

Query: 269 LESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQ 328
           LESKLRIGLAEKTVLISLSKALL +EH  E+  S          +L+E AE ++R+A CQ
Sbjct: 249 LESKLRIGLAEKTVLISLSKALLSYEHDGEEPSS----------ELVENAEQRVRDAFCQ 298

Query: 329 VPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKY 388
           VPNYEIVIN CL+ GI+ ++K C L+PGIPLKPMLAKP+K+ITEVL+ F G++F  EYKY
Sbjct: 299 VPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKY 358

Query: 389 DGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDI 448
           DGERAQVHLL  G M IYSRNGENMTERYPEL ++D+L        D E  +++      
Sbjct: 359 DGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLA-------DPETTHSL------ 405

Query: 449 ILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLR 508
           ILDCE VAWD EQ KILPFQ+L+TRKRK V+ KDVKVRVCLFAFD+L  N + +IN SL 
Sbjct: 406 ILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLL 465

Query: 509 ERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEP 568
           ER+E L++V   V G+FQ+A  L +S+++++Q +L+Q+VK++CEGLMVK+L+GEESHYEP
Sbjct: 466 ERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEP 525

Query: 569 SKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCK 628
           SKRSRNWLKLKKDYL GVGDSLDL V+GAY+G+GKRTG+YGGFLLGCYN+DT EFETCCK
Sbjct: 526 SKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCK 585

Query: 629 IGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVY 688
           IGTGFSDEML +L+  L+P+ ++ P   Y+YDSSAEPDVWF+  +LFEVLTADLSLSP+Y
Sbjct: 586 IGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIY 645

Query: 689 KAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQ 735
           KAGNS Y KGISLRFPRF+RIR+DKDV D T+SE I+E YESQ ++Q
Sbjct: 646 KAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/736 (57%), Positives = 519/736 (70%), Gaps = 60/736 (8%)

Query: 35  RTMSNSLEPSKKQATLARFFTSMGK----KTPPAVEVATKQE------SPEN------HV 78
           RT+  S+  +KKQATLA+FF+S  +    K  P  E A K +       PE+      +V
Sbjct: 3   RTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQ-ESAKKSQLNAIDAKPESSKGSQPNV 61

Query: 79  DKKRKVEVHPSQSVGASEKAESPPDQTK--------------------STVLYSEVCNLF 118
           D+     +   Q   A  K E   +  K                    S V+YSE+C++F
Sbjct: 62  DETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVF 121

Query: 119 QQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXI 178
            +IE TSSRL I+KLCS+F   V+     D++ + YL IN+                  +
Sbjct: 122 NEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLM 181

Query: 179 KTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASAT 238
           KTISE+ GKS++Q+K   +E GDLG IA++AR++QPTMFKPKPLT   VF NL+ IA A 
Sbjct: 182 KTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQ 241

Query: 239 GKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKE 298
           GKDSQLRK++LIK+ML+A +G+EAKFLIRSLESKLRIGLAEK+VL++LSKA+L HEH  +
Sbjct: 242 GKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGK 301

Query: 299 KGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIP 358
           +  S          DL++ AE K+R+A CQVPNYEIVIN  L+ GI+ ++K C L PGIP
Sbjct: 302 EPSS----------DLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIP 351

Query: 359 LKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYP 418
           LKPMLAKP+K+I+EVL+ FQG+ F  EYKYDGERAQVHLL  G MRIYSRNGENMTERYP
Sbjct: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 411

Query: 419 ELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNV 478
           E+++ DF      + +  E          +ILDCE VAWD ++  ILPFQVL+TRKRK V
Sbjct: 412 EINISDF------VAHPDETHT-------LILDCEAVAWDKDKNVILPFQVLSTRKRKGV 458

Query: 479 DLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDE 538
             +DVKVRVCLFAFD+L  N+E +INKSL ER+  L ++   VPGE Q A+ + T  +DE
Sbjct: 459 VAEDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518

Query: 539 LQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAY 598
           +Q +LDQ+VK+ CEGLMVK+LDGEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+GAY
Sbjct: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 578

Query: 599 FGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYI 658
           +G+GKRTG+YGGFLLGCYN+DT EFETCCKIGTGFSDEML NL+  L PTEI  P   Y+
Sbjct: 579 YGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYV 638

Query: 659 YDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDG 718
           Y  SA+PDVW +  +LFEVLTADLSLSPVYKAG S Y KGISLRFPRF+RIR+DK V D 
Sbjct: 639 YSESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDA 698

Query: 719 TTSEDIIEFYESQSHI 734
           T+SE +IEFYESQSHI
Sbjct: 699 TSSEQVIEFYESQSHI 714

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/714 (57%), Positives = 509/714 (71%), Gaps = 49/714 (6%)

Query: 45  KKQATLARFFTSMGKKTPPAVEVATKQES----------PENH-------------VDKK 81
           KKQATL RFFT++ +    A   AT ++S          P  H              DK 
Sbjct: 5   KKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKP 64

Query: 82  RKVEVHPSQSVGASEKAESPP--DQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFI 139
               V P Q+  A  +A+S P      ++V+Y+++C +F+ +E TSSRL+I KLC++F  
Sbjct: 65  APGGVLP-QAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMY 123

Query: 140 RVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKET 199
            V+K +P  +I V YLFINR                  IKTIS+A GKS  Q++   +E 
Sbjct: 124 SVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYREC 183

Query: 200 GDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKG 259
           GDLGT+A+ AR +QPTMFKPKPLT+ DVF+ L+ IA A GKDSQ +KI+LIK+ML+A +G
Sbjct: 184 GDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQG 243

Query: 260 LEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAE 319
           +EAK+LIRSLESKLRIGLAEKTVL++LSKA+L HEH    G+    E+       ++ AE
Sbjct: 244 MEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH---DGKEPSPEQ-------VDAAE 293

Query: 320 AKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQG 379
           A +R+  CQVPNYE++IN  LQ GI+N+ + C L PGIPLKPMLAKPTK+ITEVL+ FQG
Sbjct: 294 ALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQG 353

Query: 380 KEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGE 439
           + F  EYKYDGERAQVHL+E G +RIYSRN ENMTERYPE+    FL       N Q   
Sbjct: 354 QRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL------ANPQT-- 405

Query: 440 NAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNN 499
                 + +I+DCE VAWD E++KILPFQVL+TRKRK V+LKDVKVRVCLFAFDLLYLN 
Sbjct: 406 -----TRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNG 460

Query: 500 EGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKML 559
           E ++  SL +R++ L  V  +VPGE Q+A  + T ++ ELQT+L+Q+V  SCEGLMVKML
Sbjct: 461 ESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKML 520

Query: 560 DGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNED 619
           DGEES YEPSKRSRNWLKLKKDYL+GVGDSLDL V+GAY+G+GKRTG+YGGFLLGCYN D
Sbjct: 521 DGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPD 580

Query: 620 TQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLT 679
            +EFETCCKIGTGFS+E+L +LH  L+ T I  P     YD S+ PDVWF+  +LFEVLT
Sbjct: 581 LEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLT 640

Query: 680 ADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSH 733
           ADLSLSPVYKAG   Y KGISLRFPRFLRIREDK VTD T+S+ I+EFY+ Q++
Sbjct: 641 ADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/700 (58%), Positives = 514/700 (73%), Gaps = 33/700 (4%)

Query: 36  TMSNSLEPSKKQATLARFFTSMGKKTPPAVEVATKQESPENHVDKKRKVEVHPSQSVGAS 95
           T+   L P+KKQ       ++M  +T  A  V  K ES  +++         P +S G +
Sbjct: 34  TLDGFLRPNKKQKVDEEGDSAMPDETAAAPPV--KSESSLSNIT--------PPKSRGET 83

Query: 96  EKAESPPDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYL 155
                   +  S + ++E+C+ FQ IE TSSRLAI  +CS+F   V++ +P  ++ + YL
Sbjct: 84  LTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYL 143

Query: 156 FINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPT 215
           FI++                  IKTISEA GKSI+QI+ + +E GDLG IA  ARN+QPT
Sbjct: 144 FIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPT 203

Query: 216 MFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRI 275
           MFKPKPLT+ +VFNNL  IA + GKDSQ RK  LIK+ML+A KG EAKFLIRSLESKLRI
Sbjct: 204 MFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRI 263

Query: 276 GLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIV 335
           GLAEKTVLIS+SKA+L HEH  ++           S +++EQAE+ +R+A CQVPNYE++
Sbjct: 264 GLAEKTVLISVSKAILTHEHNGQE----------PSTEMVEQAESLIRDAFCQVPNYEMI 313

Query: 336 INLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQV 395
           IN+ LQ GI+N+++   LRPGIPL+PMLAKPTK+I+EVL+ FQG +F  EYKYDGERAQV
Sbjct: 314 INVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQV 373

Query: 396 HLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVV 455
           HL   G M+IYSRNGE+MTERYPE+DVK ++  + A              K  I+D E V
Sbjct: 374 HLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGA-------------TKSFIVDSEAV 420

Query: 456 AWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILR 515
           AWD EQ KILPFQVL+TRKRK V+LKDVKVRVCL+AFD+L LN+E +INKS  ER++IL 
Sbjct: 421 AWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILL 480

Query: 516 KVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNW 575
                  G+F +A  L T++ DELQ +LDQ+VK+SCEGLMVKML+GEESHYEPSKRSRNW
Sbjct: 481 DTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNW 540

Query: 576 LKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSD 635
           LKLKKDYL+GVGDSLDLVV+GAY+G+GKRTG+YGGFLLGCYN D++EFETCCKIGTGFSD
Sbjct: 541 LKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSD 600

Query: 636 EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRY 695
           EML +L+T L+ T +++P    IYDSSA  DVWF+  +LFEVLTADLSLSPVYKAG   +
Sbjct: 601 EMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAF 660

Query: 696 DKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQ 735
            KGISLRFPRF+RIR+DK+VTD T+S+ +IEFYESQ+H++
Sbjct: 661 GKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/658 (59%), Positives = 484/658 (73%), Gaps = 30/658 (4%)

Query: 79  DKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFF 138
           D+  K  V  ++   A   A +P D   S +LY+E+CN+F +IE TSSRL I+KLC +F 
Sbjct: 93  DEPAKRAVAATKGDPAKLGASAPKD---SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFL 149

Query: 139 IRVIKNNPSDIIIVAYLFINRXXXXXXXXXXXXXXXXXXIKTISEAYGKSIKQIKLELKE 198
             V+     DI+ + YL IN+                  +KTISE+ GKS++QIK   +E
Sbjct: 150 YSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRE 209

Query: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258
            GDLG IA++AR +QPTMFKPKPLT  +VF+NL+ IA + GKDSQLRK++LIK+ML+A +
Sbjct: 210 LGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ 269

Query: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318
           GLEAKFLIRSLESKLRIGLAEK+VL++LSKALL +EH  ++  S          +L++ A
Sbjct: 270 GLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNGKEPSS----------ELVDTA 319

Query: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378
           E K+R+A CQVPNY+IVI   L+ GI+ +DK C L PGIPLKPMLAKP+K+I+EVL+ FQ
Sbjct: 320 EQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQ 379

Query: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438
           G+ F  EYKYDGERAQVHLL  G MRIYSRNGENMTERYPE+ + DF+            
Sbjct: 380 GQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIA----------- 428

Query: 439 ENAIQPVKD--IILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLY 496
                P +   +ILDCE VAWD E+  ILPFQVL+TRKRK V ++DVKVRVCLFAFD+L 
Sbjct: 429 ----DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILC 484

Query: 497 LNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMV 556
            N+E +I + L ER+  L +  V VPGE Q A+ + T  +DELQ +LDQAV++ CEGLMV
Sbjct: 485 YNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMV 544

Query: 557 KMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCY 616
           K+L+GEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+GAY+G+GKRTG+YGGFLLGCY
Sbjct: 545 KILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCY 604

Query: 617 NEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFE 676
           N+D+ E+ETCCKIGTGFS+EML  L   L PT I  P   Y++  SA PDVWF+  +LFE
Sbjct: 605 NQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFE 664

Query: 677 VLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734
           VLTADLSLSPVYKAG S Y KGISLRFPRF+R+R+DK   + T+SE ++EFYESQSH+
Sbjct: 665 VLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/753 (53%), Positives = 528/753 (70%), Gaps = 55/753 (7%)

Query: 1   MAIGRLQTTIFRQLSYCRPFVSSLRFGTASLLYTRTMSNSLEPSKKQATLARFFTSMGKK 60
           +A  R  +   R  S CR      R+      Y+ + +  L  SKKQ TLARFF    K+
Sbjct: 6   LAARRPLSVTCRHYSCCR-----CRY------YSFSPTLPLPMSKKQVTLARFF---AKR 51

Query: 61  TPPAVEVAT----KQESPENHVDKKRKVEVHPS--------QSVGASEKAESPPDQTK-- 106
            P   E  +    K++       ++ +V++ P         Q V  S +   P  ++K  
Sbjct: 52  EPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIVVPQEVTTSTQTPRPTKKSKPA 111

Query: 107 -STVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRXXXXXX 165
            S++ Y+++C LF+ IE  SSRL I  LC+ FF R ++ +PS ++ V YL IN+      
Sbjct: 112 TSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS 171

Query: 166 XXXXXXXXXXXXIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPT--MFKPKPLT 223
                        K I  A G S +Q+KL+ ++ GDLG +A   R +QPT  MFK +PLT
Sbjct: 172 GVELGLGEGLLL-KAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLT 230

Query: 224 ISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVL 283
           I+ VF+ L KIA++ GKDSQ +KI +IK++L++ +G+EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 231 ITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 290

Query: 284 ISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDG 343
            SL++AL++HE    KG     ++D  +      AE  ++++ CQ+PNYEI+I   LQ G
Sbjct: 291 TSLARALVIHE----KGNDNIQDDDYSN------AEQIIKDSFCQIPNYEIIITTSLQYG 340

Query: 344 ILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEM 403
           +  +     L PGIPLKPMLAKPTK+I+EVL+ FQ  +F SEYKYDGERAQVHLL  G M
Sbjct: 341 VSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSM 400

Query: 404 RIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKK 463
           RIYSRNGE+MT+RYPEL+++D+L  V + T  Q           +ILDCE VAWDVE +K
Sbjct: 401 RIYSRNGEDMTQRYPELNIQDYL--VDSTTTTQ-----------LILDCEAVAWDVELQK 447

Query: 464 ILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPG 523
           ILPFQVL+TRKRK+VDLKD+KVRVCLFAFD+L  NN+ +IN +LRER++IL  +T   PG
Sbjct: 448 ILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPG 507

Query: 524 EFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYL 583
           +FQ+AT L TS++DELQTFLD+A+K+SCEGLMVK LDG +SHYEPSKRSRNWLKLKKDYL
Sbjct: 508 QFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYL 567

Query: 584 DGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHT 643
            G+GDSLDL V+GAY+G+GKRTG+YGGFLL CYN+DT+EFETCCKIGTGFSDEML  L+ 
Sbjct: 568 QGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYN 627

Query: 644 LLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRF 703
            L+ T I++P   +++DSSAEPDVWF   ++FEVLTADLSLSP+YKAG++ Y KGISLRF
Sbjct: 628 GLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRF 687

Query: 704 PRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736
           PRF+RIR DK V D T+SE +I+FYE+QSH+Q+
Sbjct: 688 PRFIRIRTDKSVNDATSSEQVIDFYENQSHLQS 720

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/428 (26%), Positives = 186/428 (43%), Gaps = 69/428 (16%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           ++R G    P +A+  K   E ++   G +F  E K DG+R QVH ++ G  +  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470
            N T  Y E   K       +I+N  +    ++ VK+ ILD E+V++D E + ILPF + 
Sbjct: 347 INYTYLYGENSSKG------SISNHLK---FVEGVKECILDGEMVSYDKEMQCILPFGLT 397

Query: 471 TTRKRKNVDLK-----DVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEF 525
            +     V+ +     +   R     FDLLYLN + + N+ + +R+E L K+ +      
Sbjct: 398 KSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVV 457

Query: 526 QYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDG 585
              +    SD + +   L  AV +  EG+++K      S Y   KR  +W+K+K +YL+ 
Sbjct: 458 HLLSGPRCSDAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLEN 514

Query: 586 VGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE----------------------- 622
            G+++DLVV+      G+  G    F+      D  E                       
Sbjct: 515 FGENMDLVVI------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQ 568

Query: 623 -----FETCCKIGTGFSDEMLGNLHTLLQ----PTEIDNPPMTYIYDSSAEPDVWFQAK- 672
                F + C I  G S+E    +  L +    P +   PP  ++   +  P  W   K 
Sbjct: 569 PKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKN 628

Query: 673 -VLFEVLTADL----SLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEF 727
            V+ EV    +    S S +YK G++ Y+           RIR DK+ +  +T  +    
Sbjct: 629 SVVLEVKARSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTA 681

Query: 728 YESQSHIQ 735
            E++S+  
Sbjct: 682 REARSYFN 689

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 102/392 (26%), Positives = 174/392 (44%), Gaps = 44/392 (11%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNGENMT 414
           G    P LAK      E + +    +FI E K DGER Q+H + GG  ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474
             Y +   +  +     + +D         V+D +LD E+V++D ++K ILPF ++ +  
Sbjct: 322 HLYGQEVARGVISQYLKLKSD---------VRDCVLDGEMVSYDKKRKIILPFGIVKSAA 372

Query: 475 -----RKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYAT 529
                   V  ++   R     FDL+YLN   +    L  R+E L+++   VP   +   
Sbjct: 373 VDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILK 432

Query: 530 SLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS 589
            +   D   ++ F+ +A++   EG++VK      S YE   R+ +W+K+K +Y + +G++
Sbjct: 433 GIRACDAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGET 489

Query: 590 LDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE---------------TCCKIGTGFS 634
           +DLVV+G     GK+     G L+       + F                + C +  G S
Sbjct: 490 MDLVVIGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVS 547

Query: 635 DEMLGNLHTLLQPTEIDN----PPMTYIYDSSAEPDVWFQAK--VLFEVLTADLSLSPVY 688
           DE    ++   + + +      PP++ +   S  P  W   K  V+ EV    +  S   
Sbjct: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS--- 604

Query: 689 KAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720
           +  + RY  G +L      RIR DKD T  T+
Sbjct: 605 EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTS 636

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 109/428 (25%), Positives = 187/428 (43%), Gaps = 66/428 (15%)

Query: 359 LKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMTERY 417
            +P LAK      EVL+     +F  E K DGER Q+H ++ G +++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 418 PELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKN 477
            +   K    + K +  +++       VK+ ILD E+V++D  +  ILPF ++ +    +
Sbjct: 324 GK--DKSTATISKYLQLNED-------VKECILDGEMVSYDKSRNCILPFGMVKSGAANS 374

Query: 478 VDLKDVKVRVC---LFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITS 534
           + +  ++  +C      FD+L+LN   + N  L +R+E L  +        +     I  
Sbjct: 375 LKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAH 434

Query: 535 DMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVV 594
           D + +++ L  A+    EG+++K  D   S Y    R+ +W+K+K +YL+  G++LDL+V
Sbjct: 435 DSESIRSALQAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIV 491

Query: 595 MGAYFGKG----------KRTGSYGGFL------LGCYNEDTQ---------------EF 623
           +G   GK           +   SY   L      L   ++D+Q               +F
Sbjct: 492 IGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKF 551

Query: 624 ETCCKIGTGFSDEMLGNLHT----LLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VLFEV 677
            + C I  G S+E    +        +    + PP  Y+   +  P  W      V+ EV
Sbjct: 552 ISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEV 611

Query: 678 LTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDII----------EF 727
               L  +   +A   ++  G +L      RIR DKD  D  T  D++          E 
Sbjct: 612 KARSLENN---EALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSEL 668

Query: 728 YESQSHIQ 735
           Y + SHI+
Sbjct: 669 YGNHSHIK 676

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  112 bits (280), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 100/382 (26%), Positives = 171/382 (44%), Gaps = 54/382 (14%)

Query: 359 LKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNGENMTERY 417
            +P LAK T    E + +    +FI E K DGER Q+H +  GE ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 418 PELDVKDFLCVVKAITNDQEGENAIQP-------VKDIILDCEVVAWDVEQKKILPFQVL 470
            E              N   G   I P       VKD ILD E++ +D E+  +LPF ++
Sbjct: 307 GE--------------NSSSG--PISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLV 350

Query: 471 TTRKRKNVDLKDVKV------RVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGE 524
            +     +  +   +      +    AFDL+YLN + + N +L  R++ L K+   V   
Sbjct: 351 KSSAMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERS 410

Query: 525 FQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLD 584
            +    +   + + ++  L+QA+    EG+++K L    S Y    R+ +W+K+K +YL+
Sbjct: 411 VEIIQYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLE 467

Query: 585 GVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE--FETCCKIGTGFSDE------ 636
             G+++DL+++G    +GK+   + G  +   NE  ++  F + C I  G S+E      
Sbjct: 468 QFGENMDLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIE 525

Query: 637 --MLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VLFEVLTADLSLSPVYKAGN 692
               G  H   +    D P    +   +  P  W   +  V+ EV    +      ++  
Sbjct: 526 RKTWGKWHIFSE----DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEK 578

Query: 693 SRYDKGISLRFPRFLRIREDKD 714
            +Y  G +L F    +IR DKD
Sbjct: 579 RKYRSGCTLHFGYCKQIRYDKD 600

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  112 bits (280), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 105/396 (26%), Positives = 178/396 (44%), Gaps = 47/396 (11%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414
           G+P  P LAK      + +      +F  E K DGER Q+H ++ G +++ +SR G + T
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312

Query: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474
             Y E D+     V K +  D +       V++ +LD E++++D E+  +LPF ++ +  
Sbjct: 313 YLYGE-DIGTG-TVAKYLQLDPK-------VRECVLDGEMISFDTEENSVLPFGLVKSSA 363

Query: 475 RKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSL 531
           R ++  + +     R      D LYLN   +IN  L  R++ L  +    P   +   S+
Sbjct: 364 RDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSM 423

Query: 532 ITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLD 591
              D   +++ L++A+    EG+++K     +S YE   R+ NW+K+K +YL+  G++LD
Sbjct: 424 HCYDDTSIKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLD 480

Query: 592 LVVMGAYFGKGKRTGSYGGFLLG-----------CYNEDTQE----------FETCCKIG 630
           L+V+G   GK          L G             N D++E          F + C I 
Sbjct: 481 LLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIA 540

Query: 631 TGFSDEMLGNLHT----LLQPTEIDNPPMTYIYDSSAEPDVWF--QAKVLFEVLTADLSL 684
            G S E    +        + TE   PP    + S   P+ W   +  V+ EV    L  
Sbjct: 541 NGISQEEFKQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDN 599

Query: 685 SPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720
           +   ++   ++  G +L      RIREDK+ T+  T
Sbjct: 600 T---ESSGRKFKVGCTLHGGYCRRIREDKNWTECYT 632

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 103/421 (24%), Positives = 177/421 (42%), Gaps = 74/421 (17%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNG 410
           +++ G    P LAK      + ++     +F  E K DGER Q+H +  GE ++ +SR+G
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQ------PVKDIILDCEVVAWDVEQKKI 464
            + T  Y                ND+      +       VK+ +LD E+V +D   KK+
Sbjct: 328 TDYTYLY---------------GNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKV 372

Query: 465 LPFQVLTTRKRKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLV 521
           LPF ++ +     ++ KD+           FD+LYLN   +I+  L +R+E L  V    
Sbjct: 373 LPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPY 432

Query: 522 PGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKD 581
               +  +S+  +D  +++  LD A+    EG+++K      S Y P+ R  NW+K+K +
Sbjct: 433 KDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPE 489

Query: 582 YLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE----------------- 624
           YL+  G+++DL+V+G     GK+     G L+    E+ QE                   
Sbjct: 490 YLEEFGENMDLIVIGR--DSGKKDCLICGILV---TEEKQELSENMKRESEIEIISDSGD 544

Query: 625 ---------------TCCKIGTGFSDEMLGNLHTLLQPT----EIDNPPMTYIYDSSAEP 665
                          + C I  G S   L  ++ + +        + PP+  +   + +P
Sbjct: 545 DDLDTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKP 604

Query: 666 DVWF--QAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSED 723
             W   Q  V+ E+    L  +        +Y  G +L      +IR+DKD T   T  D
Sbjct: 605 VEWIYPQDSVVLEIKARSLDRT---DQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHD 661

Query: 724 I 724
           +
Sbjct: 662 L 662

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/395 (25%), Positives = 173/395 (43%), Gaps = 63/395 (15%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414
           G+   P LA       + +    G +F  E K DGER Q+H    G +++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 415 ERYPELDVKDFLCVVKAITNDQEGE-----NAIQPVKDIILDCEVVAWDVEQKKILPFQV 469
             Y                N + G      N  + VKD +LDCEVV +D   K +LPF +
Sbjct: 326 YLYG--------------NNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGM 371

Query: 470 LTTRKRKNVDLKDVKVR---VCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526
           + +  +  +    +  +     L  FD+LYLN   +++    +R+E L+++        +
Sbjct: 372 VKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIE 431

Query: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586
              S+  +D   ++  L++A+    EG+++K  D   S Y  + RS +W+K+K +YL+  
Sbjct: 432 IIKSIRANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQF 488

Query: 587 GDSLDLVVMGAYFGKGKRTGSYGGFLLGCYN------------------EDTQEFE---T 625
           G+++DLV+M      G+        +LG  +                  E++Q F    +
Sbjct: 489 GENMDLVLM------GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVS 542

Query: 626 CCKIGTGFSDEMLGNLHTLLQPTEIDN---PPMTYIYDSSAEPDVWFQAK--VLFEVLTA 680
            C I  G S+E    +    +    D+   PP+ Y+   S  P  W   K  ++ E+   
Sbjct: 543 LCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKAR 602

Query: 681 DLSLSPVYKAGNSRYDKGISLRFPRFLR-IREDKD 714
            L  +   ++   ++  G +L F  + R IREDK+
Sbjct: 603 SLDNT---RSSERKFAAGCTL-FGGYCRQIREDKN 633

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 179/409 (43%), Gaps = 67/409 (16%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           TL+ G    P LAK      E +    G +F  E K DGER Q+H ++ G E++  SR G
Sbjct: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307

Query: 411 ENMTERYP-ELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQV 469
            + T  Y  +       C +K   N          VK+ ILD E+V +D E++ ILPF +
Sbjct: 308 TDYTYLYGGDTSTGTIACYLKLNEN----------VKECILDGEMVTYDQEKQMILPFGL 357

Query: 470 LTTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526
           + +  +  +  + +          AFDL+YLN   +++  L +R++ L K+     G   
Sbjct: 358 VKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVD 417

Query: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586
             +    ++++ +   L  A+    EG+++K L+   S Y  + R+ +W+K+K  YL   
Sbjct: 418 IVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQF 474

Query: 587 GDSLDLVVMGAYFGKGKRTGSYGGFL--LGCYNEDTQ----------------------- 621
           G+++DL+++      G+  G    F+  LG   +D Q                       
Sbjct: 475 GENMDLIII------GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPET 528

Query: 622 -------EFETCCKIGTGFSD----EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQ 670
                  +F + C I  G S+    E+      L +  +   PP  Y+   + +P  W  
Sbjct: 529 PKASRIVKFVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWID 588

Query: 671 AK--VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR-IREDKDVT 716
            K  ++ EV +  L  +   ++   +Y  G++L F  + R +R DKD T
Sbjct: 589 PKESLVLEVKSRSLDNT---ESNVKKYRAGVTL-FGGYCRAVRYDKDWT 633

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 126/252 (50%), Gaps = 18/252 (7%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414
           G    P LAK      E + A   ++FI E K DGER Q+H +E G ++R  SR G + T
Sbjct: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335

Query: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474
             Y +      +       ND         V+D +LD E+V++D E+  +LPF ++ +  
Sbjct: 336 HLYGDSLEHGVISQHLKFKND---------VQDCVLDGEMVSFDKEKNVVLPFGIVKSTA 386

Query: 475 RKNVDLKDVKV-----RVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYAT 529
            + +   D KV     R     FDL+YLN   +    L  R+  LR +   V    +  +
Sbjct: 387 MEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILS 446

Query: 530 SLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS 589
            +  S+ + ++  L++A++   EG+++K      S YE   R+ +W+K+K +Y + +G++
Sbjct: 447 DVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWIKIKPEYFEELGET 503

Query: 590 LDLVVMGAYFGK 601
           +DLVV+G   GK
Sbjct: 504 MDLVVIGRDPGK 515

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/400 (25%), Positives = 168/400 (42%), Gaps = 54/400 (13%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNG 410
            + PG    P LAK      E +      +FI E K DGER Q+H  + GE ++ +SR G
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470
            + T  Y E     F+     +  D         VKD ILD E++ +D  Q  ILPF ++
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKD---------VKDCILDGEMITYDKTQNMILPFGLV 365

Query: 471 TTRKRKNV---DLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527
            +  R  +    + +   +     FDL+++N   + N  L  R+E L  +    P   + 
Sbjct: 366 KSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIEL 425

Query: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587
            +S    + D ++  L+ A+    EG+++K  D   S Y  + R+ +W+K+K +YL+  G
Sbjct: 426 LSSYHRFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFG 482

Query: 588 DSLDLVVMGAYFGKGKRTGSYGGFL---------LGCYNEDT------------------ 620
           +++DL+V+G     GK+     G           L   N+D                   
Sbjct: 483 ENMDLIVIGR--DPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTI 540

Query: 621 QEFETCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VL 674
            +F + C I  G S E    +      L   ++   PP T +   +  P  W   K  V+
Sbjct: 541 HKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVV 600

Query: 675 FEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKD 714
            EV    +  +   ++   ++  G +L       IREDKD
Sbjct: 601 IEVKARSIDAA---ESNGRKFATGCTLYGGYCRGIREDKD 637

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 173/422 (40%), Gaps = 66/422 (15%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           T++ G    P LAK      E +      +F+ E K DGER QVH +  G  +R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPF--- 467
            + T  Y        +      T++         V++ +LD E+V +D  +K ILPF   
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDN---------VRECVLDGEMVTFDARRKVILPFGLV 357

Query: 468 -----QVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVP 522
                  L+     NVD   + V      FDLLYLN   +    L +R+E L  +   V 
Sbjct: 358 KGSAKDALSFNSINNVDFHPLYV-----VFDLLYLNGTSLTPLPLHQRKEYLESILTPVK 412

Query: 523 GEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDY 582
              +   +    +++ ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +Y
Sbjct: 413 NVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEY 469

Query: 583 LDGVGDSLDLVVMGAYFGKGKRTGSYGGFLL---------------GCYNEDTQE----- 622
           L+  G++LDLV++G     GK+     G LL               G  N    E     
Sbjct: 470 LEEFGENLDLVIIGR--DPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYS 527

Query: 623 ------FETCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK 672
                   + C +  G S E    +        + T    PP +     S  P  W +  
Sbjct: 528 QKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPN 587

Query: 673 --VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYES 730
             ++ E+ +  L  +   +    +Y    +L      RIR DKD TD  T   + E Y+S
Sbjct: 588 ESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKDWTDCFT---LNELYDS 641

Query: 731 QS 732
           +S
Sbjct: 642 RS 643

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/378 (25%), Positives = 176/378 (46%), Gaps = 50/378 (13%)

Query: 381 EFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGE 439
           +F  E K DGER Q+H +  G +++  SR G + +  Y   D ++   + + +       
Sbjct: 298 DFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYG--DNRNNGAIGRYL------- 348

Query: 440 NAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVK---VRVCLFAFDLLY 496
           N  + VK+ ILD E+V +D  +  ILPF ++ +   +++ + D++         AFDL+Y
Sbjct: 349 NFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVY 408

Query: 497 LNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMV 556
           LN   +    L +R+  L K+ +  P   +   +L  +D   +++ L++A++   EG+++
Sbjct: 409 LNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIIL 468

Query: 557 KMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCY 616
           K  D   S Y  +KRS +W+K+K +YL+  G+++DL+V+G     GK+     G +L   
Sbjct: 469 KRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR--DPGKKDSLMCGLILTGD 523

Query: 617 NE---------------------DTQEFETCCKIGTGFSDEMLGNL--HTLLQPTEIDN- 652
           NE                     D ++  + C I  G S +   ++  +T     + D+ 
Sbjct: 524 NEPEEITSLDSNPTDTAESFLKPDKRKIISFCNIANGISQKEFRDIDRYTFGHWIKFDDE 583

Query: 653 -PPMTYIYDSSAEPDVWF--QAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR- 708
            PP       +  P  W   +  V+ E+    L  +   ++   +Y  G +L F  + R 
Sbjct: 584 LPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETN---ESARIKYGTGSTL-FGGYCRQ 639

Query: 709 IREDKDVTDGTTSEDIIE 726
           IR DKD     T  + +E
Sbjct: 640 IRYDKDWVSCFTYNEFME 657

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 99/406 (24%), Positives = 170/406 (41%), Gaps = 67/406 (16%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414
           G    P LAK      E +      +F+ E K DGER QVH ++ G ++R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 415 ERYPELDVKDFLCVVKAITNDQEGE-----NAIQPVKDIILDCEVVAWDVEQKKILPFQV 469
           + Y E              N Q G      N    V+D +LD E++ +D ++  +LPF +
Sbjct: 328 QLYGE--------------NLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGM 373

Query: 470 LTTRKRKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526
           + +  R+ +  + +     R  L   DL+YLN   +I   L +R+E L +V    P   +
Sbjct: 374 VKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVE 433

Query: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586
               +  S+   ++  L++++    EG+++K     ++ YE   R+  W+K+K +YL+  
Sbjct: 434 ILPYVRCSEHTAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQF 490

Query: 587 GDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE---------------------- 624
           G++LDLV++G     GK+     G  +    ED  E E                      
Sbjct: 491 GENLDLVIIGR--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDG 548

Query: 625 --------TCCKIGTGFSDEMLGNLHTLLQPTEIDN----PPMTYIYDSSAEPDVWFQAK 672
                   + C I  G S +    +    +   + +    P    +   S  P+ W   K
Sbjct: 549 KKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPK 608

Query: 673 --VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVT 716
             ++ EV    L  +   ++   ++  G +L      RIR+DKD T
Sbjct: 609 NSIMLEVKARSLDNT---ESSKKKFAAGCTLHGGYCRRIRDDKDWT 651

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 179/425 (42%), Gaps = 64/425 (15%)

Query: 348 DKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIY 406
           D   +++ G    P LAK      E +      +F+ E K DGER QVH +  GE ++ +
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 407 SRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILP 466
           SR G + T  Y           + + T  Q        VK+ +LD E+V +D +++ ILP
Sbjct: 303 SRRGIDYTYLYG--------ASLSSGTISQHLR-FTDSVKECVLDGEMVTFDAKRRVILP 353

Query: 467 FQVLTTRKRKNVD---LKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPG 523
           F ++    ++ +    + +V        FDLLYLN   +    L +R++ L  +   +  
Sbjct: 354 FGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKN 413

Query: 524 EFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYL 583
             +   S     ++ ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +YL
Sbjct: 414 IVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYL 470

Query: 584 DGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE------------------- 624
           +  G++LDL+V+      G+ +G    F+LG    D +E++                   
Sbjct: 471 EEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHI 524

Query: 625 -----------TCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWF 669
                      + C I  G S E    +        + T    PP + +   S  P  W 
Sbjct: 525 QNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWI 584

Query: 670 QA--KVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEF 727
                ++ E+ +  L  +   +    +Y    +L      RIR DK+ TD  T  D+   
Sbjct: 585 DPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDL--- 638

Query: 728 YESQS 732
           YES++
Sbjct: 639 YESRT 643

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 129/277 (46%), Gaps = 22/277 (7%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           +++ G    P LAK      E +      +F+ E K DGER QVH +  G  ++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470
            + T  Y        +     +TN          VK+ +LD E+V +D  +K ILPF ++
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTN---------TVKECVLDGEMVTFDSTRKVILPFGLV 357

Query: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527
               +  +   D+     R     FDLLYLN   +    L +R++ L  +        + 
Sbjct: 358 KGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEI 417

Query: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587
             S    D+  ++  L+ A+    EG+++K  +   S Y  + R+ NW+K+K +YL+  G
Sbjct: 418 VQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFG 474

Query: 588 DSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE 624
           ++LDL+++      G+ +G    F+LG    D +E E
Sbjct: 475 ENLDLIII------GRDSGKKDSFMLGLLVIDEREME 505

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 126/254 (49%), Gaps = 16/254 (6%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           T+  G P  P  AK      E + A    +F  E K DGER Q+H  + G ++   SR G
Sbjct: 263 TINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRG 322

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470
            + T  Y E  +KD   V K +  D         V++ +LD E+V +D E+  +LPF ++
Sbjct: 323 TDYTYLYGE-SIKDG-TVSKYLHLDNN-------VQNCVLDGEMVTFDKERNALLPFGLV 373

Query: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527
            +  R  +  + V     R  L  FDL+YLN   ++N  L +R+  L K+        + 
Sbjct: 374 KSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVEL 433

Query: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587
             S   SD   ++  L+ A+    EG+++K  +   S Y  + R+ +W+K+K +YL+  G
Sbjct: 434 LRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFG 490

Query: 588 DSLDLVVMGAYFGK 601
           +++DL+V+G   GK
Sbjct: 491 ENMDLIVIGKDPGK 504

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 173/423 (40%), Gaps = 62/423 (14%)

Query: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410
           +++ G    P LAK      E +      +F  E K DGER QVH +  G  ++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470
            + T  Y    +   +      ++          VK+ +LD E+V +D  +K ILPF ++
Sbjct: 307 IDYTYLYGVNLLSGTISQYLKFSDS---------VKECVLDGEMVTFDAMRKVILPFGLV 357

Query: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527
               ++ +   D+           FDLLYLN   +    L +R+E L  + +      + 
Sbjct: 358 KGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEI 417

Query: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587
                  D + ++  L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G
Sbjct: 418 VRYSRCYDAESVKKSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFG 474

Query: 588 DSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE------------------------- 622
           ++LDL+++      G+ +G    F+LG    D QE                         
Sbjct: 475 ENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNP 528

Query: 623 ------FETCCKIGTGFSDEMLGNL----HTLLQPTEIDNPPMTYIYDSSAEPDVWFQA- 671
                   + C I  G S E    +        + T   +PP + +   S  P  W +  
Sbjct: 529 KKRVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPS 588

Query: 672 -KVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYES 730
             ++ E+ +  L  +   +    +Y    +L      RIR DKD T+  T +++ E   +
Sbjct: 589 ESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRT 645

Query: 731 QSH 733
           +S+
Sbjct: 646 KSN 648

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 96/398 (24%), Positives = 167/398 (41%), Gaps = 57/398 (14%)

Query: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414
           G    P LAK      + +      +F  E K DGER Q+H ++ G +++  SR G + T
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310

Query: 415 ERYPE-LDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTR 473
             Y E L      C +K +  D         VK+ +LD E+V +D +Q  +LPF ++ + 
Sbjct: 311 YLYGENLSTGTIACYLK-LNRD---------VKECVLDGEMVTYDEDQDILLPFGMVKSA 360

Query: 474 KRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATS 530
               +  +++        L  FDL++LN   ++   L +R++ L  V        Q    
Sbjct: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420

Query: 531 LITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSL 590
              S+ + ++  L+ A+    EG+++K  +   S Y    R+ +W+K+K +YL+  G+++
Sbjct: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENM 477

Query: 591 DLVVMGAYFGKGKRTGSYGGFLL--------------GCYN--EDTQEFE---------- 624
           DL+V+G      K+   Y G  +              G  N   D  ++E          
Sbjct: 478 DLIVIGR--DSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKK 535

Query: 625 --TCCKIGTGFSD----EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VLFE 676
             + C I  G S     E+        + TE   PP   I   +  P  W + +  V+ E
Sbjct: 536 VVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLE 595

Query: 677 VLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKD 714
           +    L  +   ++   R+  G +L      RIR+D D
Sbjct: 596 IKARSLDNT---ESSCKRFKAGCTLYGGYCRRIRDDVD 630

>Skud_8.215 Chr8 complement(370644..372224) [1581 bp, 526 aa] {ON}
           YHR151C (REAL)
          Length = 526

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 413 MTERYPELDVKDFL-CVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLT 471
           +  R+   D+K+++ C V  I ++    N +  + DII +  V +WDV Q  +      T
Sbjct: 282 LDSRFNSADIKEYISCGVSPIISNPSYINNVTQLADIIHEGSVWSWDVNQPSV------T 335

Query: 472 TRKRKNVDLKD 482
           +   K+ DL D
Sbjct: 336 SSTSKSGDLSD 346

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 178 IKTISEAYGKSIKQIKLELK-ETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIAS 236
           IK   EA+ +S+   + E+K E GD+   + D +        P P    + F    K A 
Sbjct: 709 IKDSIEAHRESLAAAEAEVKTEGGDVDMTSEDVKKEPVETVDPVPYITREHFAEAMKTAK 768

Query: 237 ATGKDSQLRKIKLIKQMLSASKGLEAKF 264
            +  D++LR+ +   Q + AS+G  + F
Sbjct: 769 RSVSDAELRRYEAYSQQMKASRGQFSNF 796

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,664,160
Number of extensions: 3266491
Number of successful extensions: 10618
Number of sequences better than 10.0: 60
Number of HSP's gapped: 10858
Number of HSP's successfully gapped: 64
Length of query: 736
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 619
Effective length of database: 40,065,477
Effective search space: 24800530263
Effective search space used: 24800530263
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)