Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042603.495ON1581417611e-104
Kpol_480.133.495ON1571284607e-59
NCAS0E007803.495ON1711324288e-54
NDAI0G009103.495ON1631194164e-52
ZYRO0D09878g3.495ON1531334061e-50
YGR133W (PEX4)3.495ON1831343976e-49
TDEL0D056303.495ON1501323939e-49
Skud_7.4443.495ON1621343843e-47
CAGL0I10450g3.495ON1621413782e-46
Kwal_55.212463.495ON1601283757e-46
Suva_7.4213.495ON1651343704e-45
Smik_6.2293.495ON1651343662e-44
KLTH0F14894g3.495ON1661323662e-44
SAKL0F02706g3.495ON1611283634e-44
KAFR0C019903.495ON1511313609e-44
TBLA0C045003.495ON1651333558e-43
AFR314W3.495ON1551283026e-35
Ecym_12343.495ON1611312959e-34
KNAG0B007803.495ON1531252913e-33
KLLA0E04027g3.495ON1581322089e-21
SAKL0B10582g7.54ON1611021889e-18
ABR059W2.569ON1651201881e-17
TDEL0H039707.54ON1561061871e-17
Kpol_461.86.109ON1671041871e-17
Ecym_45782.569ON1651201862e-17
ZYRO0C04950g6.109ON1681041862e-17
SAKL0A07260g6.109ON1691041862e-17
TDEL0G036106.109ON1691041862e-17
Ecym_30776.109ON1701041862e-17
AAR156C6.109ON1701041862e-17
Smik_7.2226.109ON1711041862e-17
YGL058W (RAD6)6.109ON1721041862e-17
Suva_7.2136.109ON1731041862e-17
KLTH0H06732g6.109ON1601041852e-17
SAKL0D13552g2.569ON1651201853e-17
CAGL0M07568g2.569ON1651201853e-17
NCAS0D032206.109ON1711041853e-17
Kpol_1065.127.54ON1591111843e-17
KLLA0C05632g6.109ON1641041844e-17
Suva_13.1892.569ON1651201844e-17
Skud_13.1762.569ON1651201844e-17
Smik_13.1862.569ON1651201844e-17
KNAG0F025706.109ON1511041834e-17
KAFR0A047006.109ON1531041834e-17
TDEL0B065702.569ON1651231835e-17
YMR022W (UBC7)2.569ON1651201835e-17
CAGL0I00352g6.109ON1671041836e-17
TPHA0J017506.109ON1691041836e-17
Kwal_14.18286.109ON1521041818e-17
ZYRO0D04466g7.54ON159971811e-16
KAFR0A021602.569ON1651201811e-16
TPHA0I024602.569ON1671151811e-16
TBLA0F024406.109ON1741041811e-16
NDAI0E038707.54ON1641021801e-16
NDAI0I016506.109ON1761041802e-16
KLTH0D01760g7.54ON1611021792e-16
KLLA0E07745g2.569ON1651231792e-16
ZYRO0E06358g2.569ON1651201792e-16
Kwal_26.70097.54ON1611061783e-16
Kwal_26.82242.569ON1651201783e-16
Skud_7.2226.109ON1701041783e-16
KLTH0D07986g2.569ON1651201774e-16
TBLA0H026102.569ON1651201766e-16
YOR339C (UBC11)7.54ON1561171731e-15
Kpol_1056.52.569ON1651201732e-15
NCAS0A127402.569ON1651151732e-15
Skud_15.5047.54ON1561061722e-15
NDAI0B015202.569ON1651201722e-15
Suva_8.3897.54ON156971713e-15
Smik_15.5177.54ON1561061713e-15
KNAG0M021502.569ON1701111697e-15
KNAG0A048108.375ON214941692e-14
Ecym_60388.375ON211891664e-14
ADR169C8.375ON211891664e-14
Suva_4.3263.308ON1481111625e-14
KAFR0B060608.375ON213891656e-14
KAFR0C002703.308ON1471111617e-14
KLTH0A07546g8.375ON215891648e-14
Suva_2.3438.375ON2151061648e-14
Skud_4.4418.375ON2151061648e-14
Smik_4.4258.375ON2151061648e-14
YDR177W (UBC1)8.375ON2151061648e-14
TBLA0H031308.375ON214891631e-13
ZYRO0C03784g8.375ON2181061631e-13
KNAG0J023403.308ON1611111601e-13
Skud_2.2073.308ON1481041591e-13
Smik_2.2193.308ON1481041591e-13
YBR082C (UBC4)3.308ON1481041591e-13
NDAI0A011608.375ON216891622e-13
TDEL0B056701.436ON2031221612e-13
Suva_2.2183.308ON1481041582e-13
Skud_4.3143.308ON1481041582e-13
YDR059C (UBC5)3.308ON1481041582e-13
CAGL0E00671g8.375ON213891612e-13
NCAS0B031508.375ON214891612e-13
Kwal_23.64858.375ON215891612e-13
TPHA0L008508.375ON216891612e-13
KLLA0A11198g1.436ON2021311603e-13
NDAI0A054903.308ON1471041573e-13
CAGL0E04752g3.308ON1471041573e-13
NCAS0A108003.308ON1481041573e-13
Smik_4.2973.308ON1481041573e-13
Kpol_1030.108.375ON215891603e-13
TDEL0F049908.375ON217891594e-13
KLTH0E14300g3.308ON1471041555e-13
SAKL0B06512g3.308ON1471041555e-13
Ecym_74313.308ON1471041555e-13
AER173C3.308ON1471041555e-13
TBLA0I021303.308ON1481041555e-13
CAGL0M03399g1.436ON2141311586e-13
SAKL0A00396g8.375ON215891586e-13
TDEL0F021003.308ON1471041547e-13
ZYRO0G12870g3.308ON147991531e-12
TPHA0A038503.308ON1481041531e-12
TBLA0A012901.436ON2191341561e-12
KLLA0E12563g3.308ON148991521e-12
Kpol_1052.23.308ON148991521e-12
NCAS0G031301.436ON2311111552e-12
KNAG0H018701.436ON2101311542e-12
Kwal_27.124013.308ON2361041552e-12
Kpol_1030.181.436ON2231221542e-12
ZYRO0E03806g1.436ON2091221524e-12
KAFR0H029601.436ON1871221514e-12
TPHA0O009201.436ON2261221525e-12
KLLA0C18656g8.375ON228891525e-12
Skud_5.871.436ON2101111516e-12
AEL045W1.436ON2111221508e-12
Suva_5.531.436ON2151111508e-12
Smik_5.981.436ON2151111508e-12
YEL012W (UBC8)1.436ON2181111509e-12
SAKL0D10560g1.436ON2071111481e-11
CAGL0G08063g8.230ON1491001452e-11
NDAI0D011401.436ON2451091492e-11
AGR121C8.230ON1541101452e-11
Ecym_13481.436ON2111221472e-11
Kwal_56.234828.230ON1491001442e-11
KAFR0H012303.308ON110931413e-11
KAFR0A024208.230ON1471001433e-11
KNAG0H029808.230ON1521001433e-11
NDAI0J015408.230ON1541001433e-11
KAFR0G032404.249ON157941433e-11
SAKL0H03058g4.249ON157941425e-11
Suva_2.2538.230ON1431001415e-11
Kwal_34.161741.436ON2131031446e-11
CAGL0D00814g4.249ON157941417e-11
SAKL0H17930g8.230ON1531001409e-11
Kwal_23.42274.249ON122941389e-11
KLTH0H13816g1.436ON2331031431e-10
KLLA0D09196g3.301ON292941441e-10
TBLA0I029604.249ON157941391e-10
Ecym_26693.301ON268941431e-10
AGL203C3.301ON270941431e-10
KLLA0C17622g8.230ON1591001391e-10
Smik_4.3358.230ON1431001381e-10
ZYRO0B11682g8.230ON1511001382e-10
NCAS0B040108.230ON1531001382e-10
YDR092W (UBC13)8.230ON1531001382e-10
Kpol_483.164.249ON122911362e-10
Ecym_32704.249ON157941382e-10
KLTH0C04818g3.301ON275941422e-10
Kwal_27.104443.301ON278941422e-10
Skud_4.3528.230ON1431001372e-10
KLTH0G14366g8.230ON1491001372e-10
KLTH0D14344g4.249ON1571001373e-10
KLLA0E05039g4.249ON157941373e-10
TDEL0A013408.230ON1571001373e-10
TDEL0E012204.249ON157941373e-10
ZYRO0B12386g4.249ON157941373e-10
SAKL0D02530g3.301ON272941413e-10
Ecym_55638.230ON1641101373e-10
YDR054C (CDC34)3.301ON295941413e-10
Suva_2.2113.301ON297941413e-10
Skud_4.3063.301ON297941413e-10
Smik_4.2903.301ON297941413e-10
NCAS0I014303.301ON258941403e-10
Kpol_1075.1b8.230ON1521101363e-10
NDAI0D043804.249ON157941364e-10
NCAS0A024904.249ON157941364e-10
NDAI0A055303.301ON273941404e-10
NCAS0A107703.301ON273941404e-10
TPHA0M012803.301ON435941414e-10
ZYRO0G12650g3.301ON285941404e-10
KAFR0H012703.301ON287941404e-10
TDEL0D032603.301ON289941404e-10
CAGL0E04598g3.301ON295941404e-10
KNAG0H010403.301ON296941404e-10
NDAI0D029104.49ON189991374e-10
Kpol_1065.453.301ON323941404e-10
TPHA0B034108.230ON1521101354e-10
YDL064W (UBC9)4.249ON157911355e-10
TBLA0G032703.301ON330941396e-10
Suva_4.1864.249ON157911347e-10
Smik_4.1714.249ON157911347e-10
AER056C4.249ON157941331e-09
Skud_4.1914.249ON157911321e-09
TBLA0F037908.230ON1511001312e-09
NDAI0A075703.301ON239921342e-09
NCAS0A059404.49ON1931031322e-09
TPHA0B007704.249ON157901294e-09
KNAG0D043904.249ON157911285e-09
KNAG0J022803.301ON2171181306e-09
KLLA0E20395g7.392ON251881272e-08
CAGL0D06468g4.49ON187911252e-08
Kpol_414.2singletonOFF192991252e-08
Kpol_YGOB_414.24.49ON193991252e-08
TBLA0E015704.49ON194871252e-08
KAFR0F030404.49ON169861242e-08
KLTH0H09504g4.49ON184831243e-08
Ecym_46837.392ON243881253e-08
Suva_10.4014.49ON1871261225e-08
CAGL0I05478g7.392ON246881202e-07
KAFR0L017507.392ON251881202e-07
Kpol_1045.397.392ON253871202e-07
Smik_12.3894.49ON187871182e-07
SAKL0F12474g7.392ON2511201192e-07
YLR306W (UBC12)4.49ON188991173e-07
TPHA0F003904.49ON1931041173e-07
ADL035C4.49ON200911173e-07
KLTH0C06688g7.392ON246881183e-07
KNAG0B023607.392ON251881183e-07
Suva_5.2197.392ON249881174e-07
Skud_5.2257.392ON2501201174e-07
Smik_5.2467.392ON2501201174e-07
TDEL0C015507.392ON248871166e-07
YER100W (UBC6)7.392ON250881166e-07
Kwal_27.108377.392ON246881158e-07
KNAG0I029404.49ON197861131e-06
NCAS0E026007.392ON255881141e-06
NDAI0E041707.392ON257881141e-06
AGR372W7.392ON242881131e-06
TPHA0K008207.392ON257871132e-06
NDAI0A016507.392ON251881122e-06
Ecym_83714.49ON267871122e-06
NCAS0A143907.392ON240871113e-06
ZYRO0B03344g7.392ON250871113e-06
TBLA0D006007.392ON256871113e-06
SAKL0H24112g4.49ON185791093e-06
TDEL0E055604.49ON187861085e-06
Skud_12.3894.49ON187851085e-06
KLLA0C17248g4.49ON1841371032e-05
ZYRO0G19910g4.49ON17993860.005
Skud_7.1956.187ON10085820.007
KLLA0E19119g6.187ON13990810.016
CAGL0H03157g6.187ON13988800.021
Suva_7.1826.187ON13785790.029
Smik_7.1966.187ON10086770.033
Ecym_22306.187ON13888770.054
Suva_3.111.412ON37981780.076
YGL087C (MMS2)6.187ON13786750.100
YCL008C (STP22)1.412ON38582760.14
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TPHA0D04260
         (477 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   297   e-104
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   181   7e-59
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   169   8e-54
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   164   4e-52
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   160   1e-50
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   157   6e-49
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   155   9e-49
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   152   3e-47
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   150   2e-46
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   149   7e-46
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   147   4e-45
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   145   2e-44
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   145   2e-44
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   144   4e-44
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   143   9e-44
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   141   8e-43
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   120   6e-35
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   118   9e-34
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   116   3e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    85   9e-21
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    77   9e-18
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    77   1e-17
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    77   1e-17
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    77   1e-17
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    76   2e-17
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    76   2e-17
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    76   2e-17
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    76   2e-17
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    76   2e-17
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    76   2e-17
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    76   2e-17
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    76   2e-17
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    76   2e-17
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    76   2e-17
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    76   3e-17
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    76   3e-17
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      76   3e-17
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    75   3e-17
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    75   4e-17
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    75   4e-17
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    75   4e-17
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    75   4e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    75   4e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   4e-17
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    75   5e-17
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    75   5e-17
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    75   6e-17
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    75   6e-17
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    74   8e-17
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    74   1e-16
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    74   1e-16
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    74   1e-16
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    74   1e-16
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    74   1e-16
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      74   2e-16
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    74   2e-16
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    74   2e-16
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    74   2e-16
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    73   3e-16
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    73   3e-16
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    73   3e-16
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    73   4e-16
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    72   6e-16
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    71   1e-15
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    71   2e-15
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    71   2e-15
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    71   2e-15
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    71   2e-15
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    70   3e-15
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    70   3e-15
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    70   7e-15
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    70   2e-14
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    69   4e-14
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    69   4e-14
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    67   5e-14
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    68   6e-14
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    67   7e-14
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    68   8e-14
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    68   8e-14
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    68   8e-14
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    68   8e-14
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    68   8e-14
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    67   1e-13
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    67   1e-13
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    66   1e-13
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    66   1e-13
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    66   1e-13
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    66   1e-13
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      67   2e-13
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    67   2e-13
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    65   2e-13
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    65   2e-13
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    65   2e-13
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    67   2e-13
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      67   2e-13
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    67   2e-13
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    67   2e-13
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    66   3e-13
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    65   3e-13
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    65   3e-13
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    65   3e-13
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    65   3e-13
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    66   3e-13
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    66   4e-13
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    64   5e-13
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    64   5e-13
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    64   5e-13
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    64   5e-13
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    64   5e-13
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    65   6e-13
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    65   6e-13
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    64   7e-13
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    64   1e-12
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    64   1e-12
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    65   1e-12
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    63   1e-12
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    63   1e-12
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                64   2e-12
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    64   2e-12
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    64   2e-12
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    64   2e-12
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    63   4e-12
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    63   4e-12
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    63   5e-12
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    63   5e-12
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    63   6e-12
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    62   8e-12
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    62   8e-12
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    62   8e-12
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    62   9e-12
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    62   1e-11
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    60   2e-11
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    62   2e-11
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    60   2e-11
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    61   2e-11
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    60   2e-11
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    59   3e-11
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    60   3e-11
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    60   3e-11
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    60   3e-11
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    60   3e-11
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    59   5e-11
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    59   5e-11
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    60   6e-11
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    59   7e-11
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    59   9e-11
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    58   9e-11
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    60   1e-10
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    60   1e-10
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    58   1e-10
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    60   1e-10
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    60   1e-10
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    58   1e-10
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    58   2e-10
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    58   2e-10
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    58   2e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    57   2e-10
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    58   2e-10
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    59   2e-10
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    59   2e-10
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    57   2e-10
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    57   2e-10
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    57   3e-10
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    57   3e-10
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    57   3e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    57   3e-10
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    57   3e-10
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    59   3e-10
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    57   3e-10
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    59   3e-10
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    59   3e-10
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    59   3e-10
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    59   3e-10
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                59   3e-10
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    57   3e-10
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    57   4e-10
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    57   4e-10
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    59   4e-10
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    59   4e-10
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    59   4e-10
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    59   4e-10
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                59   4e-10
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    59   4e-10
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    59   4e-10
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                59   4e-10
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       57   4e-10
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    59   4e-10
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    57   4e-10
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    57   5e-10
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    58   6e-10
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    56   7e-10
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    56   7e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    56   1e-09
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    55   1e-09
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    55   2e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    56   2e-09
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     55   2e-09
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    54   4e-09
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    54   5e-09
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    55   6e-09
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    54   2e-08
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    53   2e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    53   2e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    53   2e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    53   2e-08
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    52   2e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    52   3e-08
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    53   3e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    52   5e-08
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    51   2e-07
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    51   2e-07
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    51   2e-07
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    50   2e-07
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    50   2e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    50   3e-07
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    50   3e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    50   3e-07
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    50   3e-07
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    50   3e-07
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    50   4e-07
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    50   4e-07
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    50   4e-07
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    49   6e-07
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    49   6e-07
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    49   8e-07
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    48   1e-06
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    49   1e-06
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    49   1e-06
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    48   1e-06
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    48   2e-06
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    48   2e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    48   2e-06
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    47   3e-06
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    47   3e-06
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    47   3e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    47   3e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    46   5e-06
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    46   5e-06
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    44   2e-05
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    38   0.005
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    36   0.007
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    36   0.016
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    35   0.021
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    35   0.029
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    34   0.033
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    34   0.054
Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON} Y...    35   0.076
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    33   0.100
YCL008C Chr3 complement(105696..106853) [1158 bp, 385 aa] {ON}  ...    34   0.14 
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    32   0.25 
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    32   0.35 
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    32   0.35 
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    31   0.65 
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    31   0.89 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    30   2.2  
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    29   2.9  
Skud_15.440 Chr15 complement(777845..779860) [2016 bp, 671 aa] {...    30   3.0  
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    29   3.0  
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    29   3.0  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    30   3.9  
Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}...    29   5.0  
KLLA0F11022g Chr6 complement(1016214..1018880) [2667 bp, 888 aa]...    29   5.6  
AEL270W Chr5 (132790..134703) [1914 bp, 637 aa] {ON} Syntenic ho...    29   7.2  
YOR275C Chr15 complement(839084..841069) [1986 bp, 661 aa] {ON} ...    29   7.3  
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    29   7.4  
Kwal_14.2476 s14 complement(772414..774783) [2370 bp, 789 aa] {O...    29   7.4  
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    28   7.5  
TBLA0C02680 Chr3 (642682..645813) [3132 bp, 1043 aa] {ON} Anc_1....    29   7.6  
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    28   8.4  
KLTH0H10208g Chr8 complement(875962..878361) [2400 bp, 799 aa] {...    28   9.9  

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  297 bits (761), Expect = e-104
 Identities = 141/141 (100%), Positives = 141/141 (100%)
 Frame = +1

Query: 52  SGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPY 231
           SGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPY
Sbjct: 18  SGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPY 77

Query: 232 SMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRA 411
           SMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRA
Sbjct: 78  SMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRA 137

Query: 412 GDTSAYHGLINYYLQEDTATH 474
           GDTSAYHGLINYYLQEDTATH
Sbjct: 138 GDTSAYHGLINYYLQEDTATH 158

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  181 bits (460), Expect = 7e-59
 Identities = 81/128 (63%), Positives = 98/128 (76%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 249
           I  LEP+  ++   W A + GP NTPYH HSF L I L  EYPL PP +TF  Y MPHCN
Sbjct: 24  ISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCN 83

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           +EF TGKICLNIL++ +WSPVWNL+ V++A+YQLL +PV DSPLNIDL+NIL+  DTSAY
Sbjct: 84  IEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSAY 143

Query: 430 HGLINYYL 453
           +GLI YYL
Sbjct: 144 YGLIEYYL 151

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  169 bits (428), Expect = 8e-54
 Identities = 74/132 (56%), Positives = 96/132 (72%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           +++ I  L P++  +   W+A +KGP  TPY  H F+L IE P  YP+ PP I F+P SM
Sbjct: 30  FNQIITYLHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSM 89

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
           PHCNV F TG ICL+ILE +HW+P WNLM  M A++ LL++PV DSPLN+D+ANILR  D
Sbjct: 90  PHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVND 149

Query: 418 TSAYHGLINYYL 453
            SAY+GL+NYYL
Sbjct: 150 QSAYNGLLNYYL 161

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  164 bits (416), Expect = 4e-52
 Identities = 71/119 (59%), Positives = 94/119 (78%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++  KW AV+KGP  TPY+  +F L I +P EYP VPP   F+P SMPHCNV ++TG+IC
Sbjct: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+IL+ +HW+PVWNLM  + A++ LL++PV +SPLN+DLAN+LR GD SAY+GLINYYL
Sbjct: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  160 bits (406), Expect = 1e-50
 Identities = 70/133 (52%), Positives = 101/133 (75%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           YS+ I  +EP   E+  +W A+++GP  TPY   +F+L + LP EYP+ PP + FEPY+M
Sbjct: 22  YSQLIVGMEPK--EDLTRWEALIRGPSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAM 79

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
           PH NV+F TG+ICL+IL  +HWSP W+L++V+ A+ QLL EPV  SPLN+D+ANIL+A D
Sbjct: 80  PHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKAND 139

Query: 418 TSAYHGLINYYLQ 456
            +AY+GL++YY++
Sbjct: 140 MNAYYGLVHYYIK 152

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  157 bits (397), Expect = 6e-49
 Identities = 67/134 (50%), Positives = 99/134 (73%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           Y   IE L P+   +  KW A++ GP +TPY  H F++LIE+PS YP+ PP I+F   ++
Sbjct: 43  YRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNI 102

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
            HCNV+ +TG+ICLNIL+ E W+PVW+L++ + A+++LL+EPV DSPL++D+ NI+R GD
Sbjct: 103 LHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGD 162

Query: 418 TSAYHGLINYYLQE 459
            SAY G++ Y+L E
Sbjct: 163 MSAYQGIVKYFLAE 176

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  155 bits (393), Expect = 9e-49
 Identities = 72/132 (54%), Positives = 91/132 (68%)
 Frame = +1

Query: 61  SESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMP 240
           S  +  LEP+  +   +W   ++GP  TPY  H+F L + L   YP  PP +TF   SMP
Sbjct: 19  SSLVVSLEPIDGD-LSRWAGEIRGPTGTPYEGHTFSLRLVLGDRYPTTPPQVTFARRSMP 77

Query: 241 HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDT 420
           HCNV + TG ICLNIL  EHWSP W+L++V+ A+ QLL +P  DSPL+IDLANILRA D 
Sbjct: 78  HCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPDSPLDIDLANILRAQDR 137

Query: 421 SAYHGLINYYLQ 456
           SAY+GL+NYYLQ
Sbjct: 138 SAYYGLVNYYLQ 149

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  152 bits (384), Expect = 3e-47
 Identities = 64/134 (47%), Positives = 98/134 (73%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           Y   IE L P+   +  KW A++ GP +TPY  + F++LI++PS YP+ PP I F+  ++
Sbjct: 25  YQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNI 84

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
            HCN++  TG+ICL+IL+ E W+PVW+L++ + A+++LL+EPV DSPL++D+ NI+R GD
Sbjct: 85  LHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGD 144

Query: 418 TSAYHGLINYYLQE 459
           T AY G+I Y+L E
Sbjct: 145 TGAYQGIIRYFLAE 158

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  150 bits (378), Expect = 2e-46
 Identities = 71/141 (50%), Positives = 100/141 (70%), Gaps = 6/141 (4%)
 Frame = +1

Query: 55  GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYS 234
           G SE +  L PV   +  +W AV+KGP  TPY+ + FKL IE+P+ YP+VPP I F   +
Sbjct: 18  GDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDA 77

Query: 235 M------PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
                  PHCNV+  TG+ICL+IL+ E WSP+W++++V+ A++ LLQEPV DSPL++D+A
Sbjct: 78  KAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137

Query: 397 NILRAGDTSAYHGLINYYLQE 459
           NIL+  D SAY+G+I Y+L E
Sbjct: 138 NILKNNDMSAYNGIIRYFLTE 158

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  149 bits (375), Expect = 7e-46
 Identities = 65/128 (50%), Positives = 90/128 (70%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 249
           I  L PV+ +N   W A + GP +TPY  H F LLI +PS YPL PP + F    +PHCN
Sbjct: 25  IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCN 84

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           V+F +G+IC+N+LE  HWSP W+L++++ A++ LL  P  DSPL++DLA + RAGD SA+
Sbjct: 85  VDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLACLRRAGDYSAH 144

Query: 430 HGLINYYL 453
           +GL+ YYL
Sbjct: 145 NGLVAYYL 152

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  147 bits (370), Expect = 4e-45
 Identities = 62/134 (46%), Positives = 95/134 (70%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           Y   IE L P    +  KW A + GP +TPY ++ F++LI++P  YP+ PP I FE  ++
Sbjct: 25  YRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAI 84

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
            HCN+  STG+ICL+IL+ + W+PVW+L++ + A+++LL+EPV DSPL++D+ NI+R GD
Sbjct: 85  LHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGD 144

Query: 418 TSAYHGLINYYLQE 459
             AY G++ Y+L E
Sbjct: 145 KRAYQGIVKYFLAE 158

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  145 bits (366), Expect = 2e-44
 Identities = 62/134 (46%), Positives = 94/134 (70%)
 Frame = +1

Query: 58  YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           Y   I  L P+   +  +W A + GP +TPY  + F +LI++PS YP+ PP I FE   +
Sbjct: 25  YRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDI 84

Query: 238 PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
            HCNV+ +TG+ICL+IL+ E W+PVW+L++ + A+++LL+EPV DSPL++D+ NI+R  D
Sbjct: 85  LHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCAD 144

Query: 418 TSAYHGLINYYLQE 459
            SAY G++ Y+L E
Sbjct: 145 ESAYQGIVKYFLAE 158

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  145 bits (366), Expect = 2e-44
 Identities = 64/132 (48%), Positives = 91/132 (68%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           L PV+ EN  KW +++ GP +TPY  H F L IE    YPL PP + F+   MPHCNV+F
Sbjct: 28  LAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDF 87

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGL 438
            +G+ICL++L+  HW+P W+L++V+ A++ LL  P  DSPL++DLA ++RAGD SA++ L
Sbjct: 88  DSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSL 147

Query: 439 INYYLQEDTATH 474
           I YYL   +  H
Sbjct: 148 IAYYLNGGSRGH 159

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  144 bits (363), Expect = 4e-44
 Identities = 69/128 (53%), Positives = 89/128 (69%), Gaps = 3/128 (2%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYS---MPHCN 249
           LEP    N   W A + GP  TPY    F L +ELP +YPL PP + F P S   + HCN
Sbjct: 29  LEPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCN 88

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           V+F TG+ICL+IL  EHWSPVW+L++V+ A++ LL EPV +SPLN+D+AN+L+AGD  AY
Sbjct: 89  VDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAY 148

Query: 430 HGLINYYL 453
            GLI YY+
Sbjct: 149 EGLIKYYI 156

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  143 bits (360), Expect = 9e-44
 Identities = 64/131 (48%), Positives = 93/131 (70%)
 Frame = +1

Query: 61  SESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMP 240
           S+ I  L+P++ ++   W   +KGP+++P+  H+FKL I++P  YPL  P   FEP++MP
Sbjct: 17  SQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQTYPLTTPICKFEPFAMP 76

Query: 241 HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDT 420
           H NV F TG+ICL+IL+  +WSPV+N+ Y++ A+  LL EP   SPLN+DLAN+LR  D 
Sbjct: 77  HPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNFKSPLNLDLANLLRFDDL 135

Query: 421 SAYHGLINYYL 453
            AYH LI+Y+L
Sbjct: 136 KAYHDLISYHL 146

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  141 bits (355), Expect = 8e-43
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query: 64  ESIELLEPV--AFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSM 237
           +++  L PV  A  +   W +++ GP ++PYH  SF L I +P+EYP +PP I F   S+
Sbjct: 19  DNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSI 78

Query: 238 P-HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAG 414
           P HCNV F+TG+ICLNIL++E+WSPVWNL+Y + A+ QLL  P   SPLNIDL+ +L   
Sbjct: 79  PPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLK 138

Query: 415 DTSAYHGLINYYL 453
           D+ AY+ LI YYL
Sbjct: 139 DSKAYNSLIKYYL 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  120 bits (302), Expect = 6e-35
 Identities = 60/128 (46%), Positives = 86/128 (67%), Gaps = 2/128 (1%)
 Frame = +1

Query: 79  LEPVAFEN--FLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNV 252
           L PV  EN    +W A  +GP NTPY   +F L I +P  YP  PP  +F P+ + H N+
Sbjct: 24  LAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNI 83

Query: 253 EFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYH 432
           ++STG++CL++L+HE WSPV+NL+ V+ A+  LL EP VDSPL++DL+  L   D +AY 
Sbjct: 84  KWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSR-LYTTDRAAYD 142

Query: 433 GLINYYLQ 456
           G++NY L+
Sbjct: 143 GVVNYRLR 150

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  118 bits (295), Expect = 9e-34
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 1/131 (0%)
 Frame = +1

Query: 64  ESIELLEPVAFENFL-KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMP 240
           ESI +L P      L KW A   GP NTPY   +F L IE+P  YP  PP   F P  + 
Sbjct: 27  ESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHIC 86

Query: 241 HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDT 420
           H N+++STG++CL++L+HE WSP++NL+ V+ A+  LL EP VDSPL++DLA  L + D 
Sbjct: 87  HPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK-LYSVDK 145

Query: 421 SAYHGLINYYL 453
            AY GL+ Y L
Sbjct: 146 QAYQGLVTYRL 156

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  116 bits (291), Expect = 3e-33
 Identities = 55/125 (44%), Positives = 80/125 (64%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           L P    +   W A L+GP  TPY  HSF L + +P +YP +PP++ F   +MPH NV++
Sbjct: 24  LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKW 83

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGL 438
            TG++CL+ L    W+PV +L Y ++A+ +LL EP  +SPLN++LA + R GD  AY G+
Sbjct: 84  DTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGI 142

Query: 439 INYYL 453
           I Y L
Sbjct: 143 IKYRL 147

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 84.7 bits (208), Expect = 9e-21
 Identities = 48/132 (36%), Positives = 80/132 (60%), Gaps = 2/132 (1%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE-YPLVP-PAITFEPYSMPH 243
           I  L PV  ++  +W    +GP  +P+      L I +  E YP+   P + FEP ++ H
Sbjct: 23  ISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAH 82

Query: 244 CNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTS 423
            NV++ TG+ICL++L+ + W+P++ L+ V+ A+  LL +P +DSPL++D+A I  A D  
Sbjct: 83  PNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDA-DYE 140

Query: 424 AYHGLINYYLQE 459
           AY  ++ Y L+E
Sbjct: 141 AYVQIVRYRLEE 152

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 77.0 bits (188), Expect = 9e-18
 Identities = 40/102 (39%), Positives = 60/102 (58%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++  KW  ++ GP  TPY    FK+ ++ P  YP   P +TF    M H NV+ S G IC
Sbjct: 42  DDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFVS-PMWHPNVDMS-GNIC 99

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           L+IL+ + WS V+N+  ++++L  LL+EP   SPLN   A +
Sbjct: 100 LDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 77.0 bits (188), Expect = 1e-17
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           PV+ +N   W  +++GP ++PY    F   ++ P +YPL PP +TF P S+ H NV +  
Sbjct: 28  PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFTP-SILHPNV-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 76.6 bits (187), Expect = 1e-17
 Identities = 41/106 (38%), Positives = 63/106 (59%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + ++  +W  V+ GP  TPY    F+L ++   +YP  PP +TF    M H NV+ S 
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVS-PMWHPNVDMS- 90

Query: 265 GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           G ICL+IL+ + WS V+N+  ++++L  LL+EP   SPLN   A +
Sbjct: 91  GNICLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAEL 135

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 76.6 bits (187), Expect = 1e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           PV  EN   W  ++ GP ++PY    F   ++ P++YPL PP +TF P S+ H NV +  
Sbjct: 28  PVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDYPLSPPKLTFTP-SILHPNV-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 76.3 bits (186), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 75.9 bits (185), Expect = 2e-17
 Identities = 36/104 (34%), Positives = 63/104 (60%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP  TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 27  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 84

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 85  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 75.9 bits (185), Expect = 3e-17
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + +N   W  ++ GP ++PY    F  ++E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPRLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANIDACILWR 145

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 75.9 bits (185), Expect = 3e-17
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + +N   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 75.9 bits (185), Expect = 3e-17
 Identities = 36/104 (34%), Positives = 63/104 (60%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP  TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 75.5 bits (184), Expect = 3e-17
 Identities = 45/111 (40%), Positives = 62/111 (55%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           EN  KW   + GP ++PY    FK+ +  P  YP  PP + F    M H NV+ S G IC
Sbjct: 40  ENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFVS-PMWHPNVDLS-GNIC 97

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           L++L+ E WS V+N+  ++++L  LL EP   SPLN  +A  L  GD   Y
Sbjct: 98  LDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 75.5 bits (184), Expect = 4e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 75.5 bits (184), Expect = 4e-17
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P +  N   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 75.5 bits (184), Expect = 4e-17
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P +  N   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 75.5 bits (184), Expect = 4e-17
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P +  N   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 75.1 bits (183), Expect = 4e-17
 Identities = 35/104 (33%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   +YP  PP + F    M H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEIC 73

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 75.1 bits (183), Expect = 4e-17
 Identities = 35/104 (33%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   +YP  PP + F    M H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEIC 73

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17
 Identities = 38/123 (30%), Positives = 66/123 (53%), Gaps = 12/123 (9%)
 Frame = +1

Query: 76  LLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVE 255
           L  P +  N   W  +++GP +TPY    F   ++ P +YPL PP +TF P S+ H N+ 
Sbjct: 25  LAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI- 82

Query: 256 FSTGKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLAN 399
           +  G++C++IL              E WSPV ++  +++++  +L EP ++S  N+D   
Sbjct: 83  YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANVDACI 142

Query: 400 ILR 408
           + R
Sbjct: 143 LWR 145

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P +  N   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 75.1 bits (183), Expect = 6e-17
 Identities = 35/104 (33%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   +YP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 75.1 bits (183), Expect = 6e-17
 Identities = 36/104 (34%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFIS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 74.3 bits (181), Expect = 8e-17
 Identities = 35/104 (33%), Positives = 63/104 (60%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP  TPY   +F+LL+E   EYP  PP + F    + H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EIFHPNV-YANGEIC 73

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 74.3 bits (181), Expect = 1e-16
 Identities = 39/97 (40%), Positives = 56/97 (57%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W  ++ GP  TPY    FK+ +  P  YP VPP + F    M H NV+ S G ICL+IL+
Sbjct: 45  WSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFIS-PMWHPNVDMS-GNICLDILK 102

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
            + WS V+N+  ++++L  L +EP   SPLN   A +
Sbjct: 103 -DQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAEL 138

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 74.3 bits (181), Expect = 1e-16
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P   +N  +W  +++GP ++PY    F   ++ P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 74.3 bits (181), Expect = 1e-16
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 12/115 (10%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  +W  ++ GP  TPY    F   +  P +YPL PP +TF P S+ H N+ +  G++C+
Sbjct: 35  NMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSPPKLTFTP-SLLHPNI-YPNGEVCI 92

Query: 280 NILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           +IL              E WSPV ++  +++++  +L EP ++S  NID + + R
Sbjct: 93  SILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDASILYR 147

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 74.3 bits (181), Expect = 1e-16
 Identities = 35/104 (33%), Positives = 64/104 (61%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +TPY   +F+L++E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 73.9 bits (180), Expect = 1e-16
 Identities = 41/102 (40%), Positives = 59/102 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           E+   W A++ GP +TPY    FKL  +    YP  PP + F    M H NV+ S G IC
Sbjct: 44  EDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFIS-PMWHPNVDMS-GNIC 101

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           L+IL+ + WS V+N+  ++++L  LL+EP   SPLN   A +
Sbjct: 102 LDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAEL 142

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 73.9 bits (180), Expect = 2e-16
 Identities = 35/104 (33%), Positives = 63/104 (60%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP  TPY   +F+LL+E   EYP+  P + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 73.6 bits (179), Expect = 2e-16
 Identities = 40/102 (39%), Positives = 58/102 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           E+  KW  ++ GP  TPY    FK+ +E    YP   P + F    M H NV+ S G IC
Sbjct: 42  EDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDMS-GNIC 99

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           L+IL+ + WS V+N+  ++++L  LL+EP   SPLN   A +
Sbjct: 100 LDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 73.6 bits (179), Expect = 2e-16
 Identities = 38/123 (30%), Positives = 67/123 (54%), Gaps = 12/123 (9%)
 Frame = +1

Query: 76  LLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVE 255
           L  P+   N  +W  ++ GP ++ Y    F   ++ P +YPL PP +TF+P S+ H N+ 
Sbjct: 25  LASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPLNPPKLTFQP-SILHPNI- 82

Query: 256 FSTGKICLNIL------------EHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLAN 399
           +  G++C++IL            E E WSPV ++  +++++  +L EP ++S  NID   
Sbjct: 83  YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSILSEPNIESGANIDACI 142

Query: 400 ILR 408
           + R
Sbjct: 143 LWR 145

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 73.6 bits (179), Expect = 2e-16
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P +  +   W  +++GP +TPY    F   +E P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YHN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVDACILWR 145

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 73.2 bits (178), Expect = 3e-16
 Identities = 40/106 (37%), Positives = 60/106 (56%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + ++  KW  ++ GP  TPY    FK+ +E    YP   P + F    M H NV+ S 
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDMS- 95

Query: 265 GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           G ICL+IL+ + WS V+N+  ++++L  LL+EP   SPLN   A +
Sbjct: 96  GNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 73.2 bits (178), Expect = 3e-16
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + +N   W  ++ GP ++PY    F   +E P +YPL PP + F P S+ H N+ +  
Sbjct: 28  PKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 73.2 bits (178), Expect = 3e-16
 Identities = 35/104 (33%), Positives = 63/104 (60%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N + W A++ GP +T Y   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 31  DNVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEIC 88

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 72.8 bits (177), Expect = 4e-16
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P + +N   W  ++ GP ++PY    F   +E P +YPL PP + F P S+ H N+ +  
Sbjct: 28  PRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 72.4 bits (176), Expect = 6e-16
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P    +   W  ++ GP +TPY    F   ++ P++YPL PP +TF P S+ H NV +  
Sbjct: 28  PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFTP-SILHPNV-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACILWR 145

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 71.2 bits (173), Expect = 1e-15
 Identities = 46/117 (39%), Positives = 64/117 (54%)
 Frame = +1

Query: 52  SGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPY 231
           S  +ESI    PV   +   W   + GP +TPY    FK+ ++ P  YP  PP I F   
Sbjct: 22  SSTTESISAF-PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLS- 79

Query: 232 SMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
            M H NV+  +G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN   A +
Sbjct: 80  PMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P    +   W  +++GP +TPY    F   +  P +YPL PP +TF P ++ H N+ +  
Sbjct: 28  PANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDYPLSPPTLTFTP-AILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 12/115 (10%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N   W  +++GP +T Y    F   +E P +YPL PP +TF P S+ H N+ +  G++C+
Sbjct: 33  NLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCI 90

Query: 280 NILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           +IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 91  SILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDACILWR 145

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 70.9 bits (172), Expect = 2e-15
 Identities = 41/106 (38%), Positives = 57/106 (53%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           PV   +   W   + GP  TPY    FK+ +  P  YP  PP + F    M H NV+  +
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVS-PMWHPNVD-KS 89

Query: 265 GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN   A +
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 70.9 bits (172), Expect = 2e-15
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 12/120 (10%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           P    N   W  +++GP +T Y    F   ++ P +YPL PP +TF P S+ H N+ +  
Sbjct: 28  PANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 265 GKICLNILE------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           G++C++IL              E WSPV ++  +++++  +L EP ++S  NID   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 70.5 bits (171), Expect = 3e-15
 Identities = 40/97 (41%), Positives = 54/97 (55%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W   + GP  TPY    FK+ +  P  YP  PP + F    M H NV+ S G ICL+IL+
Sbjct: 41  WTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS-PMWHPNVDMS-GNICLDILK 98

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
            E WS V+N+  ++++L  LL EP   SPLN   A +
Sbjct: 99  -EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 70.5 bits (171), Expect = 3e-15
 Identities = 42/106 (39%), Positives = 57/106 (53%)
 Frame = +1

Query: 85  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 264
           PV   +   W   + GP  TPY    FK+ +  P  YP  PP I F    M H NV+  +
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFVS-PMWHPNVD-KS 89

Query: 265 GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANI 402
           G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN   A +
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAEL 134

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 69.7 bits (169), Expect = 7e-15
 Identities = 37/111 (33%), Positives = 62/111 (55%), Gaps = 12/111 (10%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W  +++GP ++PY    F+  +  P +YPL PP +TF P S+ H NV +  G++C++IL 
Sbjct: 37  WDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVP-SVLHPNV-YPNGEVCISILH 94

Query: 292 ------------HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
                        E WSPV ++  +++++  +L EP V+S  NID   + R
Sbjct: 95  APGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWR 145

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 37/94 (39%), Positives = 55/94 (58%)
 Frame = +1

Query: 115 RAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH 294
           +   +GP  TPY +  F + IE+P EYP  PP + F+   + H NV   TG ICL+IL++
Sbjct: 36  KGTFQGPPETPYDRGQFVVDIEVPMEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKN 94

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
             WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 95  A-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 68.6 bits (166), Expect = 4e-14
 Identities = 36/89 (40%), Positives = 53/89 (59%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPYH   F + I++P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYHGGKFVVDIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNS-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VLTLKTSLISLQALLQSPEPNDPQDAEVA 127

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 68.6 bits (166), Expect = 4e-14
 Identities = 36/89 (40%), Positives = 54/89 (60%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPYH  +F + I++P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNS-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VLTLKTSLISLQALLQSPEPNDPQDAEVA 127

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 39/111 (35%), Positives = 63/111 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +  D S Y
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 135

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 68.2 bits (165), Expect = 6e-14
 Identities = 36/89 (40%), Positives = 53/89 (59%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY   +F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYENGAFVVDIEVPMEYPFKPPQMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 66.6 bits (161), Expect = 7e-14
 Identities = 39/111 (35%), Positives = 63/111 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +  D S Y
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 134

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 37/89 (41%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H NV   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYENGKFIVDIEVPMEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 39/106 (36%), Positives = 58/106 (54%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           LE V+  +    +    GP  TPY    F + IE+P EYP  PP + F+   + H N+  
Sbjct: 24  LEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDT-KVYHPNISS 82

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
            TG ICL+IL++  WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 39/106 (36%), Positives = 58/106 (54%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           LE V+  +    +    GP  TPY    F + IE+P EYP  PP + F+   + H N+  
Sbjct: 24  LEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDT-KVYHPNISS 82

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
            TG ICL+IL++  WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 39/106 (36%), Positives = 58/106 (54%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           LE V+  +    +    GP  TPY    F + IE+P EYP  PP + F+   + H N+  
Sbjct: 24  LEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDT-KVYHPNISS 82

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
            TG ICL+IL++  WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 67.8 bits (164), Expect = 8e-14
 Identities = 39/106 (36%), Positives = 58/106 (54%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           LE V+  +    +    GP  TPY    F + IE+P EYP  PP + F+   + H N+  
Sbjct: 24  LEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDT-KVYHPNISS 82

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
            TG ICL+IL++  WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGRFMIDIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 38/106 (35%), Positives = 59/106 (55%)
 Frame = +1

Query: 79  LEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEF 258
           LE ++  +  + +    GP  TPY    F + IE+P EYP  PP + F+   + H N+  
Sbjct: 24  LEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPMEYPFKPPKMKFDT-KVYHPNISS 82

Query: 259 STGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
            TG ICL+IL++  WSPV  L   +++L  LLQ P  + P + ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 66.2 bits (160), Expect = 1e-13
 Identities = 39/111 (35%), Positives = 63/111 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 42  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 99

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +  D S Y
Sbjct: 100 LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 148

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++    +GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 15  DNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSIC 73

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L  ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 74  LDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 131

Query: 454 QE 459
            +
Sbjct: 132 DK 133

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 65.5 bits (158), Expect = 2e-13
 Identities = 36/104 (34%), Positives = 59/104 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP + F    + H N+  S+G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTT-KIYHPNIN-SSGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 65.5 bits (158), Expect = 2e-13
 Identities = 36/104 (34%), Positives = 59/104 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP + F    + H N+  S+G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTT-KIYHPNIN-SSGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 65.5 bits (158), Expect = 2e-13
 Identities = 36/104 (34%), Positives = 59/104 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP + F    + H N+  S+G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTT-KIYHPNIN-SSGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGKFIVDIEVPMEYPFKPPKMKFDS-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGQFIVDIEVPMEYPFKPPMMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    + + IE+P EYP  PP + F+   + H NV   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYENGKYIVDIEVPMEYPFKPPKMKFQT-KVYHPNVSSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPETPYEGGKFIVDIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 1/131 (0%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 249
           +EL+E    E  +K+     GP +TPY K  ++L +ELP  YP   P+I F    + H N
Sbjct: 23  VELVEDKMQEFHIKFH----GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPN 77

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSA 426
           ++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   
Sbjct: 78  IDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKDKDM 135

Query: 427 YHGLINYYLQE 459
           Y   I+ Y+ +
Sbjct: 136 YEQKIHEYINK 146

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 65.1 bits (157), Expect = 3e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 65.1 bits (157), Expect = 3e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-13
 Identities = 36/104 (34%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-13
 Identities = 36/104 (34%), Positives = 59/104 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP + F    + H N+  S+G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTT-KIYHPNIN-SSGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A I +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYK 129

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 66.2 bits (160), Expect = 3e-13
 Identities = 36/89 (40%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPETPYQGGRFIVDIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 65.9 bits (159), Expect = 4e-13
 Identities = 37/89 (41%), Positives = 52/89 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + IE+P EYP  PP + F+   + H NV   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYDGGLFIVDIEVPMEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 64.3 bits (155), Expect = 5e-13
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 64.3 bits (155), Expect = 5e-13
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 64.3 bits (155), Expect = 5e-13
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 64.3 bits (155), Expect = 5e-13
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 64.3 bits (155), Expect = 5e-13
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 65.5 bits (158), Expect = 6e-13
 Identities = 43/131 (32%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 249
           +EL+E    E  +K+     GP +TPY    ++L +ELP  YP   P+I F    + H N
Sbjct: 23  VELVEDSMQEFHVKFY----GPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPN 77

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMV-ALYQLLQEPVVDSPLNIDLANILRAGDTSA 426
           ++ ++G ICL+++ +  WSP+++L+ ++   L  LL+EP    PLN + AN L+  D   
Sbjct: 78  IDIASGSICLDVI-NSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKV 135

Query: 427 YHGLINYYLQE 459
           Y   +  Y+ +
Sbjct: 136 YEEKVREYIDK 146

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 65.5 bits (158), Expect = 6e-13
 Identities = 35/89 (39%), Positives = 53/89 (59%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY   +F + I++P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGNFIVDIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 63.9 bits (154), Expect = 7e-13
 Identities = 35/104 (33%), Positives = 59/104 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I F    + H N+  + G IC
Sbjct: 28  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTT-KIYHPNIN-ANGNIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 35/99 (35%), Positives = 57/99 (57%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W+A + GP ++PY    F L I  P++YP  PP I F    + H N+  + G ICL+IL+
Sbjct: 33  WQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTT-KIYHPNIN-ANGNICLDILK 90

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
            + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 91  -DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 63.5 bits (153), Expect = 1e-12
 Identities = 34/104 (32%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 64.7 bits (156), Expect = 1e-12
 Identities = 43/134 (32%), Positives = 73/134 (54%), Gaps = 1/134 (0%)
 Frame = +1

Query: 61  SESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMP 240
           +  +EL+     E F+K+     GP  TPY K  ++L +ELP  YP   P+I F    + 
Sbjct: 19  NHDVELVNDNMQEFFIKFF----GPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIF 73

Query: 241 HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGD 417
           H N++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D
Sbjct: 74  HPNIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRD 131

Query: 418 TSAYHGLINYYLQE 459
              Y   I  Y+ +
Sbjct: 132 KKLYEEKIKEYIDK 145

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 34/99 (34%), Positives = 58/99 (58%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G ICL+IL+
Sbjct: 34  WQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILK 91

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
            + WSP   +  V++++  LL +   D PL  ++A++ +
Sbjct: 92  -DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 34/99 (34%), Positives = 58/99 (58%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G ICL+IL+
Sbjct: 34  WQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILK 91

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
            + WSP   +  V++++  LL +   D PL  ++A++ +
Sbjct: 92  -DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 64.3 bits (155), Expect = 2e-12
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 118

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L   D   Y   I  Y+ +
Sbjct: 119 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYIDK 168

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 1/131 (0%)
 Frame = +1

Query: 70  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 249
           +EL+     E  +K+     GP +TPY    ++L +ELP  YP   P+I F    + H N
Sbjct: 23  VELINDSMQEFHIKFH----GPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPN 77

Query: 250 VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSA 426
           ++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   
Sbjct: 78  IDIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKM 135

Query: 427 YHGLINYYLQE 459
           Y   I  Y+ +
Sbjct: 136 YEEKIKEYIDK 146

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 64.3 bits (155), Expect = 2e-12
 Identities = 35/104 (33%), Positives = 60/104 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 117 DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 174

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 175 LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 217

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 28  DNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 86

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D + Y   I  Y+
Sbjct: 87  LDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

Query: 454 QE 459
            +
Sbjct: 145 DK 146

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 63.2 bits (152), Expect = 4e-12
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 29  DNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L  ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 88  LDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 145

Query: 454 QE 459
            +
Sbjct: 146 DK 147

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 62.8 bits (151), Expect = 4e-12
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 86  LDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKVLYEQKIKEYI 143

Query: 454 QE 459
            +
Sbjct: 144 DK 145

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 63.2 bits (152), Expect = 5e-12
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 88  LDVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

Query: 454 QE 459
            +
Sbjct: 146 DK 147

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 63.2 bits (152), Expect = 5e-12
 Identities = 35/89 (39%), Positives = 50/89 (56%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP  TPY    F + I +P EYP  PP + F+   + H NV   TG ICL+IL++  W+P
Sbjct: 41  GPSGTPYEGGKFVVDINIPVEYPYKPPQMKFDT-KVYHPNVSSVTGAICLDILKNA-WTP 98

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           V  L   +++L  LLQ P  + P +  +A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAQVA 127

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 62.8 bits (151), Expect = 6e-12
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 94

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 95  LYDLINILEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 144

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 62.4 bits (150), Expect = 8e-12
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP  TPY +  ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  +   Y   I  Y+
Sbjct: 86  LDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKNPQMYEEKIQEYI 143

Query: 454 QE 459
            +
Sbjct: 144 DK 145

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 62.4 bits (150), Expect = 8e-12
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 145

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 62.4 bits (150), Expect = 8e-12
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 145

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 62.4 bits (150), Expect = 9e-12
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 145

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 61.6 bits (148), Expect = 1e-11
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 1/111 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 26  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSP 83

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 459
           +++L+ ++  +   LL+EP    PLN + A  L+  +   Y   I  Y+ +
Sbjct: 84  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKNKELYEEKIQEYIDK 133

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 33/100 (33%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY K  FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 62.0 bits (149), Expect = 2e-11
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 113

Query: 310 VWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           +++L+ ++  +   LL+EP    PLN + A  L   D   Y   I  Y+
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELKDKKLYEERIKEYI 161

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 35/110 (31%), Positives = 61/110 (55%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    F+L + LP EYP+ PP + F    + H N++   G+IC
Sbjct: 30  DNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA 426
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A    A + +A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAKDWIADEAAA 136

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 61.2 bits (147), Expect = 2e-11
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP  TPY +  ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 453
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  +   Y   I  Y+
Sbjct: 86  LDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKNPKMYEEKIQEYI 143

Query: 454 QE 459
            +
Sbjct: 144 DK 145

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 33/100 (33%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           EN   ++  ++GP  +PY    FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 34/93 (36%), Positives = 54/93 (58%)
 Frame = +1

Query: 130 GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           GP ++PY    F L I  P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILK-DQWSP 58

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 408
              L  V++++  LL +   D PL  ++A+I +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 91

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 33/100 (33%), Positives = 58/100 (58%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY K  F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 26  DNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 83

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L+IL+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 84  LDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 32/100 (32%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GPV +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 32/100 (32%), Positives = 56/100 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 59.7 bits (143), Expect = 3e-11
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  +W A + G   T +H+  + L IE P EYP  PP +   P    H NV + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T + +  + + IE P +YP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  +++ +  LL  P  DSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.9 bits (141), Expect = 5e-11
 Identities = 32/100 (32%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 77

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 60.1 bits (144), Expect = 6e-11
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 1/103 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP  TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 73

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANI 402
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A +
Sbjct: 74  LDVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 58.9 bits (141), Expect = 7e-11
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    F + +E P EYP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 58.5 bits (140), Expect = 9e-11
 Identities = 31/100 (31%), Positives = 58/100 (58%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L++ +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 57.8 bits (138), Expect = 9e-11
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T + +  F + IE P +YP  PP + F P    H N+ + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 59.7 bits (143), Expect = 1e-10
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 1/103 (0%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N  ++     GP  TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 277 LNILEHEHWSPVWNLMYVMVALYQ-LLQEPVVDSPLNIDLANI 402
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A +
Sbjct: 86  LDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 60.1 bits (144), Expect = 1e-10
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  ++ P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N   W A + G  +T +H   + + IE P EYP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 59.7 bits (143), Expect = 1e-10
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  +  P ++P  PP+  F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 59.7 bits (143), Expect = 1e-10
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  +  P ++P  PP+  F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 58.2 bits (139), Expect = 1e-10
 Identities = 31/100 (31%), Positives = 58/100 (58%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L++ +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLKN-NWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 31/100 (31%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 77

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 31/100 (31%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLT-RIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L++ +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 31/100 (31%), Positives = 56/100 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 31/100 (31%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           +W A + G   T + +  + + IE P EYP  PP + F P    H NV + +G ICL+IL
Sbjct: 5   RWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICLSIL 62

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  +++ +  LL  P  +SP
Sbjct: 63  NEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    + + IE P +YP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   +  +++ +  LL  P  DSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 59.3 bits (142), Expect = 2e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 59.3 bits (142), Expect = 2e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 31/100 (31%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLT-RIYHPNID-RLGRIC 77

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 31/100 (31%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 1/100 (1%)
 Frame = +1

Query: 82  EPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFS 261
           +P    N  KW A + G   T +    F + IE P +YP  PP + F P    H N+ + 
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YP 88

Query: 262 TGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +G +CL+IL E + W P   L  + + +  LL  P  +SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    + L IE P +YP  PP + F P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 31/100 (31%), Positives = 56/100 (56%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   ++  ++GP  +PY    F L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLT-KIYHPNID-KLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    + + IE P EYP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    + + IE P EYP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   FK  ++ P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 34/110 (30%), Positives = 60/110 (54%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  + Y    F+L + LP EYP+ PP + F    + H N++   G+IC
Sbjct: 30  DNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA 426
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A    A + +A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAEDWIADEDAA 136

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 58.5 bits (140), Expect = 3e-10
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           YH   F+  ++ P ++P  PP   F P  + H NV +  GK+C++IL           ++
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLCISILHQSGDAMTSEPDN 119

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV ++  V++++  LL++P V SP N+D A
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 57.0 bits (136), Expect = 3e-10
 Identities = 33/110 (30%), Positives = 59/110 (53%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    F L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA 426
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A      ++SA
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDESSA 136

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 4e-10
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T + +  + + IE P+EYP  PP +   P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 4e-10
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T + +  + + IE P+EYP  PP +   P +  H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKL-PANFYHPNV-YPSGTICL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 58.9 bits (141), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV ++  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 57.4 bits (137), Expect = 4e-10
 Identities = 35/99 (35%), Positives = 52/99 (52%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y    F   +E    YP+ PP +      + H N++   GK+CLNIL  E WSP  ++  
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICTS-KLYHPNIDID-GKVCLNILR-EDWSPALDVQS 134

Query: 328 VMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLIN 444
           +++ L  LL EP    PLN D A +L + DT+ +  L+N
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKDAAMML-STDTARFASLVN 172

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 58.5 bits (140), Expect = 4e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 56.6 bits (135), Expect = 4e-10
 Identities = 33/110 (30%), Positives = 58/110 (52%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP  +PY    F L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSA 426
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A      +T A
Sbjct: 88  LDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNETGA 136

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 56.6 bits (135), Expect = 5e-10
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW A + G   T +    + + +E P+EYP  PP + F P    H NV + +G ICL+IL
Sbjct: 40  KWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSIL 97

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  +++ +  LL  P  +SP
Sbjct: 98  NEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 58.2 bits (139), Expect = 6e-10
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH----------- 294
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL             
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 56.2 bits (134), Expect = 7e-10
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW A + G   T +    + + +E P+EYP  PP + F P    H NV + +G ICL+IL
Sbjct: 40  KWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSIL 97

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  +++ +  LL  P  +SP
Sbjct: 98  NEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 56.2 bits (134), Expect = 7e-10
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW A + G   T +    + + +E P+EYP  PP + F P    H NV + +G ICL+IL
Sbjct: 40  KWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSIL 97

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  +++ +  LL  P  +SP
Sbjct: 98  NEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 55.8 bits (133), Expect = 1e-09
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N  KW A + G   T +    + + IE P +YP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCL 94

Query: 280 NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           +IL E + W P   +  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW A + G   T +    + + +E P+EYP  PP + F P    H NV + +G ICL+IL
Sbjct: 40  KWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSIL 97

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  +++ +  LL  P  +SP
Sbjct: 98  NEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 55.1 bits (131), Expect = 2e-09
 Identities = 30/100 (30%), Positives = 57/100 (57%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N   +   ++GP ++ Y    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  DNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRIC 87

Query: 277 LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           L++L++ +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 56.2 bits (134), Expect = 2e-09
 Identities = 31/92 (33%), Positives = 52/92 (56%), Gaps = 11/92 (11%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 294
           Y+   FK  ++ PS +P  PP   F P  + H NV +  GK+C++IL           ++
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDN 113

Query: 295 EHWSPVWNLMYVMVALYQLLQEPVVDSPLNID 390
           E WSPV ++  V++++  LL++P + SP N+D
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVD 145

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 55.5 bits (132), Expect = 2e-09
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +1

Query: 121 VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 300
           V+  P    Y    F+  +E    YP+ PP +      + H N++   GK+CLNIL  E 
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRN-RIYHPNIDVQ-GKVCLNILR-ED 129

Query: 301 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 429
           WSP  +L  ++V L  L  EP    PLN D A +  + D++A+
Sbjct: 130 WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAF 171

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-09
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL- 288
           W A + G   T +    + + IE P EYP  PP + F P    H N+ + +G +CL+IL 
Sbjct: 41  WEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILN 98

Query: 289 EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
           E + W P   L  +++ +  LL  P  +SP
Sbjct: 99  EDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 5e-09
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           +W A + G   T +    + L IE P EYP  PP +   P +  H NV + +G ICL+IL
Sbjct: 40  RWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKL-PANFYHPNV-YPSGTICLSIL 97

Query: 289 -EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 378
            E + W P   L  + + +  LL  P  +SP
Sbjct: 98  NEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 54.7 bits (130), Expect = 6e-09
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 12/118 (10%)
 Frame = +1

Query: 79  LEPVAFENFLKWRA-VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVE 255
           +E V   N  +W    +    ++ YH      L+  P  +P  PP   F P  + H NV 
Sbjct: 32  IELVEKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV- 89

Query: 256 FSTGKICLNIL-----------EHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 396
           FS G +C++IL           + E WSPV  +  V++++  LL +P V SP N+D A
Sbjct: 90  FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 53.5 bits (127), Expect = 2e-08
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  E W+P W+++ ++  L   +
Sbjct: 88  LSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 33/91 (36%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAIT-----FEPYSMPHCNVEFSTGKICLNILEHEHWSPV 312
           Y    F+        YP+ PP +      F P   PH       GKICLNIL  E WSP 
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLNILR-EDWSPA 127

Query: 313 WNLMYVMVALYQLLQEPVVDSPLNIDLANIL 405
            +L  +++ L  L QEP  + PLN + A +L
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVL 158

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 35/99 (35%), Positives = 49/99 (49%)
 Frame = +1

Query: 121 VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 300
           +L  P    Y    FK  ++    YP+ PP I      + H N++   GKICLNIL  E 
Sbjct: 72  LLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-ED 128

Query: 301 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
           WSP  +L  +++ L  L  E     PLN + ANIL + +
Sbjct: 129 WSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 35/99 (35%), Positives = 49/99 (49%)
 Frame = +1

Query: 121 VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 300
           +L  P    Y    FK  ++    YP+ PP I      + H N++   GKICLNIL  E 
Sbjct: 73  LLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-ED 129

Query: 301 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
           WSP  +L  +++ L  L  E     PLN + ANIL + +
Sbjct: 130 WSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 31/87 (35%), Positives = 45/87 (51%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y    F   +     YP+ PP + F    + H N++ + GKICLNIL  E WSPV +L  
Sbjct: 80  YKDGYFPFSMVFKDSYPIEPPVVKFLK-KIYHPNIDLN-GKICLNILR-EDWSPVLDLQS 136

Query: 328 VMVALYQLLQEPVVDSPLNIDLANILR 408
           +++ L  L  EP    PLN+    +L+
Sbjct: 137 IIIGLMFLFLEPNPRDPLNLKAGELLK 163

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 52.4 bits (124), Expect = 2e-08
 Identities = 33/86 (38%), Positives = 46/86 (53%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y+   FK  +     YP+ PP++      + H N++ + GKICLNIL  E WSP  ++  
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCLQ-KIYHPNIDLN-GKICLNILR-EDWSPALDIQS 114

Query: 328 VMVALYQLLQEPVVDSPLNIDLANIL 405
           V+V L  L  EP    PLN D A+ L
Sbjct: 115 VIVGLLFLFLEPNPRDPLNKDAASTL 140

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 52.4 bits (124), Expect = 3e-08
 Identities = 30/83 (36%), Positives = 43/83 (51%)
 Frame = +1

Query: 163 FKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVAL 342
           FK        YP+ PP +T     + H N++   G +CLNIL  E WSPV ++  +++ L
Sbjct: 78  FKFCATFKDTYPIEPPKVTLLS-KIFHPNIDLQ-GNVCLNILR-EDWSPVLDVQSILIGL 134

Query: 343 YQLLQEPVVDSPLNIDLANILRA 411
             L  EP    PLN   A++L A
Sbjct: 135 LMLFLEPNATDPLNKVAADVLAA 157

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 52.8 bits (125), Expect = 3e-08
 Identities = 27/88 (30%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           EN L+W  V+ GP +TPY    +   +  P EYP  PPAI     S P+   +  T ++C
Sbjct: 32  ENILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIRI---STPNGRFKQHT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVATILNGLLSFM 115

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.6 bits (122), Expect = 5e-08
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 8/126 (6%)
 Frame = +1

Query: 121 VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 300
           V+  P    Y+  S    ++    YP+ PP +T     + H N++ + G +CLNIL  E 
Sbjct: 65  VVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLK-KIFHPNIDLN-GNVCLNILR-ED 121

Query: 301 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANIL-----RAGDT---SAYHGLINYYLQ 456
           WSP  +L  +++ L  L  EP  + PLN D A +      +  +T   +   G +++ L 
Sbjct: 122 WSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETVILAMSGGSVDHVLY 181

Query: 457 EDTATH 474
           +D   H
Sbjct: 182 DDVVAH 187

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 50.8 bits (120), Expect = 2e-07
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           EN L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  ENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 50.8 bits (120), Expect = 2e-07
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYVITGPSDTPYSSGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDLWNPGWSVSTILTGLLSFM 115

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 50.8 bits (120), Expect = 2e-07
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L+W  V+ GP ++PYH   +   +  PS+YP  PPAI       P+   + +T ++CL
Sbjct: 33  NILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKENT-RLCL 88

Query: 280 NILEH--EHWSPVWNLMYVMVALYQLL 354
           ++ ++  + W+P W++  ++  L   +
Sbjct: 89  SMSDYHPDTWNPGWSVATILNGLLSFM 115

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 50.1 bits (118), Expect = 2e-07
 Identities = 31/87 (35%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = +1

Query: 148 YHKH-SFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLM 324
           Y+ H S    ++    YP+ PP +        H N++F  G +CLNIL  E WSP  +L 
Sbjct: 73  YYTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDFK-GNVCLNILR-EDWSPALDLQ 129

Query: 325 YVMVALYQLLQEPVVDSPLNIDLANIL 405
            ++  L  L  EP  + PLN D A +L
Sbjct: 130 SIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 50.4 bits (119), Expect = 2e-07
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 4/120 (3%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  P++YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL--QEPVVDSPLNIDLANILRAGDTSAYHGLIN 444
           + + ++  + W+P W++  +++ L   +   E    S    D      A  +  Y+ L N
Sbjct: 88  MTMSDYHPDTWNPAWSVATILMGLLSFMTGDEVTTGSITTSDAYKKKMAKKSKEYNALFN 147

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 49.7 bits (117), Expect = 3e-07
 Identities = 32/99 (32%), Positives = 48/99 (48%)
 Frame = +1

Query: 121 VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 300
           V+  P    Y+  S    ++    YP+ PP +      + H N++   G +CLNIL  E 
Sbjct: 66  VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLK-KIFHPNIDLK-GNVCLNILR-ED 122

Query: 301 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 417
           WSP  +L  ++  L  L  EP  + PLN D A +L  G+
Sbjct: 123 WSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGE 161

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 49.7 bits (117), Expect = 3e-07
 Identities = 35/104 (33%), Positives = 51/104 (49%), Gaps = 1/104 (0%)
 Frame = +1

Query: 133 PVNTPYHKHSFKLLIELPSEYPLVPP-AITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 309
           P   PY   +FK  ++    YP+ PP AI       P+ ++    GKICLNIL  E WSP
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIFHPNIDLN---GKICLNILR-EDWSP 132

Query: 310 VWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLI 441
             +L  +++ L  L  +     PLN   A +L A D + +  L+
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELV 175

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 49.7 bits (117), Expect = 3e-07
 Identities = 31/91 (34%), Positives = 46/91 (50%)
 Frame = +1

Query: 133 PVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPV 312
           P    Y    F+  +     YP+ PP +     ++ H N+++S G ICLN+L  E WSPV
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLN-TIYHPNIDYS-GNICLNVLR-EDWSPV 139

Query: 313 WNLMYVMVALYQLLQEPVVDSPLNIDLANIL 405
            +L  V++ L  L  EP    PLN   A+ +
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 50.1 bits (118), Expect = 3e-07
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P    +  T ++C
Sbjct: 32  DNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 50.1 bits (118), Expect = 3e-07
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  V+ GP  TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYVITGPPETPYEGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDLWNPGWSVSTILTGLLSFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 49.7 bits (117), Expect = 4e-07
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKPNT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 49.7 bits (117), Expect = 4e-07
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 4/120 (3%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP  TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKPNT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL--QEPVVDSPLNIDLANILRAGDTSAYHGLIN 444
           L++ ++  + W+P W++  ++  L   +   E    S    D    + A ++ +Y+   N
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSVTTSDHQKKILAKNSLSYNAFQN 147

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 49.7 bits (117), Expect = 4e-07
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 4/120 (3%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKPNT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL--QEPVVDSPLNIDLANILRAGDTSAYHGLIN 444
           L++ ++  + W+P W++  ++  L   +   E    S    D    + A ++ +Y+   N
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKMLARNSISYNSFQN 147

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 49.3 bits (116), Expect = 6e-07
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L+W  ++ GP +TPY +  +   +  PS+YP  PPAI       P+     +T ++CL
Sbjct: 33  NILEWHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFRENT-RLCL 88

Query: 280 NILEH--EHWSPVWNLMYVMVALYQLL 354
           ++ ++    W+P W++  ++  L   +
Sbjct: 89  SMSDYHPNTWNPSWSVSTILNGLLSFM 115

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 49.3 bits (116), Expect = 6e-07
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKPNT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 48.9 bits (115), Expect = 8e-07
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P    +  T ++C
Sbjct: 32  DNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 48.1 bits (113), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 43/86 (50%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y+   F+    +   YP+ PP +      + H N+   TG+ICLNIL  E WSP  +L  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKVVCLT-KIYHPNIN-RTGEICLNILR-EDWSPALDLQS 142

Query: 328 VMVALYQLLQEPVVDSPLNIDLANIL 405
           V++ L  L  EP    PLN   A+ L
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL 168

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 48.5 bits (114), Expect = 1e-06
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDLWNPGWSVNTILNGLLSFM 115

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 48.5 bits (114), Expect = 1e-06
 Identities = 22/88 (25%), Positives = 49/88 (55%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP ++PY +  +   +  P++YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPPDSPYSEGQYHGTLTFPTDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDLWNPSWSVSTILTGLLSFM 115

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 48.1 bits (113), Expect = 1e-06
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L W  V+ GP  TPY    +   +  P++YP  PPAI       P+     +T ++C
Sbjct: 32  DNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFNPPAIRM---LTPNGRFRENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVATILTGLLSFM 115

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 48.1 bits (113), Expect = 2e-06
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L+W  ++ GP ++PY +  +   +  PS+YP  PPAI       P+   + +T ++CL
Sbjct: 33  NILEWHYIINGPPDSPYFEGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLCL 88

Query: 280 NILEH--EHWSPVWNLMYVMVALYQLL 354
           ++ ++  + W+P W++  ++  L   +
Sbjct: 89  SMSDYHPDTWNPGWSVATILNGLLSFM 115

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 47.8 bits (112), Expect = 2e-06
 Identities = 23/88 (26%), Positives = 48/88 (54%), Gaps = 2/88 (2%)
 Frame = +1

Query: 97  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 276
           +N L+W  ++ GP +TPY    +   +  P++YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 277 LNILEH--EHWSPVWNLMYVMVALYQLL 354
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 47.8 bits (112), Expect = 2e-06
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query: 148 YHKHS-FKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLM 324
           ++KH  F   +     YP+ PP +     ++ H N++++ G ICLN+L  E W+PV +L 
Sbjct: 154 FYKHGHFGFSVSFKDSYPIDPPIVKCLT-TIYHPNIDYN-GNICLNVLR-EDWTPVLDLQ 210

Query: 325 YVMVALYQLLQEPVVDSPLNIDLANIL 405
            +++ L  L  EP    PLN   A+ +
Sbjct: 211 TIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 47.4 bits (111), Expect = 3e-06
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++CL
Sbjct: 33  NILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIRM---ITPNGRFKENT-RLCL 88

Query: 280 NILEH--EHWSPVWNLMYVMVALYQLL 354
           ++ ++  + W+P W++  ++  L   +
Sbjct: 89  SMSDYHPDLWNPGWSVATILNGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 47.4 bits (111), Expect = 3e-06
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L W  ++ GP  TPY    +   +  PS+YP  PPAI       P    + +T ++CL
Sbjct: 33  NILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM---VTPSGRFQENT-RLCL 88

Query: 280 NILEHE--HWSPVWNLMYVMVALYQLL 354
           ++ ++    W+P W++  ++  L   +
Sbjct: 89  SMSDYHPTTWNPGWSVSTILNGLLSFM 115

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 47.4 bits (111), Expect = 3e-06
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +1

Query: 100 NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 279
           N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++CL
Sbjct: 33  NILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLCL 88

Query: 280 NILEH--EHWSPVWNLMYVMVALYQLL 354
           ++ ++  + W+P W++  ++  L   +
Sbjct: 89  SMSDYHPDTWNPGWSVATILNGLLSFM 115

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 46.6 bits (109), Expect = 3e-06
 Identities = 29/79 (36%), Positives = 41/79 (51%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y    F+  +     YP+ PPA+      + H N++ + G +CLNIL  E WSPV +L  
Sbjct: 73  YKPGYFRFSLFFKDTYPIEPPAVKCVN-KIYHPNID-TQGNVCLNILR-EDWSPVLDLQS 129

Query: 328 VMVALYQLLQEPVVDSPLN 384
           V++ L  L  EP    PLN
Sbjct: 130 VVIGLLFLFLEPNDKDPLN 148

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 46.2 bits (108), Expect = 5e-06
 Identities = 30/86 (34%), Positives = 42/86 (48%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y K  F   +    +YP+ PP +        H N++   GKICLNIL  E WSP  +L  
Sbjct: 75  YRKGHFTFEMTFTEKYPIEPPQVRCMNQIF-HPNIDLQ-GKICLNILR-EDWSPALDLQS 131

Query: 328 VMVALYQLLQEPVVDSPLNIDLANIL 405
           V++ +  L  E     PLN   A++L
Sbjct: 132 VIIGILFLFLEVSGRDPLNKQAASLL 157

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 46.2 bits (108), Expect = 5e-06
 Identities = 28/85 (32%), Positives = 42/85 (49%)
 Frame = +1

Query: 148 YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 327
           Y+  S    ++    YP+ PP +      + H N++   G +CLNIL  E WSP  +L  
Sbjct: 74  YNHGSINFGLDFNEVYPIEPPKVACLK-KIFHPNIDLK-GNVCLNILR-EDWSPALDLQS 130

Query: 328 VMVALYQLLQEPVVDSPLNIDLANI 402
           ++  L  L  EP  + PLN D A +
Sbjct: 131 IITGLLFLFLEPNPNDPLNKDAAKL 155

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.3 bits (103), Expect = 2e-05
 Identities = 34/137 (24%), Positives = 64/137 (46%), Gaps = 6/137 (4%)
 Frame = +1

Query: 64  ESIELLEPVAF------ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFE 225
           E+I+L E +        EN ++    +K  +   Y   ++   + +   YP+ PP +   
Sbjct: 39  ENIDLSEQICEYTTYLDENPMRVNLAIKPDIGY-YAGGTYYFNVFIKDTYPMEPPVVKCM 97

Query: 226 PYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANIL 405
            + + H N++   G +CLN+L  E W+P  ++  +++ +  L  EP    PLN D A  L
Sbjct: 98  -HRIYHPNIDID-GNVCLNLLR-EDWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAKTL 154

Query: 406 RAGDTSAYHGLINYYLQ 456
              D   +   +N+ L+
Sbjct: 155 -IEDPLRFENKVNHSLR 170

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 37.7 bits (86), Expect = 0.005
 Identities = 27/93 (29%), Positives = 45/93 (48%)
 Frame = +1

Query: 160 SFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVA 339
           +F+LL     +YP+ PP +      + H N++ + G++CLNIL  + W+P  +L  V++ 
Sbjct: 72  TFELLFN--EQYPMEPPKVKCLN-RIYHPNID-TDGRVCLNILRQD-WTPALDLQSVIIG 126

Query: 340 LYQLLQEPVVDSPLNIDLANILRAGDTSAYHGL 438
           L  L  E     PLN   A        +  H +
Sbjct: 127 LLFLFLEISGVDPLNKQAAETFNRNRQNFAHAV 159

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 36.2 bits (82), Expect = 0.007
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW   + GP ++ +    + L IE    YP  PP +TF       C V  +TG++  N  
Sbjct: 3   KWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTNFH 61

Query: 289 EHEHWSPVWNLMYVMVALYQLLQEP 363
               W   + +  +++ L + +  P
Sbjct: 62  TLRDWKRAYTMETLLLDLRKEMATP 86

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 35.8 bits (81), Expect = 0.016
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 1/90 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW   + GP ++ +    + +LIE    YP  PP + F       C V  +TG++   + 
Sbjct: 40  KWNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTGEV---VK 95

Query: 289 EHEHWSPVWNLMYVM-VALYQLLQEPVVDS 375
           E  H    W   Y M   L +L +E    S
Sbjct: 96  EKFHTLKEWKRSYTMETVLLELRKEMATPS 125

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 35.4 bits (80), Expect = 0.021
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKI---CL 279
           +W   + GP ++ +    + + IE   +YP  PP ITF       C V+ STG++     
Sbjct: 40  RWNGTILGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPC-VDQSTGEVNKEKF 98

Query: 280 NILEHEHWSPVWNLMYVMVALYQLLQEP 363
           N L  + W  ++N+  +++ L + +  P
Sbjct: 99  NTL--KDWKRLYNMETILLDLRKEMASP 124

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 35.0 bits (79), Expect = 0.029
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL 288
           KW   + GP ++ +    + L IE    YP  PP +TF       C V  +TG+I  +  
Sbjct: 40  KWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEIQTDFH 98

Query: 289 EHEHWSPVWNLMYVMVALYQLLQEP 363
               W   + +  +++ L + +  P
Sbjct: 99  TLRDWKRAYTMETLLLDLRKEMATP 123

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 34.3 bits (77), Expect = 0.033
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITF-EPYSMPHCNVEFSTGKICLNI 285
           KW   + GP ++ +    + L IE    YP  PP +TF    ++P  N   +TG++  + 
Sbjct: 3   KWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPCVNP--TTGEVQTDF 60

Query: 286 LEHEHWSPVWNLMYVMVALYQLLQEP 363
                W   + +  +++ L + +  P
Sbjct: 61  HTLRGWKRAYTMETLLLDLRKEMATP 86

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 34.3 bits (77), Expect = 0.054
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +1

Query: 112 WRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE 291
           W   + GP ++ +    + ++I+   EYP  PP + F       C V+ +TG++  N+  
Sbjct: 41  WNGTILGPPHSNHENRIYSVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEVETNMF- 98

Query: 292 HEHWSPVWNLMYVMVALYQLLQEPVVDS 375
             H    W   Y M  L   L++ +  S
Sbjct: 99  --HTLRDWKRSYTMETLLLDLRKEMASS 124

>Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON}
           YCL008C (REAL)
          Length = 379

 Score = 34.7 bits (78), Expect = 0.076
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 10/81 (12%)
 Frame = +1

Query: 160 SFKLLIELPSEYPLVPPAITFE---------PYSMPHCNVEFSTGKICLNILEHEHWSP- 309
           S  L++ +P+ YP+ PP I+ +           S+P      S G+I L IL  +HW+P 
Sbjct: 72  SLPLIMWIPNLYPVKPPFISIDLETFDVSTISSSLPVQAYIDSDGRIALPIL--DHWNPA 129

Query: 310 VWNLMYVMVALYQLLQEPVVD 372
             +L+ V+  L  LL EP  D
Sbjct: 130 TMSLIAVVQELMGLLNEPSQD 150

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 33.5 bits (75), Expect = 0.100
 Identities = 19/86 (22%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +1

Query: 109 KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITF-EPYSMPHCNVEFSTGKICLNI 285
           KW   + GP ++ +    + L I+    YP  PP +TF    ++P  N   +TG++  + 
Sbjct: 40  KWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNP--TTGEVQTDF 97

Query: 286 LEHEHWSPVWNLMYVMVALYQLLQEP 363
                W   + +  +++ L + +  P
Sbjct: 98  HTLRDWKRAYTMETLLLDLRKEMATP 123

>YCL008C Chr3 complement(105696..106853) [1158 bp, 385 aa] {ON}
           STP22Component of the ESCRT-I complex, which is involved
           in ubiquitin-dependent sorting of proteins into the
           endosome; homologous to the mouse and human Tsg101 tumor
           susceptibility gene; mutants exhibit a Class E Vps
           phenotype
          Length = 385

 Score = 33.9 bits (76), Expect = 0.14
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 10/82 (12%)
 Frame = +1

Query: 157 HSFKLLIELPSEYPLVPPAITFE---------PYSMPHCNVEFSTGKICLNILEHEHWSP 309
           HS  +++ +PS YP+ PP I+             S+P      S G I L IL    W P
Sbjct: 79  HSIPVIMWVPSMYPVKPPFISINLENFDMNTISSSLPIQEYIDSNGWIALPIL--HCWDP 136

Query: 310 -VWNLMYVMVALYQLLQEPVVD 372
              NL+ V+  L  LL EP  D
Sbjct: 137 AAMNLIMVVQELMSLLHEPPQD 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,273,765
Number of extensions: 923590
Number of successful extensions: 2774
Number of sequences better than 10.0: 271
Number of HSP's gapped: 2609
Number of HSP's successfully gapped: 271
Length of query: 159
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 58
Effective length of database: 41,900,133
Effective search space: 2430207714
Effective search space used: 2430207714
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)