Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D045607.342ON4872409281e-120
TDEL0C020507.342ON5012486902e-84
Smik_4.757.342ON4602456794e-83
Skud_4.947.342ON4472456705e-82
YDL161W (ENT1)7.342ON4542456681e-81
KAFR0L014607.342ON5502626691e-80
ZYRO0F11550g7.342ON5382466574e-79
Suva_4.837.342ON4622456481e-78
NCAS0H006707.342ON4832586492e-78
Skud_12.2707.342ON6262766426e-76
TBLA0E004807.342ON5992736242e-73
Suva_10.3007.342ON6182656172e-72
Kpol_2001.707.342ON5332436103e-72
KNAG0C038007.342ON4472596019e-72
Smik_12.2647.342ON6122676051e-70
CAGL0A03872g7.342ON5102545981e-70
Kwal_56.246107.342ON5082615972e-70
YLR206W (ENT2)7.342ON6132016023e-70
SAKL0F10934g7.342ON4982525936e-70
NDAI0D006107.342ON4861895901e-69
KLTH0H01430g7.342ON5022595892e-69
KLLA0C16731g7.342ON4782475621e-65
KAFR0B008907.342ON4142485441e-63
Ecym_47317.342ON5142565422e-62
KNAG0B026507.342ON6462285282e-59
TBLA0E020407.342ON7012535068e-56
ACL157C7.342ON5152554951e-55
Kwal_47.168574.346ON3821352227e-19
TBLA0E047604.346ON4261332183e-18
KLTH0D16896g4.346ON4011352164e-18
SAKL0G17952g4.346ON4151352165e-18
KNAG0M003804.346ON4031352156e-18
NDAI0D032004.346ON4351352166e-18
TDEL0D007104.346ON3751352147e-18
KLLA0B04587g4.346ON4001352149e-18
Kpol_1001.24.346ON4181332141e-17
Suva_12.2164.346ON4101332121e-17
KAFR0B067404.346ON3991352112e-17
Skud_10.3494.346ON4101352085e-17
YJR125C (ENT3)4.346ON4081352061e-16
ZYRO0B14784g4.346ON4241352061e-16
AER155C4.346ON3641352041e-16
Smik_10.4184.346ON4091332042e-16
TPHA0B004004.346ON3991352032e-16
Ecym_11334.346ON3921351996e-16
NCAS0A062104.346ON4231351962e-15
CAGL0H04323g4.346ON4121231891e-14
SAKL0H25762g4.17ON2621361645e-12
TDEL0G017404.17ON2571371602e-11
Kwal_55.206114.17ON2541401557e-11
Ecym_84074.17ON2541361494e-10
TBLA0B062204.346ON3391331391e-08
KLTH0E05874g4.17ON2551001344e-08
Kpol_388.54.17ON2681361327e-08
ZYRO0G07876g4.17ON259991301e-07
TBLA0G006504.17ON4231111322e-07
NDAI0H002804.17ON3101401292e-07
KLLA0D03949g4.17ON2251321244e-07
TPHA0F002304.17ON2801181265e-07
ACL061C4.17ON2341051229e-07
CAGL0E03806g4.17ON2601091221e-06
Suva_10.354.17ON2471261166e-06
YLL038C (ENT4)4.17ON2471031122e-05
Smik_12.194.17ON2471031113e-05
Skud_12.304.17ON2471031103e-05
NCAS0C058404.17ON2671071071e-04
YHR161C (YAP1801)5.84ON637721082e-04
SAKL0H02530g5.84ON6691061072e-04
KAFR0I014604.17ON2752051033e-04
Skud_8.2255.84ON621791010.001
Smik_8.2455.84ON62772990.002
KLLA0A05522g5.84ON56772880.036
Kpol_344.88.335ON384114870.047
NCAS0B036608.335ON416139860.050
KLLA0D16654g8.335ON399155840.11
CAGL0E01199g8.335ON412142830.15
KAFR0B058008.335ON382157810.20
KLLA0E15313g1.225ON72489800.36
KNAG0E006105.84ON60491800.37
KAFR0E021805.84ON612114790.47
TPHA0A015008.335ON407111780.51
Skud_4.4128.335ON406141770.62
Suva_2.3158.335ON403141770.66
KNAG0J028704.17ON329124760.92
NDAI0J009308.335ON418113751.1
Smik_4.3988.335ON416141751.1
YDR153C (ENT5)8.335ON411141751.1
TBLA0A040408.335ON415120751.2
Kpol_1050.735.84ON67142751.2
TPHA0C007408.335ON38597741.8
KNAG0A051008.335ON42198732.0
ZYRO0F13684g8.335ON407139723.0
KAFR0L020508.863ON65730723.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04560
         (487 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   362   e-120
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   270   2e-84
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   266   4e-83
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   262   5e-82
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   261   1e-81
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   262   1e-80
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   257   4e-79
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   254   1e-78
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    254   2e-78
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   251   6e-76
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   244   2e-73
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   242   2e-72
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   239   3e-72
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   236   9e-72
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   237   1e-70
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   234   1e-70
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   234   2e-70
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   236   3e-70
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   233   6e-70
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   231   1e-69
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   231   2e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   221   1e-65
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   214   1e-63
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   213   2e-62
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   207   2e-59
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   199   8e-56
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   195   1e-55
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    90   7e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    89   3e-18
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    88   4e-18
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    88   5e-18
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    87   6e-18
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    88   6e-18
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    87   7e-18
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    87   9e-18
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    87   1e-17
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    86   1e-17
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    86   2e-17
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    85   5e-17
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    84   1e-16
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    84   1e-16
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    83   1e-16
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    83   2e-16
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    83   2e-16
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    81   6e-16
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    80   2e-15
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    77   1e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    68   5e-12
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    66   2e-11
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    64   7e-11
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    62   4e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    58   1e-08
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    56   4e-08
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    55   7e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    55   1e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   2e-07
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    54   2e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    52   4e-07
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    53   5e-07
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    52   9e-07
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    52   1e-06
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    49   6e-06
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    48   2e-05
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    47   3e-05
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    47   3e-05
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    46   1e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    46   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    46   2e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    44   3e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    44   0.001
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    43   0.002
KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} simila...    39   0.036
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    38   0.047
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    38   0.050
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    37   0.11 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    37   0.15 
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    36   0.20 
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    35   0.36 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.37 
KAFR0E02180 Chr5 complement(432775..434613) [1839 bp, 612 aa] {O...    35   0.47 
TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.3...    35   0.51 
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    34   0.62 
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    34   0.66 
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    34   0.92 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    33   1.1  
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    33   1.1  
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    33   1.1  
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    33   1.2  
Kpol_1050.73 s1050 complement(162665..164488,164492..164527,1645...    33   1.2  
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    33   1.8  
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    33   2.0  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    32   3.0  
KAFR0L02050 Chr12 complement(386478..388451) [1974 bp, 657 aa] {...    32   3.1  

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  362 bits (928), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 196/240 (81%), Positives = 196/240 (81%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRALEESRRTA 180
           GQIIRVKAKELTALLM                      PPARNGSDEDLQRALEESRRTA
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEESRRTA 180

Query: 181 EEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFGNPISYEE 240
           EEDERKRRLNQDDSD                      SMHMQQQQPVYYDVFGNPISYEE
Sbjct: 181 EEDERKRRLNQDDSDLQAALQLSKEEEELKRLQELQSSMHMQQQQPVYYDVFGNPISYEE 240

 Score =  223 bits (567), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/153 (74%), Positives = 114/153 (74%)

Query: 335 SELPDFTKPQAQSYQPAKXXXXXXXXXXXXXXXXXXXXXNRTGNKEMTNKYNELNQLLAS 394
           SELPDFTKPQAQSYQPAK                     NRTGNKEMTNKYNELNQLLAS
Sbjct: 335 SELPDFTKPQAQSYQPAKLPEQIEIQQPVQQPVQQPLQQNRTGNKEMTNKYNELNQLLAS 394

Query: 395 GTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSSNIIP 454
           GTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSSNIIP
Sbjct: 395 GTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSSNIIP 454

Query: 455 TQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
           TQTGYGFG                  GVSLIDL
Sbjct: 455 TQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  270 bits (690), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 166/248 (66%), Gaps = 9/248 (3%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KNVVKGYSS QVLVRNATANE  GP++D L ++AEKTYDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR +D+  GGVDQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDD--GGVDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPA----RNGSDEDLQRALEES 176
           GQIIRVKAKELT LL                              ++G D+DLQRAL+ES
Sbjct: 119 GQIIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDES 178

Query: 177 RRTAEEDERKRRL---NQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFG 233
           R TAEEDER+R++     DD                            QQQ   YYD+FG
Sbjct: 179 RLTAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPSQYYDIFG 238

Query: 234 NPISYEEY 241
           NPIS EEY
Sbjct: 239 NPISPEEY 246

 Score =  152 bits (384), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTG+  MT KY ELN+LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYRQ +GE 
Sbjct: 390 RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEP 449

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
           K NPFL +QYTG+PSSNI+P  TGYGFG                  GVSLIDL
Sbjct: 450 KKNPFLQSQYTGIPSSNIVPAHTGYGFG-NQPSQQNQAQQHQTADQGVSLIDL 501

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  266 bits (679), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 168/245 (68%), Gaps = 6/245 (2%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLY+IKTL EFR+ED+   G+DQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE--GIDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXX----XXXXXXXXXXXPPARNGSDEDLQRALEES 176
           GQI+RVK+KELTALL                             + N +D DLQRAL+ S
Sbjct: 119 GQIVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDAS 178

Query: 177 RRTAEEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFGNPI 236
           R TAEEDE++R++++D                             QQQQP+YYD+FGNPI
Sbjct: 179 RMTAEEDEKRRKMDEDYETALQLSKEEEELKRLQDLQRMQQLQTQQQQQPMYYDIFGNPI 238

Query: 237 SYEEY 241
           + EEY
Sbjct: 239 TPEEY 243

 Score =  152 bits (385), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ MT+KYN+LN+LLA+GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+Q S + 
Sbjct: 351 RTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDP 410

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFLS QYTGLPS+N++PTQTGYGFG
Sbjct: 411 KYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 226 PVYYDVFGNPISYEE 240
           P+YYDVFGNPI+ EE
Sbjct: 264 PLYYDVFGNPITPEE 278

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  262 bits (670), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 142/245 (57%), Positives = 168/245 (68%), Gaps = 6/245 (2%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLY+IKTL EFR+ED+   GVDQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE--GVDQ 118

Query: 121 GQIIRVKAKELTALLMXXXX--XXXXXXXXXXXXXXXXXXPPARNGS-DEDLQRALEESR 177
           GQI+RVKAKELT LL                            RN   D+DLQRA++ SR
Sbjct: 119 GQIVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASR 178

Query: 178 RTAEEDERKRRLNQD-DSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFGNPI 236
            TAEEDER+R+ ++D ++                           QQQQP+YYD+FGNPI
Sbjct: 179 MTAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNPI 238

Query: 237 SYEEY 241
           + EEY
Sbjct: 239 TPEEY 243

 Score =  152 bits (383), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 81/88 (92%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ MT+KY +LN+LLA+GTGIDTFGN G++R+PAQHT+TGTFINSQGTGYRQ S + 
Sbjct: 338 RTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDP 397

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFL++QYTGLPS+NI+PTQTGYGFG
Sbjct: 398 KQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (87%)

Query: 225 QPVYYDVFGNPISYEE 240
           + +YYDVFGNPIS EE
Sbjct: 263 EAMYYDVFGNPISPEE 278

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  261 bits (668), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 139/245 (56%), Positives = 166/245 (67%), Gaps = 6/245 (2%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC+ENLY+IKTL EFR+ED+   G+DQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE--GIDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDE---DLQRALEESR 177
           GQI+RVKAKELTALL                             SDE   DLQRA+  SR
Sbjct: 119 GQIVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASR 178

Query: 178 RTAEEDERKRRLNQD-DSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFGNPI 236
            TAEEDER+R+ ++D ++                           Q QQP+YYD+FGNPI
Sbjct: 179 LTAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNPI 238

Query: 237 SYEEY 241
           + EEY
Sbjct: 239 TPEEY 243

 Score =  149 bits (375), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (90%)

Query: 374 NRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE 433
           NRTGN+ MT+KY++LN+LLA+GTGIDTFGN GE RIPAQHT+TGTFINSQGTGYRQ S +
Sbjct: 344 NRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD 403

Query: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGF 461
              NPFL++QYTGLPS++++PTQTGYGF
Sbjct: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  262 bits (669), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 167/262 (63%), Gaps = 23/262 (8%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KNV+KGYSSTQVLVR+AT+N+    NID L DIA ++YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYWKHI KSLTVLDYLVRFGSENCVLWCKENLY+IKTL EFRYED+   G+DQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDT--GIDQ 118

Query: 121 GQIIRVKAKELTALLM-----XXXXXXXXXXXXXXXXXXXXXXPPARNGS-----DEDLQ 170
           GQIIRVKAKELT+LL                              +R+ S     D+DLQ
Sbjct: 119 GQIIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQ 178

Query: 171 RALEESRRTAEEDERKR----RLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQP 226
           R +EES++TAEEDER+R    R +++D +                           Q   
Sbjct: 179 RVIEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQ 238

Query: 227 -------VYYDVFGNPISYEEY 241
                  VYYDVFGNPISY+EY
Sbjct: 239 QQQTSANVYYDVFGNPISYDEY 260

 Score =  148 bits (374), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 80/90 (88%), Gaps = 1/90 (1%)

Query: 374 NRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE 433
           NRTGN+E+T KY+ELN LLA GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+Q + E
Sbjct: 388 NRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNE 447

Query: 434 -SKVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
            SK NPFL+ QYTGLPSSNI+P+ TGYGFG
Sbjct: 448 RSKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  257 bits (657), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 164/246 (66%), Gaps = 11/246 (4%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           M  QFVRS KN +KGY+S QVLVR+ATANE  GP++D+L ++A ++YDS +FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR++D+  G  D 
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDD--GTQDG 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXX---XXXXXXXXXXXXXPPARNGSDEDLQRALEESR 177
           GQIIRVKAKELT LLM                          P RN  D ++QRAL+ SR
Sbjct: 119 GQIIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASR 178

Query: 178 RTAEEDERKRR-LNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQ----QPV-YYDV 231
            TAEEDER+R+ LN +D+D                      +   QQ+    QP  YYD+
Sbjct: 179 LTAEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDI 238

Query: 232 FGNPIS 237
           FGNPIS
Sbjct: 239 FGNPIS 244

 Score =  139 bits (351), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 2/115 (1%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KYN+LNQLLA  TG+DTFGN G+ RIPAQHT+TGTFINSQGTG++Q S E 
Sbjct: 424 RTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNEP 483

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG--XXXXXXXXXXXXXXXXXXGVSLIDL 487
           K NPFL  Q+TG+P+S+++P+ TGYGFG                    GVSLIDL
Sbjct: 484 KKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQNQQISQPPQQQQADQGVSLIDL 538

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  254 bits (648), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 166/245 (67%), Gaps = 6/245 (2%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS Q VRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLY+IKTL EFR++D+   G DQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDE--GTDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGS---DEDLQRALEESR 177
           GQI+RVKAKELT+LL                           N S   D+DLQRA++ SR
Sbjct: 119 GQIVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASR 178

Query: 178 RTAEEDERKRRLNQD-DSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFGNPI 236
            TA+EDER+R+ ++D ++                           QQQQP+Y D+FGNPI
Sbjct: 179 MTADEDERRRKQDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNPI 238

Query: 237 SYEEY 241
           + EEY
Sbjct: 239 TPEEY 243

 Score =  148 bits (373), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 80/88 (90%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ MT+KY++LN+LL +GTGIDTFGN G+TR+PAQHT+TGTFINSQGTGYRQ S + 
Sbjct: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDP 412

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFL++QYTGLPS+N++P QTGYGFG
Sbjct: 413 KHNPFLNSQYTGLPSTNVVPAQTGYGFG 440

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  254 bits (649), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 169/258 (65%), Gaps = 19/258 (7%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYS+TQVLVR+AT+N+ + P+ +LL ++A++++DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLY+IKTL EFR+ED+  GG DQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD--GGADQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXX-------XXXXXXXXPPARNGSDED---LQ 170
           GQIIRVKAKELT+LL+                                  G+DED   LQ
Sbjct: 119 GQIIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQ 178

Query: 171 RALEESRRTAEEDERKRR--LNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPV- 227
           RALEESR TAEEDER+RR     DD D                          QQQ  + 
Sbjct: 179 RALEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMN 238

Query: 228 ----YYDVFGNPISYEEY 241
               Y+D+FGNPIS +EY
Sbjct: 239 QPQGYFDIFGNPISPDEY 256

 Score =  148 bits (373), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +T+KY++LN LLA+GTGIDTFGNTGE RIPAQHTQTGTFINSQGTGYRQ + + 
Sbjct: 370 RTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP 429

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFL++QYTGLPS+NI+ TQTGYGFG
Sbjct: 430 KNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  251 bits (642), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 167/276 (60%), Gaps = 37/276 (13%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           M  QFVRS KN+VKGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E   G D+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE--SGFDE 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPA----RNGSD---------E 167
           GQIIRVKAKEL +LL                        P     R GS+         +
Sbjct: 119 GQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQD 178

Query: 168 DLQRALEESRRTAEEDERKRR-LNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQ- 225
           +L++ LEESR TA+EDE++RR L Q D +                         +Q+QQ 
Sbjct: 179 ELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQ 238

Query: 226 --------------------PVYYDVFGNPISYEEY 241
                               P YYD+FGNPIS +EY
Sbjct: 239 PLSQMPVPVQQQQQQQQQQLPAYYDIFGNPISQDEY 274

 Score =  153 bits (387), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KYN+LN LLA+GTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 515 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  244 bits (624), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 172/273 (63%), Gaps = 32/273 (11%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QF+RS KN+VKGYSSTQ+LVR+ATAN+   P+ID+L DIAEKTYDS DFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED--ENSGGV 118
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCKENLYLIKTL EFR +D  + + G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 119 DQGQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXP---PARNGS---------- 165
           DQGQI+RV+A ELT+LLM                      P   P R  +          
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 166 ----DEDLQRALEESRRTAEEDERKRRL---NQDDSDXXXXXXXXXXXXXXXXXXXXXXS 218
               D+DLQ+A+EES+RTAEEDER+RR    +Q+D                         
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 219 MHMQQQQ----------PVYYDVFGNPISYEEY 241
           + +Q QQ           VY D+FGNPISYEE+
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  145 bits (366), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 78/88 (88%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+E+++KYN LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGY+Q   + 
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPF+SNQYTGLPS+N++P+ TGYGFG
Sbjct: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  242 bits (617), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/265 (51%), Positives = 161/265 (60%), Gaps = 30/265 (11%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E   G D+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE--SGFDE 118

Query: 121 GQIIRVKAKELTALL-----------MXXXXXXXXXXXXXXXXXXXXXXPPARNGSDE-- 167
           GQIIRVKAKEL +LL           M                          N  D   
Sbjct: 119 GQIIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPP 178

Query: 168 ----DLQRALEESRRTAEEDERKR----RLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSM 219
               DL++ALEESR TA+EDE +R    + + DD D                        
Sbjct: 179 TYQNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQ 238

Query: 220 HMQ-------QQQPVYYDVFGNPIS 237
            +Q       QQQ  YYD+FGNPIS
Sbjct: 239 QLQSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  145 bits (367), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (90%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KYN+LN LLA+GTG DTFGNTGE+RIPAQHT+TGTFINSQGTGY+Q   E 
Sbjct: 438 RTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNEP 497

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFL++QYTGLPS++I+PTQTGYGFG
Sbjct: 498 KNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  239 bits (610), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 163/243 (67%), Gaps = 8/243 (3%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           M  QFVRS KNVVKGYSSTQV+VRNAT+N+  GP+ID L  +AEKTYDS +FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLY+I+TL EF Y D++    DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH--DQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRALEESRRTA 180
           GQIIRVKAKELT+LL                       P  R   D++LQRA+EES+RTA
Sbjct: 119 GQIIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPSDDDELQRAIEESKRTA 178

Query: 181 EEDERKRRLNQDDSDXXXXXXXXXXXXXXXX------XXXXXXSMHMQQQQPVYYDVFGN 234
           E+D+R+RR+  D+                                  QQQQP+YYD+FGN
Sbjct: 179 EDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFGN 238

Query: 235 PIS 237
           PIS
Sbjct: 239 PIS 241

 Score =  159 bits (403), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 93/129 (72%), Gaps = 1/129 (0%)

Query: 335 SELPDFTKPQAQSYQPAK-XXXXXXXXXXXXXXXXXXXXXNRTGNKEMTNKYNELNQLLA 393
           SELPDF      +YQPA+                       RTGN+++T+K+ ELNQLLA
Sbjct: 343 SELPDFNAKPVSAYQPAELPPQQQISLPPQPQQPQQPLKQTRTGNQDITDKFGELNQLLA 402

Query: 394 SGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSSNII 453
           SGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGYRQ + + K NPFL++QYTGLPS+NI+
Sbjct: 403 SGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDPKNNPFLNSQYTGLPSTNIV 462

Query: 454 PTQTGYGFG 462
           P+ TGYGFG
Sbjct: 463 PSHTGYGFG 471

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  236 bits (601), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 168/259 (64%), Gaps = 37/259 (14%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLN 64
            +RS KN+VKGYS T+VLVR+ATAN  T P+ +LL D+A+K+Y+S +FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQII 124
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC+ENLY+IKTL EF +ED  +GG D+G+II
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED--AGGEDEGKII 118

Query: 125 RVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNG--------SDEDLQRALEES 176
           RVKAKELT+LLM                      P  R+G        SDEDLQRA+EES
Sbjct: 119 RVKAKELTSLLM----DEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEES 174

Query: 177 RRTA------------EEDERKR--RLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQ 222
           +RTA             E +R+   +L++++ D                          Q
Sbjct: 175 KRTAEEEERRRRNGASSEADRQAALQLSREEED---------LRRLQEQARLAQQQQQQQ 225

Query: 223 QQQPVYYDVFGNPISYEEY 241
           QQQP+YYDVFGNPI+ EEY
Sbjct: 226 QQQPMYYDVFGNPITPEEY 244

 Score =  148 bits (373), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (89%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           R+GN+ +++KY+ LN LLASGTGIDTFGNTGE RIPAQHTQTGTFINSQGTGYRQ + + 
Sbjct: 339 RSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD 398

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFL+ QYTGLPS+NI+PTQTG+GFG
Sbjct: 399 KPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  237 bits (605), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/267 (51%), Positives = 164/267 (61%), Gaps = 32/267 (11%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN++KGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E   G D+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE--SGFDE 118

Query: 121 GQIIRVKAKELTALL-----------MXXXXXXXXXXXXXXXXXXXXXXPPARNGSD--E 167
           GQIIRVKAKEL +LL           M                       P  +      
Sbjct: 119 GQIIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQN 178

Query: 168 DLQRALEESRRTAEEDERKRR-LNQ-DDSDXXXXXX---------------XXXXXXXXX 210
           DL++ALEESR TA+EDE++RR L Q DD D                              
Sbjct: 179 DLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQ 238

Query: 211 XXXXXXXSMHMQQQQPVYYDVFGNPIS 237
                   +  QQ+QP YYD+FGNPIS
Sbjct: 239 SLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  151 bits (382), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (89%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KYN+LN LLA+GTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q   E 
Sbjct: 430 RTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINEP 489

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 490 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  234 bits (598), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/254 (53%), Positives = 161/254 (63%), Gaps = 18/254 (7%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           M +Q VRS KN+VKGYSSTQV+VR+ATAN+ T P++ +L D+A+KTYD+ +FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLY+IKTL EFR+EDE SG  D+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGS-DE 119

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXX----------XXXXXXXXXXXXPPARNGSDEDLQ 170
           GQIIRVKAKELT+LL                                    RN  D+DLQ
Sbjct: 120 GQIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQ 179

Query: 171 RALEESRRTAEEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQP---- 226
           +ALEESR TAEE+E +RR      +                       M   Q+      
Sbjct: 180 KALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQ 239

Query: 227 ---VYYDVFGNPIS 237
              VYYD+FGNPIS
Sbjct: 240 QQNVYYDIFGNPIS 253

 Score =  151 bits (382), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KY+ELN LLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 421

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFLS+QYTGLPS+NI+P+ TGYGFG
Sbjct: 422 KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  234 bits (597), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/261 (49%), Positives = 159/261 (60%), Gaps = 24/261 (9%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS   +R  KNVV GYS+TQVL+R AT+N+  GP++D++ +IAE+++DS  FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+IKTL EF +EDE   G+DQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE--LGIDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRALEESRRTA 180
           GQI+RVKA+ELTALL+                       P     DEDLQRA+EESR TA
Sbjct: 119 GQIVRVKARELTALLLDDERLREERSLRTKNRKPRRR--PTAGSEDEDLQRAMEESRLTA 176

Query: 181 EEDERKRR----LNQDDSDXXXXXXXXXXXXXXXXXXXXX----------------XSMH 220
           E++E +RR    +  + SD                                         
Sbjct: 177 EQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQ 236

Query: 221 MQQQQPVYYDVFGNPISYEEY 241
            Q QQP+YYDVFGNPIS EEY
Sbjct: 237 TQAQQPMYYDVFGNPISAEEY 257

 Score =  147 bits (371), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/113 (61%), Positives = 83/113 (73%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +T K++ELN LLASGTG+DTFGNTG+TRIPAQHT+TG FINSQGTGY+Q S   
Sbjct: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
           K NPFL  QYTGLPS+N++P+ TGYGFG                  G+SLIDL
Sbjct: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQGMSLIDL 508

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  236 bits (602), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 120/201 (59%), Positives = 145/201 (72%), Gaps = 15/201 (7%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN++KGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E+  G D+
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES--GFDE 118

Query: 121 GQIIRVKAKELTALL-----------MXXXXXXXXXXXXXXXXXXXXXXPPARNGSD--E 167
           GQIIRVKAKEL +LL           M                       P  +     +
Sbjct: 119 GQIIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQD 178

Query: 168 DLQRALEESRRTAEEDERKRR 188
           DL++ALEESR TA+EDE++RR
Sbjct: 179 DLEKALEESRITAQEDEQRRR 199

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KY++LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 429 RTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 488

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 489 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  233 bits (593), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 164/252 (65%), Gaps = 13/252 (5%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS   +R+ KNVV GYSS QVLVRNAT+NE TGP +D L ++AEKTYD+ +FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW +ENLY+IKTL EF +EDE   GVD 
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDE--MGVDH 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGS--DEDLQRALEESRR 178
           GQIIRVKAKELT+LL                         +R G   D+DLQRALEESR 
Sbjct: 119 GQIIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRL 178

Query: 179 TAEEDERKRRLN---QDDSDXXXXXXXXXXXXXXXX------XXXXXXSMHMQQQQPVYY 229
           TAEE+ER+RR +    DD D                                QQQQP+YY
Sbjct: 179 TAEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYY 238

Query: 230 DVFGNPISYEEY 241
           DVFGNPI+ EEY
Sbjct: 239 DVFGNPITPEEY 250

 Score =  135 bits (341), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 78/89 (87%), Gaps = 1/89 (1%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ ++ KYN+LN LLASGTG+DTFGNTG+TRIPAQHT+TG FINSQGTGY+Q + + 
Sbjct: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434

Query: 435 -KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
            K NPFL+ QYTGLPS++++P+ TGYGFG
Sbjct: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  231 bits (590), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 139/189 (73%), Gaps = 12/189 (6%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KN++KGYS+TQVLVR+AT+N+ + P+ ++L +I+++++DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCK+NLY+IKTL EF+ ED+N   VD+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN---VDE 117

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNG---------SDEDLQR 171
             IIRVKAKELTALL                         +R G         SDEDLQ+
Sbjct: 118 SSIIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQK 177

Query: 172 ALEESRRTA 180
           ALEESR TA
Sbjct: 178 ALEESRITA 186

 Score =  145 bits (367), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++KYNELN LLASGTGIDTFGNTG+ RIPAQHTQTGTFINSQGTGY+Q   + 
Sbjct: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428

Query: 435 -KVNPFLSNQYTGLPSSNIIPTQTGYGF 461
            K NPFL+NQYTGLPSSNI+P+ TGYGF
Sbjct: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  231 bits (589), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/259 (49%), Positives = 160/259 (61%), Gaps = 22/259 (8%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS   +R  KNVV GYS+TQVL+R AT+N+  GP++DL+ +IAE+++DS  FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+IKTL EF +EDE   GVDQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDET--GVDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRALEESRRTA 180
           GQI+RVKA+ELTALL                           +  D+D+QRALEESR TA
Sbjct: 119 GQIVRVKARELTALLQDEERLREERELKGRNRRPRRRK--NSDSYDDDMQRALEESRMTA 176

Query: 181 EEDERKRR------------------LNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQ 222
           E++E +RR                  L++++ +                          Q
Sbjct: 177 EQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQ 236

Query: 223 QQQPVYYDVFGNPISYEEY 241
            QQP+YYDVFGNPIS EEY
Sbjct: 237 TQQPMYYDVFGNPISAEEY 255

 Score =  145 bits (365), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 86/115 (74%), Gaps = 2/115 (1%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSG-- 432
           RTGN+ +T+K+++LN LLASGTG+DTFGNTG+TRIPAQHT+TGTFINSQGTGY+Q S   
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 433 ESKVNPFLSNQYTGLPSSNIIPTQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
           + K NPFL  QYTGLPS++++P+ TGYGFG                  GVSLIDL
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  221 bits (562), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 156/247 (63%), Gaps = 11/247 (4%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS  F+RS KN+V GYS  QVLVR+AT+N+  GP++D L ++AE+T+D+ +FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCKENLY+IKTL EF + DE +  +D 
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFT-EIDN 119

Query: 121 GQIIRVKAKELTALLM-XXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRALEESRRT 179
           G+I+RVKAKELTALL                            N  D+DLQRALEESR T
Sbjct: 120 GEIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDDDLQRALEESRIT 179

Query: 180 AEEDERKRR---LNQDDSDXXXX------XXXXXXXXXXXXXXXXXXSMHMQQQQPVYYD 230
           AEE+ER+R+   +  DDS                                 QQQQP+YYD
Sbjct: 180 AEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYYD 239

Query: 231 VFGNPIS 237
           +FGNPIS
Sbjct: 240 IFGNPIS 246

 Score =  139 bits (350), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 64/89 (71%), Positives = 80/89 (89%), Gaps = 1/89 (1%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTGN+ +++K++ELN LLASGTGIDTFGNTGETR+PAQHT+TGTFINSQGTGY+Q + ++
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 435 -KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
            K NPFL++QYTG+PSS I P+ TGYGFG
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  214 bits (544), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 152/248 (61%), Gaps = 27/248 (10%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLN 64
            +RS KN+VKGYSSTQ LVR+AT+N    P ID L+++AE TY++ +FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQII 124
            KGKYWKH+ KSL VLDYLVRFGSENCV+WCKENLY+IKTL EF YEDE   G+DQGQ++
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDE--SGMDQGQMV 118

Query: 125 RVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQRA-----------L 173
           RV+AKELT+LLM                          +  D+DL+RA            
Sbjct: 119 RVRAKELTSLLMDEERLREERALNRRGGGNRRRAKSRNSDDDDDLERAKEESRRTAREEE 178

Query: 174 EESRRTAEEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVYYDVFG 233
           E  RR   E +   +LNQ++ +                          QQQQP+YYD+FG
Sbjct: 179 ELRRRQEAERQFALQLNQEEQE--------------LRALQQLQQQQQQQQQPMYYDIFG 224

Query: 234 NPISYEEY 241
           NPI+ EEY
Sbjct: 225 NPITPEEY 232

 Score =  135 bits (340), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/88 (71%), Positives = 76/88 (86%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434
           RTG++ +++KY+ LN LLA+GTGIDTFGNTG  RIPAQHT+TGTFINSQGTGY+Q S   
Sbjct: 315 RTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNG 374

Query: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462
             N FL++QYTGLPSSNI+P+QTGYGFG
Sbjct: 375 FNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  213 bits (542), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 150/256 (58%), Gaps = 20/256 (7%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS Q +RS KNV+ GYS  QVLVRNAT+N+  GP++D + ++AE+TY + +FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W +EN+++I+ LTEF + DE+S G D 
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESS-GTDH 119

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARN--GSDEDLQRALEESRR 178
           GQ+IRVKAKEL ALL                        P  N  G D DL+RALEESR 
Sbjct: 120 GQLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALEESRI 179

Query: 179 TAEEDERKRRLNQDDSDXXXXXXXXXXX-----------------XXXXXXXXXXXSMHM 221
           TAEE+ER+R+L +   D                                           
Sbjct: 180 TAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQVQ 239

Query: 222 QQQQPVYYDVFGNPIS 237
            QQQP+YYD+FGNPI+
Sbjct: 240 YQQQPMYYDIFGNPIT 255

 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/114 (58%), Positives = 82/114 (71%), Gaps = 4/114 (3%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE- 433
           RTGN+ +++KY ELN LLA+GTGIDTFGNTG+ RI +QHT+T TFINS GTG++Q S E 
Sbjct: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463

Query: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
            K NPFL+ QYTGLPS+NI+P+ TGYGFG                  G+SLIDL
Sbjct: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFG---NASSFQQTASKPNDQGMSLIDL 514

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  207 bits (528), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 136/228 (59%), Gaps = 41/228 (17%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS QFVRS KNV+KGYSSTQVLVR+ATAN+G  P++D L DIA  ++DS DFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W +++L+L+K L  FR+ D+   G DQ
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGI-GFDQ 119

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXX---------------------- 158
           GQI+RVKA++L  LL                                             
Sbjct: 120 GQIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDE 179

Query: 159 ---------PPARNG---------SDEDLQRALEESRRTAEEDERKRR 188
                    PP R G          D+DLQRA+EES+RT +EDE +RR
Sbjct: 180 YYPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRR 227

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 3/90 (3%)

Query: 376 TGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESK 435
           TGN+E+TNKY+ELN LLA GTG+DTFGN G  RIPAQHTQTGTFINSQGTG++Q + E K
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 436 ---VNPFLSNQYTGLPSSNIIPTQTGYGFG 462
               NPFL++QYTGLPS+ I+P  TGYGFG
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  199 bits (506), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 146/253 (57%), Gaps = 20/253 (7%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS+QFVRS KN+ KGYS TQVLVR+ATAN  +G +ID+L  + E +YD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W ++N   ++ L +F Y D  S G+DQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD--SAGIDQ 118

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXXXXXXXXXXXXPPARNG------------SDED 168
           GQ+IRVKA EL  LL                       PP R G             +ED
Sbjct: 119 GQLIRVKAAELIDLL--RDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEED 176

Query: 169 LQRALEESRRTAEEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQQPVY 228
           + RALEES++TAEEDE +RR +Q+                         +      +P Y
Sbjct: 177 VDRALEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRLQDEA----NNKPQY 232

Query: 229 YDVFGNPISYEEY 241
           +D  GNPIS EE+
Sbjct: 233 FDENGNPISQEEW 245

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (75%)

Query: 376 TGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESK 435
           TGN  ++ KY+ LNQLLA GTGIDTFGN G TRIPAQHT+TGTFINSQGTGY+Q +  S 
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 436 VNPFLSNQYTGLPSSNII 453
             P L  QYTGLP+   +
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  195 bits (495), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 144/255 (56%), Gaps = 17/255 (6%)

Query: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60
           MS Q +RS KNVV GYS  Q+LVRNAT+NE  GP++D + ++AE++Y + +FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W +ENLYL + LTEF + DE S GVD 
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDE-STGVDH 119

Query: 121 GQIIRVKAKELTALLMXXXXXXXXXXXX--XXXXXXXXXXPPARNGSDEDLQRALEESRR 178
           GQIIRVKA+EL ALL                         PP     D DLQRALEESR 
Sbjct: 120 GQIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESRI 179

Query: 179 TA--------------EEDERKRRLNQDDSDXXXXXXXXXXXXXXXXXXXXXXSMHMQQQ 224
           TA              +++E      Q   +                          QQ 
Sbjct: 180 TAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQP 239

Query: 225 QPVYYDVFGNPISYE 239
           Q +YYD+FGNPIS E
Sbjct: 240 QAMYYDIFGNPISLE 254

 Score =  144 bits (362), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 85/114 (74%), Gaps = 1/114 (0%)

Query: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE- 433
           RTGN+ +T+KY+ELN LLASGTG+DTFGNTG+TRIPAQHT+TGTFINSQGTGY+Q   E 
Sbjct: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461

Query: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGFGXXXXXXXXXXXXXXXXXXGVSLIDL 487
            K NPF++ QYTGLPS+N++P+ TGYGFG                   +SLID+
Sbjct: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I K+L +LDYL+R G+E  +   + NL LIK L  F Y D  S G DQ
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +A EL  LL
Sbjct: 133 GINVRNRAHELALLL 147

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 78/133 (58%), Gaps = 3/133 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K G  W+ I K+L +L+YL+  G+E  +   + +L LI+ L  F Y D  S G DQG 
Sbjct: 77  TEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVD--SEGRDQGA 134

Query: 123 IIRVKAKELTALL 135
            +R +A+ +T+LL
Sbjct: 135 NVRSRAQAMTSLL 147

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +N+V  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I K+L +LDYL+R G+E  +   + NL LIK L  F Y D  S G DQ
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +A EL  LL
Sbjct: 133 GINVRNRAHELVLLL 147

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I+  TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I K+L +L+YL++ GSE  +   + NL LIK L  F Y D  S G DQ
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTD--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +A+EL  LL
Sbjct: 133 GINVRNRAQELVKLL 147

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  ++  +  VR AT NE  G +  L+  IA+ TY+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I K+L +LDYL+R GSE  +   +  L +++ L  F Y D  S G DQ
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +AK++  LL
Sbjct: 133 GVNVRNRAKQIVELL 147

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + +L LI+ L  F Y D  S G DQ
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYID--SEGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +AK L  LL
Sbjct: 133 GINVRNRAKLLVELL 147

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 87.0 bits (214), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           RL +K    W+ I K+L +LDYL+R  SE  +   + ++ LIK L  F Y D  S G DQ
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +AK L  LL
Sbjct: 133 GINVRNRAKALAELL 147

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I K+L +L+YLV+ GSE  +   + NL L+K L  F Y D  S G DQ
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +A +L  LL
Sbjct: 133 GINVRNRASQLVKLL 147

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 78/133 (58%), Gaps = 3/133 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           ++ R  +NV+  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K    W+ I K+L +L+YL++ GSE  +   + +L LIK L  F Y D  S G DQG 
Sbjct: 77  TEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYID--SQGRDQGI 134

Query: 123 IIRVKAKELTALL 135
            +R KA+ LTALL
Sbjct: 135 NVRNKAQSLTALL 147

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 76/133 (57%), Gaps = 3/133 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K G  W+ I K+L +LDYL++ GSE  +   + ++ LIK L  F Y D  S G DQG 
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTD--SQGRDQGI 134

Query: 123 IIRVKAKELTALL 135
            +R + K L  LL
Sbjct: 135 NVRTRVKALVELL 147

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I KSL +LDYL+R GSE  +   + ++ LI+ L  F Y D  S G DQ
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +AK L  LL
Sbjct: 133 GINVRNRAKALGELL 147

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ LIK L  F Y D  S G DQ
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R + K L  LL
Sbjct: 133 GINVRTRVKTLIELL 147

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ LI+ L  F Y D  S G DQ
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R + K L  LL
Sbjct: 133 GINVRTRVKALIELL 147

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (57%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I K+L +L+YL++ GSE  +   + ++ L+K L  F Y D  S G DQ
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVD--SQGRDQ 167

Query: 121 GQIIRVKAKELTALL 135
           G  +R +AK LT LL
Sbjct: 168 GINVRTRAKALTELL 182

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NV+  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I KS+ +L+YLV+ GSE  +   + NL LI+ L  F Y D  S G DQ
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R + K L  LL
Sbjct: 133 GINVRNRTKALVKLL 147

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 76/133 (57%), Gaps = 3/133 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           ++ R  +NVV  Y+  +  VR AT NE  G +  L+  I++ TY+  +  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K G  W+ I K+L +LDYL++ GSE  +   + ++ LI+ L  F Y D  S G DQG 
Sbjct: 77  TEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID--SQGRDQGI 134

Query: 123 IIRVKAKELTALL 135
            +R + K L  LL
Sbjct: 135 NVRTRVKALIDLL 147

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NV+  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I KSL + DYL++ GSE  +   + ++ LIK L  F Y D  S G DQ
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R KA+ L A L
Sbjct: 133 GINVRNKAQSLVAFL 147

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (54%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G    L+A IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K    W+ I KS+ +L+YL+  GSE  +   +  L LIK L  F Y D  S G DQ
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYID--SQGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R + + L  LL
Sbjct: 133 GINVRNRTQALVQLL 147

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 2   SNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDK 61
           + ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ ++K L  F Y D  + G DQ
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYID--AEGRDQ 132

Query: 121 GQIIRVKAKELTALL 135
           G  +R +   L  LL
Sbjct: 133 GINVRNRVTTLIELL 147

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 71/123 (57%), Gaps = 3/123 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           ++ R  +NVV  Y+  +  VR AT NE  G +  L+  IA+ TY+  +  EI+ M+ +R 
Sbjct: 17  KYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K G  W+ I K+L +L+YL++ GSE  +   + ++ ++K L  F Y D  S G DQG 
Sbjct: 77  TEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYID--SQGRDQGV 134

Query: 123 IIR 125
            +R
Sbjct: 135 NVR 137

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 78/136 (57%), Gaps = 13/136 (9%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNATAN-EGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           F+RS++N+  G S+T+V V+ AT + E +G    L+ +I+  TY +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYE-DENS 115
           +  G Y K       HI K+LT++ YL+  GS + V W ++  YL+ TL EF    D++ 
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 116 GGVDQGQIIRVKAKEL 131
              +Q +++ +K  +L
Sbjct: 119 KMAEQVRMLSIKLSKL 134

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 75/137 (54%), Gaps = 10/137 (7%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
            + S++ +V+  S+T++ V+ AT  NE +G    L+ +I+  TY      EI+ ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  NDKG-----KYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGV 118
              G     K   H+ K+LT++ YL+  GS + + W + N+ L+  L EF  +D N   +
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI 120

Query: 119 DQGQIIRVKAKELTALL 135
             GQ IR  +++L  L+
Sbjct: 121 --GQQIRAMSQDLCTLI 135

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 74/140 (52%), Gaps = 16/140 (11%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNATAN-EGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
            +++++N+  G SST+V  RNAT + E  G    L+ +++  TY      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGV 118
           +        K   H+ K+LT++ YL+  GS+  V+W +  LYLI TL EF     N G  
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF-----NGGSR 115

Query: 119 DQGQI---IRVKAKELTALL 135
            + ++   IR  A  L A+L
Sbjct: 116 TKERMASQIRNLASSLAAIL 135

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 73/136 (53%), Gaps = 13/136 (9%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNATAN-EGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           F+ S++++  G SST V V+ AT + E  G    L+ +IA  TY      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED-ENS 115
              G Y K       ++ K+LT++ +LV  GSE C+ W + +L LI++  +F   D E  
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 116 GGVDQGQIIRVKAKEL 131
             V+Q Q++  K  +L
Sbjct: 119 QMVNQIQLLSCKLCQL 134

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 3/133 (2%)

Query: 4   QFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           +F R  +N +   +  +  VR AT N+  G ++ L+A I   T++     +I++ML  R 
Sbjct: 17  KFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLNRF 76

Query: 64  NDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQ 122
            +K G  W+ I KS+ +L YL+  GS   V   K NL LIK L  F + D+   G +Q  
Sbjct: 77  LEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQ--GYNQSS 134

Query: 123 IIRVKAKELTALL 135
            I    + L  L+
Sbjct: 135 KISKATERLIELM 147

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 6/100 (6%)

Query: 15  GYSSTQVLVRNATAN-EGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL--NDKGKYWK 71
           G S T++  +NAT + E +G    L+ +I+  TY S    EI  ++ KRL  N++    K
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 72  ---HIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEF 108
              HI K+LT+  YL+  GS   V W +  +YLI +L EF
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 14/136 (10%)

Query: 8   SMKNVVKGYSSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDK 66
           S++N V+  S+T+  V+ AT  NE +G    L+ +I+  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFR--YEDENSGGVD 119
            K        HI K++T++ YL+  GS + + W + N+ + + L +F   +ED+      
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEK---- 119

Query: 120 QGQIIRVKAKELTALL 135
             + IR  A +L  L+
Sbjct: 120 MAEQIRYIAGDLCILI 135

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 13  VKGYSSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWK 71
           V G SST++ VR AT  +E TG    L+ +I+  TY      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKSLTVLDYLVRFGSENCVLWCKENLYLIKTL 105
           H     I K+LT++ YL+  GSE  V W + NL   + L
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECL 107

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 8   SMKNVVKGYSSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDK 66
           S++N V+  S T++ VR AT  NE +G    L+ +I+  TY +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
           GK   H     I K+LT++ YL+  GS   + W  EN  L + +  F   D
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSD 114

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 76/140 (54%), Gaps = 15/140 (10%)

Query: 8   SMKNVVKGYSSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND- 65
           ++KN V+  + T+  V+ AT  NE TG    L+ +I+  TY      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTE---FRYEDENS 115
               K   H     I K+LT++ YL+  GS   + W + N YL++ +T+   F+ +D ++
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 116 GGVDQGQIIRVKAKELTALL 135
                GQ I+V A+++T L+
Sbjct: 124 DSKMIGQ-IKVIAEDMTNLI 142

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 72/132 (54%), Gaps = 14/132 (10%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           F + ++ V  G S+TQ+ V+ AT +NE  G    L+ +++  TY      EI +++ KRL
Sbjct: 3   FFKGLRRV--GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRL 60

Query: 64  NDKGKYWKH-------IAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSG 116
            +     K+       + K+LT+++YL+  GSE  VLW + +L  I+ L ++   ++   
Sbjct: 61  MNGSSRLKNSHDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK-- 118

Query: 117 GVDQGQIIRVKA 128
             D+ ++ ++K+
Sbjct: 119 --DKSKVKQIKS 128

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 11/118 (9%)

Query: 8   SMKNVVKGYSSTQVLVRNATAN-EGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLN-- 64
           S++N V+  S T+  VR AT + E +G    L+ +I+  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFR---YEDENSG 116
              +  K   HI K+LT++ YL+  GS + + W + N+ L + L  F     EDE  G
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMG 121

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 15  GYSSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  NE  G +  L+++I   TY      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDE 113
              HI K+LT+ +YL+  GSE+ V W +    L++ L +F   +E
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNE 115

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 8   SMKNVVKGY--SSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLN 64
           S+ +  KG+  S T++ VR AT  NE  G    L+ +I+  TY      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEF 108
                +  +   H+ K+LT++ YL+  GS + + W K + Y+I+ L+ F
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 9/126 (7%)

Query: 17  SSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ +E +G    L+ +I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQIIRVKAK 129
              + K+LT++ YL+  GS   + W K N+ LI+ L +F+ +D        G+ IR  ++
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDR--NGEEIRKLSR 130

Query: 130 ELTALL 135
            L  LL
Sbjct: 131 NLHELL 136

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  +E +G    L+ +I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
              + K+LT++ YL+  GS   + W K N+ LI+ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  +E +G    L+ +I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
              + K+LT++ YL+  GS   + W K N+ L++ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATA-NEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ +E +G    L+ +I+  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
              + K+LT++ YL+  GS   + W K N+ LI+ L  F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQD 115

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 13  VKGY--SSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT  +E  G    L+ +I+  TY      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYE 111
             H     I K+LT++ YL+  GS   V W + N  LI  L   + E
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVE 113

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 22 LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          LV+ AT  +   P    L  I   T +  DF+EI+  LD R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL 93
           ++R GS++  L
Sbjct: 65 LMIREGSKDVAL 76

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 7/106 (6%)

Query: 22  LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT  +   P    +  I   T DS++F EIM  L+ R+ND    W  + KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQGQIIRVK 127
            ++R G  +  +      YL   L  F+  D     +  G +  +K
Sbjct: 65  LMMRDGDRDVTIK-----YLSHHLEFFQLRDVFHSKLSSGDLQALK 105

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 88/205 (42%), Gaps = 18/205 (8%)

Query: 5   FVRSMKNVVKGYSSTQVLVRNAT-ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRL 63
           F  S++N+V  YS T++ VR AT  NE       L+ +I+  TY +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
                  N  G    K    + K+ T++ YL+  GS + + W K N  +++ L   + + 
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILA--KVDS 118

Query: 113 ENSGGVDQGQIIRVKAKELT--ALLMXXXXXXXXXXXXXXXXXXXXXXPPARNGSDEDLQ 170
            N    D+   I  +A+++T   +L+                       P R  +D    
Sbjct: 119 NNHITDDEDLHILNQAQKITKDIILLINDNKLLEKRRKDVIQFRSSISSPGRKSTDNSHL 178

Query: 171 RALEESRRTAEEDERKRRLNQDDSD 195
           R   E +R++EE  R    N+   D
Sbjct: 179 RLSNELKRSSEEIMRSSNNNRKSDD 203

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 22 LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          LV+ AT  +   P    L  I   T    DF+EI+  LD R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R G ++  L +   NL
Sbjct: 65 LMMREGKKDVALRYYSRNL 83

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 22 LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          LV+ AT  +   P    L  I   T    DF+EI+  L+ R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL 93
           ++R G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} similar
          to uniprot|P53309 Saccharomyces cerevisiae YGR241C
          YAP1802 Yeast Assembly Polypeptide, member of AP180
          protein family, binds Pan1p and clathrin; member of
          clathrin assembly polypeptide AP180 family
          Length = 567

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 22 LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          LV+ AT  +   P       I   T +  DF EI++ L++R+ND    W  + KSL V  
Sbjct: 7  LVKGATKIKMAPPKTKYTDPILLGTTNERDFGEIVNALEERINDSA--WTVVFKSLAVAH 64

Query: 82 YLVRFGSENCVL 93
           ++R G ++  L
Sbjct: 65 LMIRDGDKDIAL 76

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 22/114 (19%)

Query: 7   RSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFF-------EIMDML 59
           R M+N++  Y   Q+ +R AT  +  GP    L  +    Y    +         I+D L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 60  DKR---LNDK--------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWCKEN 98
            KR   L +K        G  W+ I K L V++YL+   SE    N V  C EN
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 26/139 (18%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV +R AT  +  GP    L+ +    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWC--KENLY 100
                               G  W+ + K L V+D+L+   SE    N VL C       
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHI 138

Query: 101 LIKTLTEFRYEDENSGGVD 119
           L + +  F+ +  N G ++
Sbjct: 139 LTREIPNFKVKFSNDGKME 157

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 64/155 (41%), Gaps = 25/155 (16%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFF-------EIMDM 58
            R  +NV+  Y   Q+ +R AT  +  GP    LA +    Y+ + F         ++D 
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDH 79

Query: 59  LDKRLNDK-----------GKYWKHIAKSLTVLDYLV----RFGSENCVLWC--KENLYL 101
           + KR  +            G  W+ + K L +L+YL+    R    + VL C       L
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHIL 139

Query: 102 IKTLTEFRYEDENSGGVD-QGQIIRVKAKELTALL 135
            K   ++R +  + G ++   + I+ K + +  L+
Sbjct: 140 TKETMQYRVDFSSDGKMELHERGIKKKCEHIIQLI 174

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 58/142 (40%), Gaps = 32/142 (22%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV VR AT  +  GP    LA +    Y     + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L V++YL   V  G E     +C+L  K  
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLLMNVDDGDEINQVRSCLLTHK-- 136

Query: 99  LYLI-KTLTEFRYEDENSGGVD 119
            +LI K +  F+ +  N G ++
Sbjct: 137 -HLISKEVLNFKIKFSNDGKME 157

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 65/157 (41%), Gaps = 31/157 (19%)

Query: 7   RSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDK 66
           R  +NV+  Y   Q+ VR AT  +  GP    L  +    +     + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKENL 99
                              G  W+ + K LTV++YL   V  G E     +C+L  K   
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCLLTHKH-- 137

Query: 100 YLIKTLTEFRYEDENSGGVD-QGQIIRVKAKELTALL 135
            L + +  F+ +  N G ++   + IR K +++  +L
Sbjct: 138 ILTREVLNFKIKFSNDGKMEVHERSIRKKGEKILQML 174

>KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} similar
           to uniprot|P08018 Saccharomyces cerevisiae YJL128C PBS2
           MAP kinase kinase that plays a pivotal role in the
           osmosensing signal-transduction pathway activated under
           severe osmotic stress
          Length = 724

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 55  IMDMLDKRLN-DKGKYWK--------HIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTL 105
           IM M + RL  D+ K+ +        H  +S  ++D+   F  E  V  C E  Y+    
Sbjct: 443 IMAMKEVRLELDESKFRQILMELEVLHNCQSPYIVDFYGAFFIEGAVYMCME--YMDGGS 500

Query: 106 TEFRYEDENSGGVDQGQIIRVKAKELTAL 134
            +  Y+DE  GG+D+ Q+ R+ +  +  L
Sbjct: 501 LDKTYDDEQIGGIDEPQLARITSSVIQGL 529

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {ON}
           Anc_5.84 YGR241C
          Length = 604

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 36/91 (39%), Gaps = 7/91 (7%)

Query: 22  LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT  +   P    +  I   T    DF EI+  L  R+ D    W  + KSL V  
Sbjct: 7   LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82  YLVRFGSENCVLWCKENLYLIKTLTEFRYED 112
            + R G E  VL      Y    L  FR  D
Sbjct: 65  LMFREGDEQIVLE-----YFADHLDFFRLGD 90

>KAFR0E02180 Chr5 complement(432775..434613) [1839 bp, 612 aa] {ON}
           Anc_5.84 YGR241C
          Length = 612

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 22  LVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT  +   P    +  I   +    DF EI+  L  RL+D    W  + K++ V+ 
Sbjct: 7   LVKGATKIKLAPPKQKYIDPILLGSASPRDFQEIVSALSSRLSDTA--WTVVYKTIIVIH 64

Query: 82  YLVRFGSENCVL-WCKENLYLIKTLTEFRYEDENSGGVDQ----GQIIRVKAKE 130
            L+R G ++  L +  E+L + +    F+     S  V         I+++ KE
Sbjct: 65  LLIREGEKDRTLEYFSEDLSVFQLRDNFQALKGGSSDVRALERYSNYIKIRCKE 118

>TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.335
           YDR153C
          Length = 407

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 22/111 (19%)

Query: 7   RSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFF-------EIMDML 59
           R M+N++  Y   Q+ +R AT  +  GP    L  +    Y    F         I+D +
Sbjct: 21  RFMQNMLVQYEPYQIDIRRATNTDSWGPTTKHLEKVIRNKYQVPLFLMTEYILKRIIDHI 80

Query: 60  DKR---LNDK--------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC 95
            K+   L +K        G  W+ I K L VL++L   V  G E N +L C
Sbjct: 81  AKKPKNLYEKARKEYVNYGAEWRVILKCLVVLEFLMLHVEDGEELNQILNC 131

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 56/141 (39%), Gaps = 30/141 (21%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV +R AT  +  GP    LA +    Y     + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLMNVDVGDELNQIRSCLLTHKH- 137

Query: 99  LYLIKTLTEFRYEDENSGGVD 119
             L + + +F+ +  N G ++
Sbjct: 138 -ILTREIAQFKVKFSNDGKME 157

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 56/141 (39%), Gaps = 30/141 (21%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV +R AT  +  GP    LA +    Y     + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLLNVDTGDELNQIRSCLLTHKH- 137

Query: 99  LYLIKTLTEFRYEDENSGGVD 119
             L + + +F+ +  N G ++
Sbjct: 138 -ILTREIAQFKLKFSNDGKME 157

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 23/124 (18%)

Query: 8   SMKNVVKGYSSTQVLVRNAT-----ANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKR 62
           S++N V   S+T++ V+ AT      +  TG    ++ +I+  TY      EI  +L KR
Sbjct: 6   SVRNFVN--STTELKVKQATDDSEVLSSSTG---TVMNEISVLTYSPKTLKEIQSVLRKR 60

Query: 63  LNDKGKYWKHIA--------KSLTVLDYLVRFGSENCVLWCKENLYLIKTL-----TEFR 109
            +      + +         K+LT++ +L+  GS   V W K N+   + L     TEF 
Sbjct: 61  FHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFS 120

Query: 110 YEDE 113
           + D+
Sbjct: 121 FTDK 124

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 45/113 (39%), Gaps = 24/113 (21%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV +R AT  +  GP    L  +    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  W+ + K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 56/141 (39%), Gaps = 30/141 (21%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   Q+ +R AT  +  GP    LA +    Y     + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLLLNVDTGDELNQIRSCLLTHKH- 137

Query: 99  LYLIKTLTEFRYEDENSGGVD 119
             L + + +F+ +  N G ++
Sbjct: 138 -ILTREIAQFKVKFSNDGKME 157

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 56/141 (39%), Gaps = 30/141 (21%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   Q+ +R AT  +  GP    LA +    Y     + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCLLTHKH- 137

Query: 99  LYLIKTLTEFRYEDENSGGVD 119
             L + + +F+ +  N G ++
Sbjct: 138 -ILTREIAQFKVKFSNDGKME 157

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 28/120 (23%)

Query: 7   RSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDK 66
           R  +NV+  Y   Q+ +R AT  +  GP    LA +    Y     + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKENL 99
                              G  W+ + K L V+D+L   V  G E     +C+L  K  L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHIL 139

>Kpol_1050.73 s1050
           complement(162665..164488,164492..164527,164531..164686)
           [2016 bp, 671 aa] {ON}
           complement(162665..164488,164492..164527,164531..164686)
           [2016 nt, 672 aa]
          Length = 671

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 25/42 (59%), Gaps = 5/42 (11%)

Query: 423 QGTGYRQQSGESKVNPFLSNQYTGLPSSN--IIPTQTGYGFG 462
           Q TG+ QQS      P L+NQ TG  SSN  + P+ TG GFG
Sbjct: 510 QNTGFIQQSATV---PNLTNQQTGFFSSNTQVTPSFTGAGFG 548

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 20/97 (20%)

Query: 7   RSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLNDK 66
           R M+N++  Y   Q+ VR A+  +  GP    L  +    Y S   + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 40/98 (40%), Gaps = 20/98 (20%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +NV+  Y   QV +R AT  +  GP    L+ +    Y     + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 54/139 (38%), Gaps = 26/139 (18%)

Query: 6   VRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLDKRLND 65
            R  +N++  Y   QV VR AT  +  GP    L  +    Y     + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC--KENLY 100
                               G  W+ + K LTV++YL   V  G E N V  C       
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKHI 138

Query: 101 LIKTLTEFRYEDENSGGVD 119
           L + + E+R +  N G ++
Sbjct: 139 LSREVLEYRVKFSNDGKME 157

>KAFR0L02050 Chr12 complement(386478..388451) [1974 bp, 657 aa] {ON}
           Anc_8.863 YML088W
          Length = 657

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 166 DEDLQRALEESRRTAEEDERKRRLNQDDSD 195
           DE+ +R LEES+R AE D+R+  ++ +D D
Sbjct: 567 DEEFRRILEESQRQAEIDQRRTPVSHEDDD 596

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,941,085
Number of extensions: 1281510
Number of successful extensions: 4093
Number of sequences better than 10.0: 109
Number of HSP's gapped: 4033
Number of HSP's successfully gapped: 147
Length of query: 487
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 373
Effective length of database: 40,409,475
Effective search space: 15072734175
Effective search space used: 15072734175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)