Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042603.495ON1581588301e-115
Kpol_480.133.495ON1571555032e-65
NCAS0E007803.495ON1711614391e-55
NDAI0G009103.495ON1631594285e-54
TDEL0D056303.495ON1501504137e-52
ZYRO0D09878g3.495ON1531544102e-51
YGR133W (PEX4)3.495ON1831584123e-51
Suva_7.4213.495ON1651584009e-50
Skud_7.4443.495ON1621583921e-48
CAGL0I10450g3.495ON1621583886e-48
KLTH0F14894g3.495ON1661573852e-47
Kwal_55.212463.495ON1601523843e-47
Smik_6.2293.495ON1651583834e-47
SAKL0F02706g3.495ON1611573765e-46
KAFR0C019903.495ON1511483581e-43
TBLA0C045003.495ON1651523592e-43
AFR314W3.495ON1551523218e-38
Ecym_12343.495ON1611523113e-36
KNAG0B007803.495ON1531483062e-35
KLLA0E04027g3.495ON1581542252e-23
Kpol_461.86.109ON1671361975e-19
ZYRO0C04950g6.109ON1681361965e-19
Smik_7.2226.109ON1711361966e-19
Suva_7.2136.109ON1731361966e-19
TDEL0G036106.109ON1691361966e-19
AAR156C6.109ON1701361966e-19
YGL058W (RAD6)6.109ON1721361966e-19
SAKL0A07260g6.109ON1691341967e-19
Ecym_30776.109ON1701341967e-19
KLLA0C05632g6.109ON1641341958e-19
ABR059W2.569ON1651461941e-18
CAGL0I00352g6.109ON1671341941e-18
TPHA0J017506.109ON1691341932e-18
NCAS0D032206.109ON1711341932e-18
Ecym_45782.569ON1651451923e-18
Suva_13.1892.569ON1651461905e-18
Kpol_1065.127.54ON1591111895e-18
SAKL0D13552g2.569ON1651451895e-18
Smik_13.1862.569ON1651461896e-18
KLLA0E07745g2.569ON1651451896e-18
YMR022W (UBC7)2.569ON1651461896e-18
Skud_13.1762.569ON1651461897e-18
CAGL0M07568g2.569ON1651461888e-18
Skud_7.2226.109ON1701341888e-18
NDAI0I016506.109ON1761341881e-17
ZYRO0E06358g2.569ON1651451862e-17
KAFR0A021602.569ON1651461862e-17
TDEL0H039707.54ON1561001843e-17
TBLA0F024406.109ON1741341853e-17
KNAG0F025706.109ON1511041833e-17
KLTH0H06732g6.109ON1601041834e-17
TDEL0B065702.569ON1651461834e-17
TPHA0I024602.569ON1671461844e-17
KAFR0A047006.109ON1531041825e-17
KLTH0D07986g2.569ON1651451819e-17
Kwal_26.82242.569ON1651451819e-17
TBLA0H026102.569ON1651461801e-16
YOR339C (UBC11)7.54ON1561211801e-16
Kwal_14.18286.109ON1521041782e-16
NDAI0E038707.54ON164961792e-16
KNAG0A048108.375ON2141291812e-16
KAFR0C002703.308ON1471441773e-16
Kpol_1056.52.569ON1651461765e-16
Smik_15.5177.54ON1561121756e-16
NDAI0B015202.569ON1651451756e-16
ZYRO0D04466g7.54ON159961748e-16
YDR177W (UBC1)8.375ON2151291771e-15
Skud_4.4418.375ON2151301761e-15
Suva_2.3438.375ON2151291761e-15
Smik_4.4258.375ON2151291761e-15
Skud_15.5047.54ON1561121731e-15
NCAS0A127402.569ON1651451732e-15
ZYRO0C03784g8.375ON2181301752e-15
Suva_4.3263.308ON1481521712e-15
KLTH0E14300g3.308ON1471531703e-15
SAKL0B06512g3.308ON1471531703e-15
AER173C3.308ON1471531703e-15
ADR169C8.375ON2111291733e-15
Ecym_74313.308ON1471531693e-15
KAFR0B060608.375ON2131301733e-15
Ecym_60388.375ON2111291734e-15
Suva_8.3897.54ON1561121704e-15
CAGL0E00671g8.375ON2131301725e-15
KNAG0M021502.569ON1701461705e-15
TDEL0F021003.308ON1471531685e-15
NCAS0B031508.375ON2141301716e-15
TDEL0F049908.375ON2171381716e-15
Skud_2.2073.308ON1481351677e-15
Smik_2.2193.308ON1481351677e-15
YBR082C (UBC4)3.308ON1481351677e-15
Kpol_1030.108.375ON2151291717e-15
ZYRO0G12870g3.308ON1471361678e-15
Suva_2.2183.308ON1481491678e-15
Skud_4.3143.308ON1481491678e-15
YDR059C (UBC5)3.308ON1481491678e-15
Smik_4.2973.308ON1481491661e-14
KLTH0A07546g8.375ON215901691e-14
TPHA0L008508.375ON2161291691e-14
CAGL0E04752g3.308ON1471531651e-14
NDAI0A054903.308ON1471371652e-14
NDAI0A011608.375ON2161301682e-14
TBLA0H031308.375ON214891682e-14
NCAS0A108003.308ON1481331642e-14
TBLA0I021303.308ON1481361633e-14
KLLA0C18656g8.375ON2281301665e-14
Kwal_23.64858.375ON2151291655e-14
KNAG0J023403.308ON1611131625e-14
TPHA0A038503.308ON1481361608e-14
Kpol_1052.23.308ON1481521609e-14
KLLA0E12563g3.308ON1481521609e-14
SAKL0A00396g8.375ON2151301631e-13
SAKL0B10582g7.54ON161961582e-13
TDEL0B056701.436ON2031221593e-13
KLLA0A11198g1.436ON2021481584e-13
CAGL0M03399g1.436ON2141111577e-13
Kwal_27.124013.308ON2361041571e-12
KNAG0H018701.436ON2101111542e-12
KLTH0D01760g7.54ON1611001512e-12
TBLA0A012901.436ON2191321542e-12
Kpol_1030.181.436ON2231221533e-12
AGR121C8.230ON1541321503e-12
NCAS0G031301.436ON2311111524e-12
CAGL0G08063g8.230ON1491301484e-12
TPHA0O009201.436ON2261221525e-12
Kwal_26.70097.54ON1611001495e-12
NDAI0J015408.230ON1541301485e-12
Skud_5.871.436ON2101111515e-12
ZYRO0E03806g1.436ON2091221515e-12
KNAG0H029808.230ON1521301486e-12
SAKL0H17930g8.230ON1531301478e-12
Ecym_55638.230ON1641411479e-12
Suva_5.531.436ON2151111499e-12
Smik_5.981.436ON2151111499e-12
NDAI0D011401.436ON2451091501e-11
CAGL0D00814g4.249ON1571271461e-11
KLLA0D09196g3.301ON292941511e-11
KAFR0H029601.436ON1871221471e-11
YEL012W (UBC8)1.436ON2181111491e-11
SAKL0D10560g1.436ON207921481e-11
AEL045W1.436ON2111291481e-11
AGL203C3.301ON270941492e-11
KLTH0D14344g4.249ON1571271442e-11
KAFR0H012303.308ON110941412e-11
Ecym_26693.301ON268941482e-11
KLTH0C04818g3.301ON275941492e-11
ZYRO0B11682g8.230ON1511311442e-11
KLLA0C17622g8.230ON1591301442e-11
NCAS0B040108.230ON1531301442e-11
Kwal_34.161741.436ON2131031462e-11
Kwal_27.104443.301ON278941482e-11
KAFR0H012703.301ON287941483e-11
NDAI0A055303.301ON273941483e-11
Skud_4.3063.301ON297941483e-11
Ecym_13481.436ON2111031463e-11
NCAS0A107703.301ON273941473e-11
CAGL0E04598g3.301ON295981483e-11
YDR054C (CDC34)3.301ON295941473e-11
ZYRO0G12650g3.301ON285941473e-11
Smik_4.2903.301ON297941474e-11
Suva_2.2113.301ON297941474e-11
KNAG0H010403.301ON296941474e-11
TDEL0D032603.301ON289941474e-11
TPHA0M012803.301ON435941484e-11
Kpol_1075.1b8.230ON1521401424e-11
ZYRO0B12386g4.249ON1571291424e-11
YDL064W (UBC9)4.249ON1571291425e-11
TDEL0A013408.230ON1571301425e-11
TBLA0G032703.301ON330941475e-11
Kpol_1065.453.301ON323941475e-11
SAKL0D02530g3.301ON272941465e-11
Kwal_56.234828.230ON1491001416e-11
KLTH0H13816g1.436ON2331261446e-11
KLTH0G14366g8.230ON1491301406e-11
Suva_4.1864.249ON1571291416e-11
KAFR0G032404.249ON157941416e-11
SAKL0H03058g4.249ON1571271416e-11
NCAS0I014303.301ON2581111457e-11
KAFR0A024208.230ON1471001407e-11
Suva_2.2538.230ON1431001391e-10
Kwal_23.42274.249ON122941371e-10
Skud_4.1914.249ON1571291391e-10
TPHA0B034108.230ON1521401391e-10
Smik_4.1714.249ON1571291391e-10
NCAS0A059404.49ON1931121411e-10
NCAS0A024904.249ON1571271391e-10
Ecym_32704.249ON1571281382e-10
TBLA0F037908.230ON1511311372e-10
YDR092W (UBC13)8.230ON1531301372e-10
KLLA0E05039g4.249ON157941363e-10
Kpol_483.164.249ON122941343e-10
Skud_4.3528.230ON1431001353e-10
KNAG0D043904.249ON1571271354e-10
Smik_4.3358.230ON1431001345e-10
TBLA0I029604.249ON1571291355e-10
TDEL0E012204.249ON157941346e-10
NDAI0D043804.249ON157941321e-09
AER056C4.249ON1571281321e-09
TPHA0B007704.249ON1571291312e-09
NDAI0A075703.301ON239941323e-09
CAGL0D06468g4.49ON187921313e-09
KNAG0J022803.301ON2171421323e-09
KAFR0L017507.392ON2511521315e-09
Ecym_46837.392ON2431201305e-09
KAFR0F030404.49ON169861269e-09
Kpol_414.2singletonOFF1921001261e-08
Kpol_YGOB_414.24.49ON1931001261e-08
KLLA0E20395g7.392ON251881271e-08
KLTH0H09504g4.49ON184881252e-08
Smik_5.2467.392ON2501491272e-08
Kpol_1045.397.392ON2531171262e-08
Suva_5.2197.392ON2491501253e-08
KNAG0B023607.392ON2511201253e-08
YER100W (UBC6)7.392ON2501181253e-08
Skud_5.2257.392ON2501491244e-08
TPHA0F003904.49ON1931041225e-08
NCAS0E026007.392ON2551191236e-08
TBLA0E015704.49ON194871216e-08
CAGL0I05478g7.392ON246881227e-08
NDAI0D029104.49ON189991217e-08
KLTH0C06688g7.392ON246881228e-08
NCAS0A143907.392ON2401171201e-07
Kwal_27.108377.392ON246881202e-07
TDEL0C015507.392ON2481171192e-07
Suva_10.4014.49ON1871451172e-07
SAKL0F12474g7.392ON251891183e-07
NDAI0A016507.392ON2511171173e-07
Smik_12.3894.49ON187871164e-07
NDAI0E041707.392ON2571531174e-07
TBLA0D006007.392ON256871174e-07
TPHA0K008207.392ON2571171175e-07
ZYRO0B03344g7.392ON250871166e-07
AGR372W7.392ON2421181157e-07
YLR306W (UBC12)4.49ON188901147e-07
SAKL0H24112g4.49ON185791112e-06
TDEL0E055604.49ON187861112e-06
Skud_12.3894.49ON1871171093e-06
KNAG0I029404.49ON197861084e-06
ADL035C4.49ON200861076e-06
Ecym_83714.49ON267871087e-06
KLLA0C17248g4.49ON1841251032e-05
ZYRO0G19910g4.49ON17997935e-04
CAGL0H03157g6.187ON139122860.003
Suva_7.1826.187ON137119840.005
Skud_7.1956.187ON10087790.014
YGL087C (MMS2)6.187ON137119790.028
ZYRO0G08228g6.187ON138120760.059
Ecym_22306.187ON138122760.065
Smik_7.1966.187ON10087740.077
KLLA0E19119g6.187ON139118750.084
Suva_3.111.412ON37981760.13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04260
         (158 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   324   e-115
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   198   2e-65
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   173   1e-55
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   169   5e-54
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   163   7e-52
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   162   2e-51
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   163   3e-51
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   158   9e-50
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   155   1e-48
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   154   6e-48
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   152   2e-47
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   152   3e-47
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   152   4e-47
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   149   5e-46
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   142   1e-43
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   142   2e-43
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   128   8e-38
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   124   3e-36
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   122   2e-35
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    91   2e-23
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    80   5e-19
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    80   5e-19
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    80   6e-19
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    80   6e-19
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    80   6e-19
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    80   6e-19
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    80   6e-19
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    80   7e-19
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    80   7e-19
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    80   8e-19
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    79   1e-18
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    79   1e-18
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    79   2e-18
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      79   2e-18
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    79   3e-18
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    78   5e-18
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    77   5e-18
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    77   5e-18
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    77   6e-18
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    77   6e-18
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    77   6e-18
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    77   7e-18
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    77   8e-18
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    77   8e-18
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      77   1e-17
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    76   2e-17
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    76   2e-17
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    75   3e-17
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    76   3e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    75   3e-17
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    75   4e-17
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    75   4e-17
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    75   4e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   5e-17
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    74   9e-17
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    74   9e-17
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    74   1e-16
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    74   1e-16
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    73   2e-16
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    74   2e-16
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    74   2e-16
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    73   3e-16
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    72   5e-16
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    72   6e-16
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    72   6e-16
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    72   8e-16
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    73   1e-15
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    72   1e-15
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    72   1e-15
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    72   1e-15
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    71   1e-15
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    71   2e-15
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    72   2e-15
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    70   2e-15
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    70   3e-15
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    70   3e-15
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    70   3e-15
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    71   3e-15
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    70   3e-15
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    71   3e-15
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    71   4e-15
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    70   4e-15
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    71   5e-15
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    70   5e-15
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    69   5e-15
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      70   6e-15
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    70   6e-15
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    69   7e-15
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    69   7e-15
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    69   7e-15
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    70   7e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    69   8e-15
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    69   8e-15
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    69   8e-15
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    69   8e-15
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    69   1e-14
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    70   1e-14
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    70   1e-14
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    68   1e-14
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    68   2e-14
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      69   2e-14
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    69   2e-14
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    68   2e-14
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    67   3e-14
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    69   5e-14
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    68   5e-14
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    67   5e-14
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    66   8e-14
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    66   9e-14
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    66   9e-14
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    67   1e-13
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    65   2e-13
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    66   3e-13
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    65   4e-13
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    65   7e-13
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    65   1e-12
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    64   2e-12
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    63   2e-12
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    64   2e-12
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    64   3e-12
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    62   3e-12
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                63   4e-12
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    62   4e-12
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    63   5e-12
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    62   5e-12
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    62   5e-12
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    63   5e-12
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    63   5e-12
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    62   6e-12
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    61   8e-12
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    61   9e-12
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    62   9e-12
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    62   9e-12
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    62   1e-11
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    61   1e-11
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    63   1e-11
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    61   1e-11
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    62   1e-11
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    62   1e-11
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    62   1e-11
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    62   2e-11
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    60   2e-11
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    59   2e-11
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    62   2e-11
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    62   2e-11
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    60   2e-11
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    60   2e-11
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    60   2e-11
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    61   2e-11
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    62   2e-11
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                62   3e-11
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    62   3e-11
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    62   3e-11
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    61   3e-11
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    61   3e-11
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    62   3e-11
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    61   3e-11
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    61   3e-11
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    61   4e-11
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    61   4e-11
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                61   4e-11
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    61   4e-11
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    62   4e-11
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    59   4e-11
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    59   4e-11
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    59   5e-11
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    59   5e-11
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    61   5e-11
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    61   5e-11
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    61   5e-11
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    59   6e-11
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    60   6e-11
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    59   6e-11
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    59   6e-11
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    59   6e-11
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    59   6e-11
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                60   7e-11
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    59   7e-11
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    57   1e-10
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    58   1e-10
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    58   1e-10
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    58   1e-10
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     59   1e-10
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    58   1e-10
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    58   2e-10
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    57   2e-10
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    57   2e-10
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    57   3e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    56   3e-10
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    57   3e-10
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    57   4e-10
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    56   5e-10
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    57   5e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    56   6e-10
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    55   1e-09
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    55   1e-09
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    55   2e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    55   3e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    55   3e-09
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    55   3e-09
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    55   5e-09
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    55   5e-09
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    53   9e-09
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    53   1e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    53   1e-08
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    54   1e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    53   2e-08
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    54   2e-08
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    53   2e-08
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    53   3e-08
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    53   3e-08
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    53   3e-08
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    52   4e-08
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    52   5e-08
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    52   6e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    51   6e-08
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    52   7e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       51   7e-08
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    52   8e-08
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    51   1e-07
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    51   2e-07
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    50   2e-07
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    50   2e-07
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    50   3e-07
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    50   3e-07
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    49   4e-07
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    50   4e-07
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    50   4e-07
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    50   5e-07
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    49   6e-07
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    49   7e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    49   7e-07
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    47   2e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    47   2e-06
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    47   3e-06
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    46   4e-06
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    46   6e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    46   7e-06
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    44   2e-05
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    40   5e-04
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    38   0.003
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    37   0.005
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    35   0.014
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    35   0.028
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    34   0.059
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    34   0.065
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    33   0.077
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    33   0.084
Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON} Y...    34   0.13 
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    32   0.23 
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    32   0.23 
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    32   0.26 
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    31   0.55 
Skud_15.440 Chr15 complement(777845..779860) [2016 bp, 671 aa] {...    32   0.69 
YCL008C Chr3 complement(105696..106853) [1158 bp, 385 aa] {ON}  ...    31   0.91 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    30   1.0  
Smik_15.457 Chr15 complement(788706..790682) [1977 bp, 658 aa] {...    30   1.7  
YOR275C Chr15 complement(839084..841069) [1986 bp, 661 aa] {ON} ...    30   3.4  
KLLA0F11022g Chr6 complement(1016214..1018880) [2667 bp, 888 aa]...    30   3.5  
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    28   4.7  
Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}...    29   5.8  
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    28   6.0  
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    28   6.1  
Kwal_14.2476 s14 complement(772414..774783) [2370 bp, 789 aa] {O...    29   6.5  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    29   7.2  
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    28   9.2  

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  324 bits (830), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE
Sbjct: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
           LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE
Sbjct: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH 158
           PVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH
Sbjct: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH 158

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  198 bits (503), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 91/155 (58%), Positives = 115/155 (74%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MS +RLLKE ++++KEL  +   I  LEP+  ++   W A + GP NTPYH HSF L I 
Sbjct: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
           L  EYPL PP +TF  Y MPHCN+EF TGKICLNIL++ +WSPVWNL+ V++A+YQLL +
Sbjct: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDT 155
           PV DSPLNIDL+NIL+  DTSAY+GLI YYL   +
Sbjct: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  173 bits (439), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 82/161 (50%), Positives = 107/161 (66%), Gaps = 12/161 (7%)

Query: 3   LKRLLKEKRLIEKELSG------------YSESIELLEPVAFENFLKWRAVLKGPVNTPY 50
           + RLLKE + I+  LS             +++ I  L P++  +   W+A +KGP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 51  HKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYV 110
             H F+L IE P  YP+ PP I F+P SMPHCNV F TG ICL+ILE +HW+P WNLM  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 111 MVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           M A++ LL++PV DSPLN+D+ANILR  D SAY+GL+NYYL
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  169 bits (428), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 9/159 (5%)

Query: 3   LKRLLKEKRLIEKELSG--------YSESIELLEPVA-FENFLKWRAVLKGPVNTPYHKH 53
           + R++KE + I+K+L+         ++  I  L P+   ++  KW AV+KGP  TPY+  
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 54  SFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVA 113
           +F L I +P EYP VPP   F+P SMPHCNV ++TG+ICL+IL+ +HW+PVWNLM  + A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 114 LYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
           ++ LL++PV +SPLN+DLAN+LR GD SAY+GLINYYL 
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  163 bits (413), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 100/150 (66%), Gaps = 1/150 (0%)

Query: 3   LKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           + R+ +E + I+  L   S  +  LEP+   +  +W   ++GP  TPY  H+F L + L 
Sbjct: 1   MARIAREYKHIQATLGSESSLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
             YP  PP +TF   SMPHCNV + TG ICLNIL  EHWSP W+L++V+ A+ QLL +P 
Sbjct: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119

Query: 123 VDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
            DSPL+IDLANILRA D SAY+GL+NYYLQ
Sbjct: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  162 bits (410), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 109/154 (70%), Gaps = 6/154 (3%)

Query: 3   LKRLLKEKRLIEKELSG----YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + R  KE + I K L      YS+ I  +EP   E+  +W A+++GP  TPY   +F+L 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPK--EDLTRWEALIRGPSGTPYEGCNFRLH 58

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLL 118
           + LP EYP+ PP + FEPY+MPH NV+F TG+ICL+IL  +HWSP W+L++V+ A+ QLL
Sbjct: 59  LSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLL 118

Query: 119 QEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
            EPV  SPLN+D+ANIL+A D +AY+GL++YY++
Sbjct: 119 DEPVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  163 bits (412), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 111/158 (70%), Gaps = 7/158 (4%)

Query: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55
           + R++KE ++I K L+        Y   IE L P+   +  KW A++ GP +TPY  H F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115
           ++LIE+PS YP+ PP I+F   ++ HCNV+ +TG+ICLNIL+ E W+PVW+L++ + A++
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +LL+EPV DSPL++D+ NI+R GD SAY G++ Y+L E
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  158 bits (400), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 7/158 (4%)

Query: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55
           + R+ KE RLI K L+        Y   IE L P    +  KW A + GP +TPY ++ F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115
           ++LI++P  YP+ PP I FE  ++ HCN+  STG+ICL+IL+ + W+PVW+L++ + A++
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +LL+EPV DSPL++D+ NI+R GD  AY G++ Y+L E
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  155 bits (392), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 7/158 (4%)

Query: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55
           + R+ KE   I+K L+        Y   IE L P+   +  KW A++ GP +TPY  + F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115
           ++LI++PS YP+ PP I F+  ++ HCN++  TG+ICL+IL+ E W+PVW+L++ + A++
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +LL+EPV DSPL++D+ NI+R GDT AY G+I Y+L E
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  154 bits (388), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 77/158 (48%), Positives = 108/158 (68%), Gaps = 7/158 (4%)

Query: 3   LKRLLKEKRLIEKELS-GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           + R+ KE   I K L  G SE +  L PV   +  +W AV+KGP  TPY+ + FKL IE+
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60

Query: 62  PSEYPLVPPAITFEPYSM------PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115
           P+ YP+VPP I F   +       PHCNV+  TG+ICL+IL+ E WSP+W++++V+ A++
Sbjct: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120

Query: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
            LLQEPV DSPL++D+ANIL+  D SAY+G+I Y+L E
Sbjct: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  152 bits (385), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (64%), Gaps = 2/157 (1%)

Query: 4   KRLLKEKRLIEKELSGYSES--IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           +RL KE R + K L    E   I  L PV+ EN  KW +++ GP +TPY  H F L IE 
Sbjct: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
              YPL PP + F+   MPHCNV+F +G+ICL++L+  HW+P W+L++V+ A++ LL  P
Sbjct: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122

Query: 122 VVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH 158
             DSPL++DLA ++RAGD SA++ LI YYL   +  H
Sbjct: 123 EPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGH 159

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  152 bits (384), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 4/152 (2%)

Query: 4   KRLLKEKRLIEKELS---GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           +RL KE + + K L     YS  I  L PV+ +N   W A + GP +TPY  H F LLI 
Sbjct: 3   QRLAKEYKTLLKTLKEDPAYSH-IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
           +PS YPL PP + F    +PHCNV+F +G+IC+N+LE  HWSP W+L++++ A++ LL  
Sbjct: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLAN 121

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
           P  DSPL++DLA + RAGD SA++GL+ YYL 
Sbjct: 122 PEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  152 bits (383), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 105/158 (66%), Gaps = 7/158 (4%)

Query: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55
           + R+ KE R+I K L+        Y   I  L P+   +  +W A + GP +TPY  + F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115
            +LI++PS YP+ PP I FE   + HCNV+ +TG+ICL+IL+ E W+PVW+L++ + A++
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +LL+EPV DSPL++D+ NI+R  D SAY G++ Y+L E
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAE 158

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  149 bits (376), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/157 (49%), Positives = 106/157 (67%), Gaps = 7/157 (4%)

Query: 1   MSLKRLLKEKRLIEKELS---GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKL 57
           MSL+R+ KE + + K L+    Y+  ++L EP    N   W A + GP  TPY    F L
Sbjct: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKL-EPKDTGNMYHWIADISGPPETPYASAVFAL 59

Query: 58  LIELPSEYPLVPPAITFEPYS---MPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVAL 114
            +ELP +YPL PP + F P S   + HCNV+F TG+ICL+IL  EHWSPVW+L++V+ A+
Sbjct: 60  DVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAI 119

Query: 115 YQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           + LL EPV +SPLN+D+AN+L+AGD  AY GLI YY+
Sbjct: 120 WILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  142 bits (358), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 100/148 (67%), Gaps = 4/148 (2%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           R+LKE +      S  S+ I  L+P++ ++   W   +KGP+++P+  H+FKL I++P  
Sbjct: 4   RILKEYK---DSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIPQT 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YPL  P   FEP++MPH NV F TG+ICL+IL+  +WSPV+N+ Y++ A+  LL EP   
Sbjct: 61  YPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNFK 119

Query: 125 SPLNIDLANILRAGDTSAYHGLINYYLQ 152
           SPLN+DLAN+LR  D  AYH LI+Y+L 
Sbjct: 120 SPLNLDLANLLRFDDLKAYHDLISYHLN 147

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  142 bits (359), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 3   LKRLLKEKRLIEKELSGYSESIELLEPV--AFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + R++KE   I K L+   +++  L PV  A  +   W +++ GP ++PYH  SF L I 
Sbjct: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59

Query: 61  LPSEYPLVPPAITFEPYSMP-HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQ 119
           +P+EYP +PP I F   S+P HCNV F+TG+ICLNIL++E+WSPVWNL+Y + A+ QLL 
Sbjct: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119

Query: 120 EPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
            P   SPLNIDL+ +L   D+ AY+ LI YYL
Sbjct: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  128 bits (321), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 3   LKRLLKEKRLIEKELSGYSESIELLEPVAFEN--FLKWRAVLKGPVNTPYHKHSFKLLIE 60
           ++R+L+E + ++K+L+ +   + L  PV  EN    +W A  +GP NTPY   +F L I 
Sbjct: 1   MRRILREYKQLQKQLALHPAVLSL-APVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
           +P  YP  PP  +F P+ + H N+++STG++CL++L+HE WSPV+NL+ V+ A+  LL E
Sbjct: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
           P VDSPL++DL+  L   D +AY G++NY L+
Sbjct: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLR 150

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  124 bits (311), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (62%), Gaps = 3/152 (1%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFL-KWRAVLKGPVNTPYHKHSFKLLIELPS 63
           R+L E + I ++L  + ESI +L P      L KW A   GP NTPY   +F L IE+P 
Sbjct: 11  RMLAEYKQIREQLQSH-ESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
            YP  PP   F P  + H N+++STG++CL++L+HE WSP++NL+ V+ A+  LL EP V
Sbjct: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129

Query: 124 DSPLNIDLANILRAGDTSAYHGLINYYLQEDT 155
           DSPL++DLA  L + D  AY GL+ Y L   T
Sbjct: 130 DSPLDVDLAK-LYSVDKQAYQGLVTYRLCSRT 160

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  122 bits (306), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 3/148 (2%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           +R+L+E R +       +ES   L P    +   W A L+GP  TPY  HSF L + +P 
Sbjct: 3   QRVLREYRRLVAAGGAANESN--LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           +YP +PP++ F   +MPH NV++ TG++CL+ L    W+PV +L Y ++A+ +LL EP  
Sbjct: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNP 119

Query: 124 DSPLNIDLANILRAGDTSAYHGLINYYL 151
           +SPLN++LA + R GD  AY G+I Y L
Sbjct: 120 ESPLNLELAALSRLGDHKAYDGIIKYRL 147

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 91.3 bits (225), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 3   LKRLLKEKRLIEKELSGYSES-IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           + R++KE   ++K L     S I  L PV  ++  +W    +GP  +P+      L I +
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60

Query: 62  PSE-YPLVP-PAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQ 119
             E YP+   P + FEP ++ H NV++ TG+ICL++L+ + W+P++ L+ V+ A+  LL 
Sbjct: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119

Query: 120 EPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +P +DSPL++D+A I  A D  AY  ++ Y L+E
Sbjct: 120 DPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 80.5 bits (197), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFV-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 80/136 (58%), Gaps = 10/136 (7%)

Query: 2   SLKRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E
Sbjct: 5   ARRRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLE 58

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
              EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +
Sbjct: 59  FDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFND 115

Query: 121 PVVDSPLNIDLANILR 136
           P   SP N++ A + +
Sbjct: 116 PNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 80.1 bits (196), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 80.1 bits (196), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDSPPGVSAS-----PLP-DNVMIWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFQ 131

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 79/146 (54%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRL+KE ++L+     G      +  PV+ +N   W  +++GP ++PY    F   ++ P
Sbjct: 7   KRLMKELQQLLRDSPDGI-----VAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL------------EHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H NV +  G++C++IL              E WSPV ++  +
Sbjct: 62  RDYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP V+S  NID   + R
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWR 145

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDSPPGVSAS-----PLP-DNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EDYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSGS-----PLP-DNVMIWNAMIIGPSDTPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFI-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP  TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPAETPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 78.6 bits (192), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 79/145 (54%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL+KE   +++ L    E I +  PV  EN   W  ++ GP ++PY    F   ++ P+
Sbjct: 7   KRLMKE---MQQLLKDCPEGI-VAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPT 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL------------EHEHWSPVWNLMYVM 111
           +YPL PP +TF P S+ H NV +  G++C++IL              E WSPV ++  ++
Sbjct: 63  DYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP V+S  NID   + R
Sbjct: 121 LSVMSMLSEPNVESGANIDACILWR 145

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 77.8 bits (190), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++LI+    G      +  P +  N   W  +++GP +TPY    F   +E P
Sbjct: 7   KRLLKELQQLIKDSPPGI-----VAGPKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           EN  KW   + GP ++PY    FK+ +  P  YP  PP + F    M H NV+ S G IC
Sbjct: 40  ENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV-SPMWHPNVDLS-GNIC 97

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 143
           L++L+ E WS V+N+  ++++L  LL EP   SPLN  +A  L  GD   Y
Sbjct: 98  LDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 79/145 (54%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRLLKE + + ++     E I +  P + +N   W  ++ GP ++PY    F  ++E P 
Sbjct: 7   KRLLKELQQLARD---SPEGI-VAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPRLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP V+S  NID   + R
Sbjct: 121 LSVTSMLSEPNVESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++LI+    G      +  P +  N   W  +++GP +TPY    F   +E P
Sbjct: 7   KRLLKELQQLIKDSPPGI-----VAGPKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 78/145 (53%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRLLKE   +EK      E I L  P+   N  +W  ++ GP ++ Y    F   ++ P 
Sbjct: 7   KRLLKE---LEKLTKDSPEGI-LASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL------------EHEHWSPVWNLMYVM 111
           +YPL PP +TF+P S+ H N+ +  G++C++IL            E E WSPV ++  ++
Sbjct: 63  DYPLNPPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP ++S  NID   + R
Sbjct: 121 LSVMSILSEPNIESGANIDACILWR 145

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++LI+    G      +  P +  N   W  +++GP +TPY    F   +E P
Sbjct: 7   KRLLKELQQLIKDSPPGI-----VAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++LI+    G      +  P +  N   W  +++GP +TPY    F   +E P
Sbjct: 7   KRLLKELQQLIKDSPPGI-----VAGPKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRL KE ++LI+    G      +  P + +N   W  +++GP +TPY    F   +E P
Sbjct: 7   KRLYKELQQLIKDSPPGI-----VAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL------------EHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++IL              E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP +T Y   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPADTSYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+ E    G S S     P+  +N + W A++ GP  TPY   +F+LL+E  
Sbjct: 7   RRLMRDFKRMKEDAPPGVSAS-----PLP-DNVMVWNAMIIGPAETPYEDGTFRLLLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP+  P + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPINRPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 78/145 (53%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRLLKE + + K+    S +  +  P +  +   W  +++GP +TPY    F   +E P 
Sbjct: 7   KRLLKELQQLMKD----SSTGIVAGPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP V+S  N+D   + R
Sbjct: 121 LSVMSMLSEPNVESGANVDACILWR 145

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 79/146 (54%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++L++    G      +  P   +N  +W  +++GP ++PY    F   ++ P
Sbjct: 7   KRLLKELQQLMKDSPPGI-----VAGPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID   + R
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWR 145

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 29  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 88
           P + ++  +W  V+ GP  TPY    F+L ++   +YP  PP +TF    M H NV+ S 
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVS-PMWHPNVDMS- 90

Query: 89  GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           G ICL+IL+ + WS V+N+  ++++L  LL+EP   SPLN
Sbjct: 91  GNICLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLN 129

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RL+++ KR+      G S S     P+  +N + W A++ GP +TPY   +F+L++E  
Sbjct: 7   RRLMRDFKRIKSDSPPGISAS-----PLP-DNVMLWNAMIIGPSDTPYEDGTFRLVLEFD 60

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F    M H NV ++ G+ICL+IL++  W+P +++  ++ ++  L  +P 
Sbjct: 61  EEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQN-RWTPTYDVSSILTSIQSLFNDPN 117

Query: 123 VDSPLNIDLANILR 136
             SP N++ A + +
Sbjct: 118 PASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N + W A++ GP +TPY   +F+LL+E   +YP  PP + F    M H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 63/104 (60%), Gaps = 3/104 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N + W A++ GP  TPY   +F+LL+E   EYP  PP + F    M H NV ++ G+IC
Sbjct: 27  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEIC 84

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 85  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 77/146 (52%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RLLKE ++LI     G      L  P +  N   W  +++GP +TPY    F   ++ P
Sbjct: 7   RRLLKEYQQLIRDPPPGI-----LAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  N+D   + R
Sbjct: 120 LLSVMSMLSEPNIESGANVDACILWR 145

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 75.5 bits (184), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++LI +   G      +  P    N  +W  ++ GP  TPY    F   +  P
Sbjct: 9   KRLLKEYQQLIRESPPGI-----VAGPSDENNMFEWDCLISGPPETPYENGVFNATLLFP 63

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 64  KDYPLSPPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 121

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP ++S  NID + + R
Sbjct: 122 LLSVMSMLSEPNIESGANIDASILYR 147

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N + W A++ GP +TPY   +F+LL+E   +YP  PP + F    M H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEIC 73

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 74.3 bits (181), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 76/145 (52%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE   +++ L    E I +  P + +N   W  ++ GP ++PY    F   +E P 
Sbjct: 7   KRLFKE---LQQLLKDSPEGI-VAGPRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP + F P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP V+S  NID   + R
Sbjct: 121 LSVMSMLSEPNVESGANIDACILWR 145

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 74.3 bits (181), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 76/145 (52%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE   +++ L    E I +  P + +N   W  ++ GP ++PY    F   +E P 
Sbjct: 7   KRLFKE---LQQLLKDSPEGI-VAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP + F P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP V+S  NID   + R
Sbjct: 121 LSVMSMLSEPNVESGANIDACILWR 145

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRLLKE ++L      G      +  P    +   W  ++ GP +TPY    F   ++ P
Sbjct: 7   KRLLKELQQLTRDPPPGI-----IAAPKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILE------------HEHWSPVWNLMYV 110
           ++YPL PP +TF P S+ H NV +  G++C++IL              E WSPV ++  +
Sbjct: 62  TDYPLSPPTLTFTP-SILHPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP V+S  NID   + R
Sbjct: 120 LLSVVSMLSEPNVESGANIDACILWR 145

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 17  LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEP 76
           LS  +ESI    PV   +   W   + GP +TPY    FK+ ++ P  YP  PP I F  
Sbjct: 21  LSSTTESISAF-PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLS 79

Query: 77  YSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
             M H NV+  +G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN   A +  
Sbjct: 80  -PMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWD 136

Query: 137 A 137
           A
Sbjct: 137 A 137

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 63/104 (60%), Gaps = 3/104 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N + W A++ GP  TPY   +F+LL+E   EYP  PP + F    + H NV ++ G+IC
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEIFHPNV-YANGEIC 73

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           L+IL++  W+P +++  ++ ++  L  +P   SP N++ A + +
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           E+   W A++ GP +TPY    FKL  +    YP  PP + F    M H NV+ S G IC
Sbjct: 44  EDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI-SPMWHPNVDMS-GNIC 101

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           L+IL+ + WS V+N+  ++++L  LL+EP   SPLN
Sbjct: 102 LDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLN 136

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ +     E+   LE V   +    +   +GP  TPY +  F + IE+P 
Sbjct: 5   KRIMKEMQAVKDD----PEAHITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H NV   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 79/144 (54%), Gaps = 11/144 (7%)

Query: 1   MSLKRLLKEKRLIEKE-LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLI 59
           MS KR+ KE   + K+ ++ +S       PV  ++   W+A + GP ++PY    F L I
Sbjct: 1   MSSKRISKELNDLRKDPITSFSAG-----PVG-DDLFHWQASIMGPPDSPYAGGVFFLSI 54

Query: 60  ELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQ 119
             P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL 
Sbjct: 55  HFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLT 111

Query: 120 EPVVDSPLNIDLANILRAGDTSAY 143
           +   D PL  ++A+I +  D S Y
Sbjct: 112 DANPDDPLVPEIAHIYKT-DRSKY 134

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 73/146 (50%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KRL KE ++LI     G      +  P    +   W  +++GP +TPY    F   +  P
Sbjct: 7   KRLFKEYQQLIRDSPPGI-----VAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P  + H N+ +  G++C++I            L  E WSPV ++  +
Sbjct: 62  RDYPLSPPTLTFTPAIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP V+S  NID   + R
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWR 145

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 4/112 (3%)

Query: 17  LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEP 76
           LS  ++SI    PV   +   W   + GP  TPY    FK+ +  P  YP  PP I F  
Sbjct: 21  LSSATQSISAF-PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFVS 79

Query: 77  YSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
             M H NV+  +G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN
Sbjct: 80  -PMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLN 128

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 75/145 (51%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           +RLLKE + + K+    S    +  P    N   W  +++GP +T Y    F   ++ P 
Sbjct: 7   RRLLKELQQLNKD----SPPGIVAGPANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP ++S  NID   + R
Sbjct: 121 LSVMSMLSEPNIESGANIDACILWR 145

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 56/96 (58%), Gaps = 3/96 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           ++   W  ++ GP  TPY    FK+ +  P  YP VPP + F    M H NV+ S G IC
Sbjct: 40  DDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFI-SPMWHPNVDMS-GNIC 97

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           L+IL+ + WS V+N+  ++++L  L +EP   SPLN
Sbjct: 98  LDILK-DQWSAVYNVQTILLSLQSLFEEPNNSSPLN 132

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + + +      LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEIQAVKDDPAAHI----TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 70/130 (53%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + + +      LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEIQAVKDDPAAHI----TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + + +      LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEIQAVKDDPAAHI----TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + + +      LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEIQAVKDDPAAHI----TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 4/112 (3%)

Query: 17  LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEP 76
           LS  ++SI    PV   +   W   + GP  TPY    FK+ +  P  YP  PP + F  
Sbjct: 21  LSSTTQSIGAF-PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVS 79

Query: 77  YSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
             M H NV+  +G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN
Sbjct: 80  -PMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (51%), Gaps = 18/145 (12%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           +RLLKE + + K+    S    +  P    N   W  +++GP +T Y    F   +E P 
Sbjct: 7   RRLLKELQQLTKD----SPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPK 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYVM 111
           +YPL PP +TF P S+ H N+ +  G++C++I            L  E WSPV ++  ++
Sbjct: 63  DYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKIL 120

Query: 112 VALYQLLQEPVVDSPLNIDLANILR 136
           +++  +L EP ++S  NID   + R
Sbjct: 121 LSVMSMLSEPNIESGANIDACILWR 145

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL+KE + +  + +        LE ++  +  + +    GP  TPY    F + IE+P 
Sbjct: 5   KRLMKELQAVRDDPAANI----TLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           S KR+ KE   +E++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SSKRIAKELSDLERDPPTSCSA----GPVG-DDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
             D PL  ++A+I +  D S Y      + ++
Sbjct: 115 NPDDPLVPEIAHIYKT-DRSKYEATAREWTKK 145

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAKEWTKK 144

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAKEWTKK 144

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAKEWTKK 144

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL+KE + ++ +     ++   L  V+  +    +    GP  TPYH  +F + I++P 
Sbjct: 5   KRLMKEIQSVKDD----PDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPL 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 69.7 bits (169), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAKEWTKK 144

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ +     E+   LE V   +    +    GP  TPY   +F + IE+P 
Sbjct: 5   KRIMKELQAVKDD----PEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPQMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 71.2 bits (173), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL+KE + ++ +     ++   L  V+  +    +    GP  TPYH   F + I++P 
Sbjct: 5   KRLMKEIQSVKDD----PDANISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPL 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 17  LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEP 76
           LS  + SI    P    +   W   + GP  TPY    FK+ +  P  YP  PP + F  
Sbjct: 21  LSSTTRSISAF-PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS 79

Query: 77  YSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
             M H NV+ S G ICL+IL+ E WS V+N+  ++++L  LL EP   SPLN
Sbjct: 80  -PMWHPNVDMS-GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ +     E+   LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKELQAVKDD----PEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-SKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 70.1 bits (170), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 20/146 (13%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +RLLKE ++L+     G      +  P    +   W  +++GP ++PY    F+  +  P
Sbjct: 7   RRLLKELQQLMRDPPPGI-----VAGPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFP 61

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNI------------LEHEHWSPVWNLMYV 110
            +YPL PP +TF P S+ H NV +  G++C++I            L  E WSPV ++  +
Sbjct: 62  RDYPLSPPKLTFVP-SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEKI 119

Query: 111 MVALYQLLQEPVVDSPLNIDLANILR 136
           ++++  +L EP V+S  NID   + R
Sbjct: 120 LLSVVSMLSEPNVESGANIDACVLWR 145

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 69.3 bits (168), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 79/153 (51%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDIYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAREWTKK 144

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 68/130 (52%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ +     E    LE V   +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKELQAVKDDPEARIE----LEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPMMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + +        LE V   +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEMQAVKDDPAAKIN----LEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H NV   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN-ILRAGDT 140
           + P + ++A   LR  D+
Sbjct: 119 NDPQDAEVAQHYLRDKDS 136

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 8/135 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           S KR+ KE   +E++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SSKRIAKELSDLERDPPTSCSA----GPVG-DDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILR 136
             D PL  ++A+I +
Sbjct: 115 NPDDPLVPEIAHIYK 129

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 8/135 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           S KR+ KE   +E++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SSKRIAKELSDLERDPPTSCSA----GPVG-DDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILR 136
             D PL  ++A+I +
Sbjct: 115 NPDDPLVPEIAHIYK 129

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 8/135 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           S KR+ KE   +E++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SSKRIAKELSDLERDPPTSCSA----GPVG-DDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILR 136
             D PL  ++A+I +
Sbjct: 115 NPDDPLVPEIAHIYK 129

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 70.5 bits (171), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + +        LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEMQAVKDDPAANIN----LEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 73/136 (53%), Gaps = 8/136 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MSLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSA----GPVG-DDVYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL +
Sbjct: 56  FPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILR 136
              D PL  ++A+I +
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 7   LKEKRLIEKELS--GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           +   + I KELS  G             ++   W+A + GP ++PY    F L I  P++
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YP  PP + F    + H N+  S+G ICL+IL+ + WSP   L  V++++  LL +   D
Sbjct: 61  YPFKPPKVNFT-TKIYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPD 117

Query: 125 SPLNIDLANILRAGDTSAYHGLINYYLQE 153
            PL  ++A I +  D + Y      + ++
Sbjct: 118 DPLVPEIAQIYKT-DKAKYEATAKEWTKK 145

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 7   LKEKRLIEKELS--GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           +   + I KELS  G             ++   W+A + GP ++PY    F L I  P++
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YP  PP + F    + H N+  S+G ICL+IL+ + WSP   L  V++++  LL +   D
Sbjct: 61  YPFKPPKVNFT-TKIYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPD 117

Query: 125 SPLNIDLANILRAGDTSAYHGLINYYLQE 153
            PL  ++A I +  D + Y      + ++
Sbjct: 118 DPLVPEIAQIYKT-DKAKYEATAKEWTKK 145

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 7   LKEKRLIEKELS--GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           +   + I KELS  G             ++   W+A + GP ++PY    F L I  P++
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YP  PP + F    + H N+  S+G ICL+IL+ + WSP   L  V++++  LL +   D
Sbjct: 61  YPFKPPKVNFT-TKIYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPD 117

Query: 125 SPLNIDLANILRAGDTSAYHGLINYYLQE 153
            PL  ++A I +  D + Y      + ++
Sbjct: 118 DPLVPEIAQIYKT-DKAKYEATAKEWTKK 145

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 7   LKEKRLIEKELS--GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           +   + I KELS  G             ++   W+A + GP ++PY    F L I  P++
Sbjct: 1   MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YP  PP + F    + H N+  S+G ICL+IL+ + WSP   L  V++++  LL +   D
Sbjct: 61  YPFKPPKVNFT-TKIYHPNIN-SSGNICLDILK-DQWSPALTLSKVLLSVCSLLTDANPD 117

Query: 125 SPLNIDLANILRAGDTSAYHGLINYYLQE 153
            PL  ++A I +  D + Y      + ++
Sbjct: 118 DPLVPEIAQIYKT-DKAKYEATAKEWTKK 145

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP  TPY    F + IE+P EYP  PP + F+   + H NV   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYENGKFIVDIEVPMEYPFKPPKMKFD-TKVYHPNVSSVTGAICLDILKN-AWSP 98

Query: 104 VWNLMYVMVALYQLLQEPVVDSPLNIDLAN 133
           V  L   +++L  LLQ P  + P + ++A 
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (52%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE   +  +     E+   LE V+  +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKEMEAVRDD----PEANIDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 79/153 (51%), Gaps = 9/153 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MS KR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSSKRIAKELSDLGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
              D PL  ++A+I +  D + Y      + ++
Sbjct: 113 ANPDDPLVPEIAHIYKT-DRAKYEATAREWTKK 144

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 8/137 (5%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           MS KR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I 
Sbjct: 1   MSSKRITKELSDMGRDPPTSCSA----GPVG-DDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120
            P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL +
Sbjct: 56  FPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTD 112

Query: 121 PVVDSPLNIDLANILRA 137
              D PL  ++A+I + 
Sbjct: 113 ANPDDPLVPEIAHIYKT 129

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 6/130 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + ++ + +        LE V   +    +    GP  TPY    F + IE+P 
Sbjct: 5   KRIMKELQAVKDDPTAKIG----LEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLAN 133
           + P + ++A 
Sbjct: 119 NDPQDAEVAQ 128

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP  TPY    F + IE+P EYP  PP + F+   + H N+   TG ICL+IL++  WSP
Sbjct: 41  GPPGTPYEGGRFMIDIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILKN-AWSP 98

Query: 104 VWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           V  L   +++L  LLQ P  + P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 7   LKEKRLIEKELS--GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           +   + I KELS  G             ++   W+A + GP ++PY    F L I  P++
Sbjct: 1   MSSSKRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD 60

Query: 65  YPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVD 124
           YP  PP I+F    + H N+  + G ICL+IL+ + WSP   L  V++++  LL +   D
Sbjct: 61  YPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPD 117

Query: 125 SPLNIDLANILRA 137
            PL  ++A+I + 
Sbjct: 118 DPLVPEIAHIYKT 130

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 73/136 (53%), Gaps = 8/136 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           SLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SLKRITKELNDLGRDPPTSCSA----GPVG-DDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILRA 137
             D PL  ++A+I + 
Sbjct: 115 NPDDPLVPEIAHIYKT 130

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 68.6 bits (166), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 6/130 (4%)

Query: 6   LLKEKRLIEKELSGYSESIELLEPVAFEN---FLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           +L+ KR++ KE+    E  E    + F N       +    GP  TPY    F + I +P
Sbjct: 1   MLRSKRIL-KEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F+   + H NV   TG ICL+IL++  W+PV  L   +++L  LLQ P 
Sbjct: 60  VEYPYKPPQMKFD-TKVYHPNVSSVTGAICLDILKN-AWTPVITLKSALISLQALLQSPE 117

Query: 123 VDSPLNIDLA 132
            + P +  +A
Sbjct: 118 PNDPQDAQVA 127

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 68.2 bits (165), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 6/129 (4%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KR++KE + I+ +     E+   L+ V   +    +    GP  TPY    + + IE+P 
Sbjct: 5   KRVMKELQAIKDD----PEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPM 60

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           EYP  PP + F+   + H NV   TG ICL+IL++  WSPV  L   +++L  LLQ P  
Sbjct: 61  EYPFKPPKMKFQ-TKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLA 132
           + P + ++A
Sbjct: 119 NDPQDAEVA 127

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 63/113 (55%), Gaps = 4/113 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 42  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNIC 99

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHG 145
           L+IL+ + WSP   L  V++++  LL +   D PL  ++A+I +  D S Y  
Sbjct: 100 LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEA 150

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 73/136 (53%), Gaps = 8/136 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           SLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SLKRITKELNDLGRDPPTSCSA----GPVG-DDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILRA 137
             D PL  ++A++ + 
Sbjct: 115 NPDDPLVPEIAHLYKT 130

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           SLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SLKRITKELNDLGRDPPTSCSA----GPVG-DDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
             D PL  ++A++ +  D + Y      + ++
Sbjct: 115 NPDDPLVPEIAHLYKT-DRAKYEATAKEWTKK 145

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           SLKR+ KE   + ++      +     PV  ++   W+A + GP ++PY    F L I  
Sbjct: 3   SLKRITKELNDLGRDPPTSCSA----GPVG-DDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP   +  V++++  LL + 
Sbjct: 58  PTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSPALTISKVLLSICSLLTDA 114

Query: 122 VVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
             D PL  ++A++ +  D + Y      + ++
Sbjct: 115 NPDDPLVPEIAHLYKT-DRAKYEATAREWTKK 145

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 69/130 (53%), Gaps = 6/130 (4%)

Query: 6   LLKEKRLIEKELSGYSESIE---LLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           + + KR+I KE+    +  E    L  V+  +    +    GP  TPY   +F + I++P
Sbjct: 1   MSRAKRII-KEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            EYP  PP + F+   + H N+   TG ICL+IL++  WSPV  L   +++L  LLQ P 
Sbjct: 60  LEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 123 VDSPLNIDLA 132
            + P + ++A
Sbjct: 118 PNDPQDAEVA 127

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 58/96 (60%), Gaps = 3/96 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           ++  KW  ++ GP  TPY    FK+ ++ P  YP   P +TF    M H NV+ S G IC
Sbjct: 42  DDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFV-SPMWHPNVDMS-GNIC 99

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           L+IL+ + WS V+N+  ++++L  LL+EP   SPLN
Sbjct: 100 LDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 65.9 bits (159), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++    +GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 15  DNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSIC 73

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           L+++ +  WSP+++L  ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 74  LDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

Query: 152 QE 153
            +
Sbjct: 132 DK 133

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 65.5 bits (158), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 80/148 (54%), Gaps = 11/148 (7%)

Query: 10  KRLIEKELSG---YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYP 66
           KR IE ++         +EL+E    E  +K+     GP +TPY K  ++L +ELP  YP
Sbjct: 6   KRRIETDVMKLLMSDHDVELVEDKMQEFHIKFH----GPKDTPYEKGVWRLHVELPDNYP 61

Query: 67  LVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDS 125
              P+I F    + H N++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    
Sbjct: 62  YKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSD 119

Query: 126 PLNIDLANILRAGDTSAYHGLINYYLQE 153
           PLN + A  L+  D   Y   I+ Y+ +
Sbjct: 120 PLNNEAA-TLQLKDKDMYEQKIHEYINK 146

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 65.1 bits (157), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 39  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 96

Query: 104 VWNLMYVMV-ALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++   L  LL+EP    PLN + AN L+  D   Y   +  Y+ +
Sbjct: 97  LYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREYIDK 146

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 3/104 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           ++   W+A + GP ++PY    F L I  P++YP  PP I+F    + H N+  + G IC
Sbjct: 117 DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNIC 174

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           L+IL+ + WSP   +  V++++  LL +   D PL  ++A+I +
Sbjct: 175 LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 217

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICLDVI-NSTWSP 96

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 97  LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYIDK 146

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 29  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 88
           P   E+  KW  ++ GP  TPY    FK+ +E    YP   P + F    M H NV+ S 
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDMS- 95

Query: 89  GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           G ICL+IL+ + WS V+N+  ++++L  LL+EP   SPLN
Sbjct: 96  GNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 23  SIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHC 82
            +EL+     E F+K+     GP  TPY K  ++L +ELP  YP   P+I F    + H 
Sbjct: 21  DVELVNDNMQEFFIKFF----GPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHP 75

Query: 83  NVEFSTGKICLNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTS 141
           N++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D  
Sbjct: 76  NIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKK 133

Query: 142 AYHGLINYYLQE 153
            Y   I  Y+ +
Sbjct: 134 LYEEKIKEYIDK 145

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 28  DNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 86

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D + Y   I  Y+
Sbjct: 87  LDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

Query: 152 QE 153
            +
Sbjct: 145 DK 146

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 75/132 (56%), Gaps = 12/132 (9%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAV-LKGPVNTPYHKHSFKLLIEL 61
           KR++KE +RL+   + G S      EP   E+ L++  V ++GP  +PY    F+L + L
Sbjct: 6   KRIIKETERLVSDPVPGISA-----EP--HEDNLRYFDVSIEGPQQSPYEHGVFRLELFL 58

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P EYP+ PP + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P
Sbjct: 59  PDEYPMEPPKVRFL-TKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLATP 115

Query: 122 VVDSPLNIDLAN 133
             + PL  D+A 
Sbjct: 116 NPNDPLANDVAK 127

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 118

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L   D   Y   I  Y+ +
Sbjct: 119 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELRDKKLYEEKIREYIDK 168

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 61.6 bits (148), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 72/130 (55%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +      EP   +N   +   ++GP  +PY K  FKL + LP
Sbjct: 6   KRIIKETERLVSDPVPGIT-----AEPHE-DNLRYFDVTIEGPSQSPYEKGIFKLELYLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  EDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 88  LDVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

Query: 152 QE 153
            +
Sbjct: 146 DK 147

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 29  PVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFST 88
           P + ++  KW  ++ GP  TPY    FK+ +E    YP   P + F    M H NV+ S 
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDMS- 95

Query: 89  GKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLN 128
           G ICL+IL+ + WS V+N+  ++++L  LL+EP   SPLN
Sbjct: 96  GNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 71/130 (54%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RLI   + G +      EP   +N   +   ++GP  +PY    FKL + LP
Sbjct: 6   KRIIKETERLISDPVPGIT-----AEP-HDDNLRYFNVTVEGPTQSPYENGIFKLELYLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 62.8 bits (151), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 94

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 95  LYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYIDK 144

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 62.8 bits (151), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 4/122 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 29  DNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           L+++ +  WSP+++L  ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 88  LDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

Query: 152 QE 153
            +
Sbjct: 146 DK 147

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 72/130 (55%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RLI   + G +      EP   +N   +   ++GPV +PY    F+L + LP
Sbjct: 6   KRIIKETERLITDPVPGITA-----EP-HDDNLRYFEVTVEGPVGSPYENGIFQLELYLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 61.2 bits (147), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 73/130 (56%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G S      EP   +N   ++  ++GP  +PY    F+L + LP
Sbjct: 6   KRIIKETERLVSDPVPGIS-----AEP-HDDNLRYFQVTIEGPQQSPYENGVFELELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L++ +WSP   +  V++++  LL  P 
Sbjct: 60  EDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 61.2 bits (147), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 78/141 (55%), Gaps = 12/141 (8%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAV-LKGPVNTPYHKHSFKLLIEL 61
           KR++KE +RL+   + G S      EP   E+ L++  V ++GP  + Y    F+L + L
Sbjct: 6   KRIIKETERLVSDPVPGISA-----EP--HEDNLRYFDVSIEGPQQSAYENGVFRLELFL 58

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P EYP+ PP + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P
Sbjct: 59  PDEYPMEPPKVRFL-TKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLATP 115

Query: 122 VVDSPLNIDLANILRAGDTSA 142
             + PL  D+A    A + +A
Sbjct: 116 NPNDPLANDVAEDWIADEDAA 136

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 62.0 bits (149), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYIDK 145

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 62.0 bits (149), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYIDK 145

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 4/109 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 113

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           +++L+ ++  +   LL+EP    PLN + A  L   D   Y   I  Y+
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYI 161

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 3/127 (2%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + L+RL +E++   K+      +     P    N  KW A + G   T +    F + +E
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVE 63

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQ 119
            P EYP  PP + F P    H N+ + +G +CL+IL E + W P   L  +++ +  LL 
Sbjct: 64  YPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLD 121

Query: 120 EPVVDSP 126
            P  +SP
Sbjct: 122 SPNPNSP 128

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  ++ P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDVASGSIC 85

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+
Sbjct: 86  LDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

Query: 152 QE 153
            +
Sbjct: 144 DK 145

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY    ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153
           +++L+ ++  +   LL+EP    PLN + A  L+  D   Y   I  Y+ +
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYIDK 145

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 57/92 (61%), Gaps = 3/92 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP +TPY K  ++L +ELP  YP   P+I F    + H N++ ++G ICL+++ +  WSP
Sbjct: 26  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSP 83

Query: 104 VWNLMYVMVALY-QLLQEPVVDSPLNIDLANI 134
           +++L+ ++  +   LL+EP    PLN + A +
Sbjct: 84  LYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 115

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 71/129 (55%), Gaps = 10/129 (7%)

Query: 10  KRLIEKELSG---YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYP 66
           KR IE ++         +EL++    +N  ++     GP  TPY +  ++L +ELP  YP
Sbjct: 5   KRRIETDVMKLLMSDHDVELVD----DNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYP 60

Query: 67  LVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDS 125
              P+I F    + H N++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    
Sbjct: 61  YKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSD 118

Query: 126 PLNIDLANI 134
           PLN + A +
Sbjct: 119 PLNNEAATL 127

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP+  F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 3/127 (2%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + L+RL +E++   K+      +    +P    N  KW A + G   T +    F + IE
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIE 63

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQ 119
            P +YP  PP + F P    H N+ + +G +CL+IL E + W P   L  + + +  LL 
Sbjct: 64  YPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLLD 121

Query: 120 EPVVDSP 126
            P  +SP
Sbjct: 122 SPNPNSP 128

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 58.9 bits (141), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 44  GPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           GP ++PY    F L I  P++YP  PP I+F    + H N+  + G ICL+IL+ + WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILK-DQWSP 58

Query: 104 VWNLMYVMVALYQLLQEPVVDSPLNIDLANILRA 137
              L  V++++  LL +   D PL  ++A+I + 
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT 92

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP+  F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 12/131 (9%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAV-LKGPVNTPYHKHSFKLLIEL 61
           KR++KE +RL    + G S      EP   E+ L++ AV ++GP  +PY    F+L + L
Sbjct: 6   KRIIKETERLASDPVPGIS-----AEP--HEDNLRYFAVTIEGPEESPYENGVFELELYL 58

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P +YP+  P + F    + H N++   G+ICL++L++ +WSP   +  V++++  LL  P
Sbjct: 59  PDDYPMEAPKVRFL-TRIYHPNID-RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASP 115

Query: 122 VVDSPLNIDLA 132
             + PL  D+A
Sbjct: 116 NPNDPLANDVA 126

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 73/130 (56%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +      EP   +N   ++  ++GP  +PY    F+L + LP
Sbjct: 6   KRIIKETERLVSDPVPGIT-----AEPHE-DNLRYFQVTIEGPQQSPYENGVFQLELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L++ +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKN-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 71/130 (54%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RLI   + G +      EP   +N   +   ++GP  +PY    F+L + LP
Sbjct: 6   KRIIKETERLISDPVPGIT-----AEPHE-DNLRYFNVTVEGPAGSPYENGIFQLELYLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP  TPY    ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 73

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANI 134
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A +
Sbjct: 74  LDVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 60.8 bits (146), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N  ++     GP  TPY +  ++L +ELP  YP   P+I F    + H N++ ++G IC
Sbjct: 27  DNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 85

Query: 93  LNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLNIDLANI 134
           L+++ +  WSP+++L+ ++  +   LL+EP    PLN + A +
Sbjct: 86  LDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 13/98 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
           E WSPV  +  V++++  LL++P + SP N+D A   R
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFR 150

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P ++SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV ++  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 74/140 (52%), Gaps = 10/140 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +      EP   +N   +   ++GP  +PY    F L + LP
Sbjct: 6   KRIIKETERLVSDPVPGIT-----AEP-HDDNLRYFEVTIEGPQQSPYENGVFDLELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLANILRAGDTSA 142
            + PL  D+A      ++SA
Sbjct: 117 PNDPLANDVAEDWIKDESSA 136

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     Y++  +  +     N  KW A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPCKKAD--GSMNLQKWEAGIPGKEGTIWQDGVYPIT 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           IE P EYP  PP + F P    H N+ + +G +CL+IL E + W P   L  + + +  L
Sbjct: 62  IEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     Y++ ++  +     +  KW A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGKEGTNWAGGVYPIT 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           +E P+EYP  PP + F P    H NV + +G ICL+IL E + W P   L  +++ +  L
Sbjct: 62  VEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 71/130 (54%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +      EP   +N   ++  ++GP  +PY    F L + LP
Sbjct: 6   KRIIKETERLVSDPVPGIT-----AEPHE-DNLRYFQVTIEGPQQSPYENGVFNLELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-KLGRICLDVLKT-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  +  P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           YH   FK  ++ P ++P  PP   F P ++ H NV +  G++C++IL           + 
Sbjct: 55  YHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV  +  V++++  LL++P + SP N+D A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           EN   ++  ++GP  +PY    FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 88  LDVLKT-NWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 60.1 bits (144), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 4/126 (3%)

Query: 10  KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVP 69
           KR IE ++     S   +E V  +N  ++     GP  TPY    ++L +ELP  YP   
Sbjct: 5   KRRIETDVMKLLMSDHDVELVD-DNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKS 63

Query: 70  PAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY-QLLQEPVVDSPLN 128
           P+I F    + H N++ ++G ICL+++ +  WSP+++L+ ++  +   LL+EP    PLN
Sbjct: 64  PSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN 121

Query: 129 IDLANI 134
            + A +
Sbjct: 122 NEAATL 127

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 58.5 bits (140), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (53%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +           +N   ++  ++GP  +PY    F+L + LP
Sbjct: 6   KRIIKETERLVSDPVPGITAQPH------EDNLRYFQVTIEGPQQSPYESGVFQLELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     Y++ ++  +     +  KW A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGREGTNWAGGVYPIT 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           +E P+EYP  PP + F P    H NV + +G ICL+IL E + W P   L  +++ +  L
Sbjct: 62  VEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N  +W A + G   T +H+  + L IE P EYP  PP +   P    H NV + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + L+RL +E++   K+      +    +     N  KW A + G   T + +  + + IE
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFWAKPTRKADGSMNLQKWEAGIPGKEGTIWKEGVYPITIE 63

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQ 119
            P +YP  PP + F P    H N+ + +G +CL+IL E + W P   L  +++ +  LL 
Sbjct: 64  YPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLN 121

Query: 120 EPVVDSP 126
            P  DSP
Sbjct: 122 SPNPDSP 128

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 60.5 bits (145), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 14/111 (12%)

Query: 34  NFLKWR-AVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           N   W   V+    ++ YH   F+  ++ P ++P  PP   F P  + H NV +  GK+C
Sbjct: 45  NIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLC 102

Query: 93  LNIL-----------EHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           ++IL           ++E WSPV ++  V++++  LL++P V SP N+D A
Sbjct: 103 ISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N   ++  ++GP  +PY K  F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 26  DNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 83

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           L+IL+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 84  LDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N   ++  ++GP  +PY    FKL + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 57.4 bits (137), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N  KW A + G   T + +  F + IE P +YP  PP + F P    H N+ + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     Y++ ++  +     +  KW A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGKDATNWAGGVYPIT 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           +E P+EYP  PP + F P    H NV + +G ICL+IL E + W P   L  +++ +  L
Sbjct: 62  VEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 10/140 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE +RL+   + G +      EP   +N   +   ++GP  +PY    F L + LP
Sbjct: 6   KRIIKETERLVSDPVPGIT-----AEP-HDDNLRYFSVTIEGPEGSPYEHGIFDLELFLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMESPKVRFL-TKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLANILRAGDTSA 142
            + PL  D+A      +T A
Sbjct: 117 PNDPLANDVAEDWIKNETGA 136

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     Y++ ++  +     +  KW A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFYAKPVKKSD--GSMDLQKWEAGIPGKEGTNWAGGVYPIS 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           +E P+EYP  PP + F P    H NV + +G ICL+IL E + W P   L  +++ +  L
Sbjct: 62  VEYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 41  VLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEH 100
           V+  P    Y    F+  +E    YP+ PP +      + H N++   GK+CLNIL  E 
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCR-NRIYHPNIDVQ-GKVCLNIL-RED 129

Query: 101 WSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152
           WSP  +L  ++V L  L  EP    PLN D A +  + D++A+   +   ++
Sbjct: 130 WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVRKTME 180

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + L+RL +E++   K+      +     P    N  KW A + G   T + +  + + IE
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIE 63

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQ 119
            P+EYP  PP +   P +  H NV + +G ICL+IL E + W P   L  + + +  LL 
Sbjct: 64  YPNEYPSKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLLD 121

Query: 120 EPVVDSP 126
            P  +SP
Sbjct: 122 SPNPNSP 128

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 5/128 (3%)

Query: 1   MSLKRLLKEKRLIEKELS-GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLI 59
           + L+RL +E++   K+   G+       E  +  N  KW A + G   T +    + + I
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSM-NLQKWEAGIPGREGTIWKDAVYPITI 62

Query: 60  ELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLL 118
           E P +YP  PP + F P    H N+ + +G +CL+IL E + W P   +  +++ +  LL
Sbjct: 63  EYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQDLL 120

Query: 119 QEPVVDSP 126
             P  DSP
Sbjct: 121 TSPNPDSP 128

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 74/131 (56%), Gaps = 12/131 (9%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAV-LKGPVNTPYHKHSFKLLIEL 61
           KR++KE +RLI   + G +           E+ L++ +V ++GP ++ Y    F+L + L
Sbjct: 6   KRIIKETERLISDPVPGITAQ-------PHEDNLRYFSVTIEGPKDSAYENGVFELELFL 58

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEP 121
           P +YP+  P + F    + H N++   G+ICL++L++ +WSP   +  V++++  LL  P
Sbjct: 59  PDDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASP 115

Query: 122 VVDSPLNIDLA 132
             + PL  D+A
Sbjct: 116 NPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 72/130 (55%), Gaps = 10/130 (7%)

Query: 4   KRLLKE-KRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELP 62
           KR++KE ++L+   + G +      EP   +N   ++  ++GP  +PY    F+L + LP
Sbjct: 6   KRIIKETEKLVSDPVPGIT-----AEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLP 59

Query: 63  SEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
            +YP+  P + F    + H N++   G+ICL++L+  +WSP   +  V++++  LL  P 
Sbjct: 60  DDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 VDSPLNIDLA 132
            + PL  D+A
Sbjct: 117 PNDPLANDVA 126

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N  KW A + G   T +    + L IE P +YP  PP + F P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPSGTICL 94

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           +  +W A + G   T + +  + + IE P EYP  PP + F P    H NV + +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFL-TRIYHPNID-RLGRIC 77

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 3/127 (2%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
           + L+RL +E++   K+      +    +P    +  +W A + G   T +    + L IE
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIE 63

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLLQ 119
            P EYP  PP +   P +  H NV + +G ICL+IL E + W P   L  + + +  LL 
Sbjct: 64  YPDEYPSKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLLD 121

Query: 120 EPVVDSP 126
            P  +SP
Sbjct: 122 SPNPNSP 128

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N   ++  ++GP  +PY    F+L + LP +YP+  P + F    + H N++   G+IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 93  LNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           L++L+  +WSP   +  V++++  LL  P  + PL  D+A
Sbjct: 78  LDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+     +++  + ++     N   W A + G  +T +H   + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFFAKPTKKVD--GSMNLQLWEAGIPGKESTIWHGALYPIT 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           IE P EYP  PP + F P    H N+ + +G +CL+IL E + W P   L  +++ +  L
Sbjct: 62  IEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDTPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N  KW A + G   T +    + + IE P EYP  PP + F P    H N+ + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGTVCL 94

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  +++ +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N  KW A + G   T + +  + + IE P+EYP  PP +   P    H NV + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 94  NIL-EHEHWSPVWNLMYVMVALYQLLQEPVVDSP 126
           +IL E + W P   L  + + +  LL  P  +SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 63/128 (49%), Gaps = 5/128 (3%)

Query: 1   MSLKRLLKEKRLIEKELS-GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLI 59
           + L+RL +E++   K+   G+       E  +  N  KW A + G   T +    + + I
Sbjct: 4   LCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSM-NLQKWEAGIPGREGTIWKDGVYPITI 62

Query: 60  ELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQLL 118
           E P +YP  PP + F P    H N+ + +G +CL+IL E + W P   +  +++ +  LL
Sbjct: 63  EYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQDLL 120

Query: 119 QEPVVDSP 126
             P  +SP
Sbjct: 121 TSPNPNSP 128

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 1   MSLKRLLKEKRLIEKE--LSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLL 58
           + L+RL +E++   K+   S +++ ++  +     +   W A + G   T +    + + 
Sbjct: 4   LCLQRLQEERKKWRKDHPFSFFAKPLKKAD--GTMDLQHWEAGIPGKAGTLWADAVYPIS 61

Query: 59  IELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-EHEHWSPVWNLMYVMVALYQL 117
           IE P EYP  PP + F P    H N+ + +G +CL+IL E + W P   L  +++ +  L
Sbjct: 62  IEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDL 119

Query: 118 LQEPVVDSP 126
           L  P  +SP
Sbjct: 120 LDSPNPNSP 128

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 53/94 (56%), Gaps = 13/94 (13%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EH 98
           Y+   FK  ++ PS +P  PP   F P  + H NV +  GK+C++IL           ++
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDN 113

Query: 99  EHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLA 132
           E WSPV ++  V++++  LL++P + SP N+D +
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 43/92 (46%), Gaps = 13/92 (14%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAIT-----FEPYSMPHCNVEFSTGKICLNILEHEHWSPV 104
           Y    F+        YP+ PP +      F P   PH       GKICLNIL  E WSP 
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLNIL-REDWSPA 127

Query: 105 WNLMYVMVALYQLLQEPVVDSPLNIDLANILR 136
            +L  +++ L  L QEP  + PLN + A +L 
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLN 159

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 19/142 (13%)

Query: 3   LKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWR-AVLKGPVNTPYHKHSFKLLIEL 61
           L R  +E R   + +  +   IEL+E     N  +W    +    ++ YH      L+  
Sbjct: 13  LLRQFRELRDPRRRMPCFH--IELVEK---SNIFEWEVGFMVTNEDSIYHGAYLTGLLCF 67

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNIL-----------EHEHWSPVWNLMYV 110
           P  +P  PP   F P  + H NV FS G +C++IL           + E WSPV  +  V
Sbjct: 68  PRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETV 125

Query: 111 MVALYQLLQEPVVDSPLNIDLA 132
           ++++  LL +P V SP N+D A
Sbjct: 126 LISIISLLDDPNVSSPANVDAA 147

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 13/152 (8%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
            +LKRL KE +LI +    Y     ++     +N L+W  V+ GP +TPY    +   + 
Sbjct: 5   QALKRLTKEYKLIVENPPPY-----IVARPNEDNILEWHYVITGPSDTPYSSGQYHGTLT 59

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
            PS+YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 60  FPSDYPYKPPAIRM---ITPNGRFKENT-RLCLSMSDYHPDLWNPGWSVSTILTGLLSFM 115

Query: 119 --QEPVVDSPLNIDLANILRAGDTSAYHGLIN 148
              E    S +  D    L A  +  ++   N
Sbjct: 116 TGDEATTGSIVTTDQQKKLLAKRSIQFNTFKN 147

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
            + KRL KE ++I +    Y     ++     EN L+W  V+ GP +TPY    +   + 
Sbjct: 5   QAYKRLSKEYKMIMENTPPY-----IIAVPNDENILEWHYVITGPPDTPYEGGQYHGTLH 59

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
            P EYP  PPAI     S P+   +  T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 60  FPPEYPFKPPAIRI---STPNGRFKQHT-RLCLSMSDYHPDTWNPSWSVATILNGLLSFM 115

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y+   FK  +     YP+ PP++      + H N++ + GKICLNIL  E WSP  ++  
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCL-QKIYHPNIDLN-GKICLNIL-REDWSPALDIQS 114

Query: 110 VMVALYQLLQEPVVDSPLNIDLANIL 135
           V+V L  L  EP    PLN D A+ L
Sbjct: 115 VIVGLLFLFLEPNPRDPLNKDAASTL 140

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 40  AVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHE 99
            +L  P    Y    FK  ++    YP+ PP I      + H N++   GKICLNIL  E
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNIL-RE 127

Query: 100 HWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 139
            WSP  +L  +++ L  L  E     PLN + ANIL + +
Sbjct: 128 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 167

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 40  AVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHE 99
            +L  P    Y    FK  ++    YP+ PP I      + H N++   GKICLNIL  E
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNIL-RE 128

Query: 100 HWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGD 139
            WSP  +L  +++ L  L  E     PLN + ANIL + +
Sbjct: 129 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDE 168

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 6/88 (6%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  DNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRM---ITPNGRFKENT-RLC 87

Query: 93  LNILEH--EHWSPVWNLMYVMVALYQLL 118
           L++ ++  E W+P W+++ ++  L   +
Sbjct: 88  LSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y    FK        YP+ PP +T     + H N++   G +CLNIL  E WSPV ++  
Sbjct: 73  YKCGHFKFCATFKDTYPIEPPKVTLL-SKIFHPNIDLQ-GNVCLNIL-REDWSPVLDVQS 129

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILRA 137
           +++ L  L  EP    PLN   A++L A
Sbjct: 130 ILIGLLMLFLEPNATDPLNKVAADVLAA 157

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 13/149 (8%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +    Y     +L     +N L+W  ++ GP +TPY    +   +  PS
Sbjct: 8   KRLTKEYKLMVENPPPY-----ILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL--Q 119
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +   
Sbjct: 63  DYPYKPPAIRM---VTPNGRFKPNT-RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD 118

Query: 120 EPVVDSPLNIDLANILRAGDTSAYHGLIN 148
           E    S    D    + A ++ +Y+   N
Sbjct: 119 EATTGSITTSDHQKKMLARNSISYNSFQN 147

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 61/117 (52%), Gaps = 11/117 (9%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +++ +  + Y     ++      N L+W  V+ GP ++PYH   +   +  PS
Sbjct: 8   KRLTKEYKMMMENPTPY-----IIARPNESNILEWHYVITGPPDSPYHDGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPYKPPAIRM---VTPNGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 15/150 (10%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +    Y     +L     +N L+W  ++ GP +TPY    +   +  PS
Sbjct: 8   KRLTKEYKLMVENPPPY-----ILARPNEDNILEWHYIITGPADTPYKAGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFS-TGKICLNILEH--EHWSPVWNLMYVMVALYQLL-- 118
           +YP  PPAI      M   N  F    ++CL++ ++  + W+P W++  ++  L   +  
Sbjct: 63  DYPYKPPAI-----RMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

Query: 119 QEPVVDSPLNIDLANILRAGDTSAYHGLIN 148
            E    S    D    + A ++ +Y+   N
Sbjct: 118 DEATTGSITTSDHQKKVLAKNSVSYNTFQN 147

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
            +LKRL KE +LI +    Y     +      +N L+W  V+ GP  TPY    +   + 
Sbjct: 5   QALKRLTKEYKLIVENPPPY-----VTARPNEDNILEWHYVITGPPETPYEGGQYHGTLT 59

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
            PS+YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 60  FPSDYPYKPPAIRM---VTPNGRFKENT-RLCLSMSDYHPDLWNPGWSVSTILTGLLSFM 115

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 13/118 (11%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +    Y     +L     +N L+W  ++ GP +TPY    +   +  PS
Sbjct: 8   KRLTKEYKLMVENPPPY-----ILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFS-TGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI      M   N  F    ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPYKPPAI-----RMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 70/149 (46%), Gaps = 13/149 (8%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +    Y     +L     +N L+W  ++ GP  TPY    +   +  PS
Sbjct: 8   KRLTKEYKLMVENPPPY-----ILARPNEDNILEWHYIITGPAETPYKGGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL--Q 119
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +   
Sbjct: 63  DYPYKPPAIRM---VTPNGRFKPNT-RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD 118

Query: 120 EPVVDSPLNIDLANILRAGDTSAYHGLIN 148
           E    S    D    + A ++ +Y+   N
Sbjct: 119 EATTGSVTTSDHQKKILAKNSLSYNAFQN 147

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 51/104 (49%), Gaps = 6/104 (5%)

Query: 45  PVNTPYHKHSFKLLIELPSEYPLVPP-AITFEPYSMPHCNVEFSTGKICLNILEHEHWSP 103
           P   PY   +FK  ++    YP+ PP AI       P+ ++    GKICLNIL  E WSP
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIFHPNIDL---NGKICLNIL-REDWSP 132

Query: 104 VWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLI 147
             +L  +++ L  L  +     PLN   A +L A D + +  L+
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELV 175

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 52.0 bits (123), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 11/119 (9%)

Query: 2   SLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61
           +LKRL KE +L+ +    Y     +L     +N L+W  ++ GP +TPY    +   +  
Sbjct: 6   ALKRLTKEYKLMVENPPPY-----ILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTF 60

Query: 62  PSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           PS+YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFKENT-RLCLSMSDYHPDLWNPGWSVNTILNGLLSFM 115

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y    F   +     YP+ PP + F    + H N++ + GKICLNIL  E WSPV +L  
Sbjct: 80  YKDGYFPFSMVFKDSYPIEPPVVKFL-KKIYHPNIDLN-GKICLNIL-REDWSPVLDLQS 136

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILR 136
           +++ L  L  EP    PLN+    +L+
Sbjct: 137 IIIGLMFLFLEPNPRDPLNLKAGELLK 163

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 6/88 (6%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           EN L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++C
Sbjct: 32  ENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLC 87

Query: 93  LNILEH--EHWSPVWNLMYVMVALYQLL 118
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPGWSVATILNGLLSFM 115

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y    F   +E    YP+ PP +      + H N++   GK+CLNIL  E WSP  ++  
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICT-SKLYHPNIDID-GKVCLNIL-REDWSPALDVQS 134

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLIN 148
           +++ L  LL EP    PLN D A +L + DT+ +  L+N
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKDAAMML-STDTARFASLVN 172

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P    +  T ++C
Sbjct: 32  DNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT-RLC 87

Query: 93  LNILEH--EHWSPVWNLMYVMVALYQLL 118
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 11/117 (9%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +LI +  + Y     +L      N L+W  ++ GP +TPY    +   +  PS
Sbjct: 8   KRLSKEYKLIIENPTPY-----ILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPFKPPAIRM---ITPNGRFKENT-RLCLSMSDYHPDLWNPGWSVATILNGLLSFM 115

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 6/88 (6%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKIC 92
           +N L+W  V+ GP +TPY    +   +  PS+YP  PPAI       P    +  T ++C
Sbjct: 32  DNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT-RLC 87

Query: 93  LNILEH--EHWSPVWNLMYVMVALYQLL 118
           L++ ++  + W+P W++  ++  L   +
Sbjct: 88  LSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 11/117 (9%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +    Y     +L      N L+W  ++ GP +TPY +  +   +  PS
Sbjct: 8   KRLTKEYKLMVENPPPY-----ILARPNENNILEWHYIITGPADTPYFEGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI       P+     +T ++CL++ ++    W+P W++  ++  L   +
Sbjct: 63  DYPYKPPAIRM---VTPNGRFRENT-RLCLSMSDYHPNTWNPSWSVSTILNGLLSFM 115

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 67/145 (46%), Gaps = 18/145 (12%)

Query: 22  ESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPH 81
           +S + ++P   E       V+  P    Y+  S    ++    YP+ PP +T     + H
Sbjct: 53  QSTDRMQPPKLE-------VVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCL-KKIFH 104

Query: 82  CNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANIL-----R 136
            N++ + G +CLNIL  E WSP  +L  +++ L  L  EP  + PLN D A +      +
Sbjct: 105 PNIDLN-GNVCLNIL-REDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKK 162

Query: 137 AGDT---SAYHGLINYYLQEDTATH 158
             +T   +   G +++ L +D   H
Sbjct: 163 FAETVILAMSGGSVDHVLYDDVVAH 187

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 33  ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTG-KI 91
           +N L+W  ++ GP +TPY    +   +  P++YP  PPAI      M   N  F    ++
Sbjct: 32  DNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAI-----RMITPNGRFKENTRL 86

Query: 92  CLNILEH--EHWSPVWNLMYVMVALYQLL 118
           C+ + ++  + W+P W++  +++ L   +
Sbjct: 87  CMTMSDYHPDTWNPAWSVATILMGLLSFM 115

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 60/117 (51%), Gaps = 11/117 (9%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +L+ +     S    L  P   +N L+W  ++ GP +TPY    +   +  P+
Sbjct: 8   KRLTKEYKLLVES----SPPFILARPNE-DNILEWHYIITGPPDTPYDGGQYHGTLTFPN 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPYKPPAIRM---ITPNGRFKENT-RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 50  YHKH-SFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLM 108
           Y+ H S    ++    YP+ PP +        H N++F  G +CLNIL  E WSP  +L 
Sbjct: 73  YYTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDFK-GNVCLNIL-REDWSPALDLQ 129

Query: 109 YVMVALYQLLQEPVVDSPLNIDLANIL 135
            ++  L  L  EP  + PLN D A +L
Sbjct: 130 SIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 70/153 (45%), Gaps = 15/153 (9%)

Query: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60
            + KRL KE + + +    Y     +L     +N L+W  ++ GP ++PY +  +   + 
Sbjct: 5   QAFKRLTKEYKTLTETPPPY-----ILARPNEDNILEWHYIITGPPDSPYSEGQYHGTLT 59

Query: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTG-KICLNILEH--EHWSPVWNLMYVMVALYQL 117
            P++YP  PPAI      M   N  F    ++CL++ ++  + W+P W++  ++  L   
Sbjct: 60  FPTDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDLWNPSWSVSTILTGLLSF 114

Query: 118 L--QEPVVDSPLNIDLANILRAGDTSAYHGLIN 148
           +   E    S +  D      A ++ A++   N
Sbjct: 115 MTGDEATTGSIVTTDSQKRQFAMNSVAFNNRQN 147

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N L+W  ++ GP +TPY    +   +  PS+YP  PPAI       P+   + +T ++CL
Sbjct: 33  NILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RLCL 88

Query: 94  NILEH--EHWSPVWNLMYVMVALYQLL 118
           ++ ++  + W+P W++  ++  L   +
Sbjct: 89  SMSDYHPDTWNPGWSVATILNGLLSFM 115

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 61/117 (52%), Gaps = 11/117 (9%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +++ +  + +     ++      N L+W  ++ GP ++PY +  +   +  PS
Sbjct: 8   KRLTKEYKMMNENPTPF-----IMARPNEANILEWHYIINGPPDSPYFEGQYHGTLTFPS 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI       P+   + +T ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPYKPPAIRM---ITPNGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 34  NFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICL 93
           N L W  ++ GP  TPY    +   +  PS+YP  PPAI       P    + +T ++CL
Sbjct: 33  NILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM---VTPSGRFQENT-RLCL 88

Query: 94  NILEH--EHWSPVWNLMYVMVALYQLL 118
           ++ ++    W+P W++  ++  L   +
Sbjct: 89  SMSDYHPTTWNPGWSVSTILNGLLSFM 115

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 13/118 (11%)

Query: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63
           KRL KE +++ +    Y     ++     +N L W  V+ GP  TPY    +   +  P+
Sbjct: 8   KRLSKEYKMMTENPPPY-----IVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPN 62

Query: 64  EYPLVPPAITFEPYSMPHCNVEFS-TGKICLNILEH--EHWSPVWNLMYVMVALYQLL 118
           +YP  PPAI      M   N  F    ++CL++ ++  + W+P W++  ++  L   +
Sbjct: 63  DYPFNPPAI-----RMLTPNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFM 115

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y+  S    ++    YP+ PP +      + H N++   G +CLNIL  E WSP  +L  
Sbjct: 75  YNYGSINFNLDFNEVYPIEPPKVVCL-KKIFHPNIDLK-GNVCLNIL-REDWSPALDLQS 131

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILRAGD 139
           ++  L  L  EP  + PLN D A +L  G+
Sbjct: 132 IITGLLFLFLEPNPNDPLNKDAAKLLCEGE 161

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y    F+  +     YP+ PPA+      + H N++ + G +CLNIL  E WSPV +L  
Sbjct: 73  YKPGYFRFSLFFKDTYPIEPPAVKCV-NKIYHPNID-TQGNVCLNIL-REDWSPVLDLQS 129

Query: 110 VMVALYQLLQEPVVDSPLN 128
           V++ L  L  EP    PLN
Sbjct: 130 VVIGLLFLFLEPNDKDPLN 148

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y K  F   +    +YP+ PP +      + H N++   GKICLNIL  E WSP  +L  
Sbjct: 75  YRKGHFTFEMTFTEKYPIEPPQVRCM-NQIFHPNIDLQ-GKICLNIL-REDWSPALDLQS 131

Query: 110 VMVALYQLLQEPVVDSPLNIDLANIL 135
           V++ +  L  E     PLN   A++L
Sbjct: 132 VIIGILFLFLEVSGRDPLNKQAASLL 157

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 11/117 (9%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y+  S    ++    YP+ PP +      + H N++   G +CLNIL  E WSP  +L  
Sbjct: 74  YNHGSINFGLDFNEVYPIEPPKVACL-KKIFHPNIDLK-GNVCLNIL-REDWSPALDLQS 130

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILRAGD--------TSAYHGLINYYLQEDTATH 158
           ++  L  L  EP  + PLN D A +    +        ++   G +N    +D A+ 
Sbjct: 131 IITGLLFLFLEPNPNDPLNKDAAKLFCQNEKKFAEIVRSTMSGGSVNQVQYDDVASR 187

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y+   F+    +   YP+ PP +      + H N+   TG+ICLNIL  E WSP  +L  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKVVCL-TKIYHPNIN-RTGEICLNILR-EDWSPALDLQS 142

Query: 110 VMVALYQLLQEPVVDSPLNIDLANIL 135
           V++ L  L  EP    PLN   A+ L
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL 168

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y    F+  +     YP+ PP +     ++ H N+++S G ICLN+L  E WSPV +L  
Sbjct: 88  YRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNIDYS-GNICLNVL-REDWSPVMDLQT 144

Query: 110 VMVALYQLLQEPVVDSPLNIDLANIL 135
           V++ L  L  EP    PLN   A+ +
Sbjct: 145 VVLGLLFLFLEPNGSDPLNRQAADTM 170

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 50  YHKHS-FKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLM 108
           ++KH  F   +     YP+ PP +     ++ H N++++ G ICLN+L  E W+PV +L 
Sbjct: 154 FYKHGHFGFSVSFKDSYPIDPPIVKCL-TTIYHPNIDYN-GNICLNVLR-EDWTPVLDLQ 210

Query: 109 YVMVALYQLLQEPVVDSPLNIDLANIL 135
            +++ L  L  EP    PLN   A+ +
Sbjct: 211 TIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 13  IEKELSGYSESIELLEPVAF--ENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPP 70
           ++K+L     S ++ E   +  EN ++    +K  +   Y   ++   + +   YP+ PP
Sbjct: 34  LKKDLENIDLSEQICEYTTYLDENPMRVNLAIKPDIGY-YAGGTYYFNVFIKDTYPMEPP 92

Query: 71  AITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNID 130
            +    + + H N++   G +CLN+L  E W+P  ++  +++ +  L  EP    PLN D
Sbjct: 93  VVKCM-HRIYHPNIDID-GNVCLNLL-REDWTPALDIQSIIIGILFLFHEPNGRDPLNKD 149

Query: 131 LANIL 135
            A  L
Sbjct: 150 AAKTL 154

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 50  YHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMY 109
           Y   +F   +    +YP+ PP +      + H N++ + G++CLNIL  + W+P  +L  
Sbjct: 66  YKGGNFTFELLFNEQYPMEPPKVKCL-NRIYHPNID-TDGRVCLNILRQD-WTPALDLQS 122

Query: 110 VMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGL 146
           V++ L  L  E     PLN   A        +  H +
Sbjct: 123 VIIGLLFLFLEISGVDPLNKQAAETFNRNRQNFAHAV 159

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 9/122 (7%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK L   S S  L +        +W   + GP ++ +    + + IE   +
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADADDI-TMTRWNGTILGPPHSNHENRIYSVSIECGPK 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKIC---LNILEHEHWSPVWNLMYVMVALYQLLQE 120
           YP  PP ITF    ++P C V+ STG++     N L  + W  ++N+  +++ L + +  
Sbjct: 68  YPDEPPTITFISKINLP-C-VDQSTGEVNKEKFNTL--KDWKRLYNMETILLDLRKEMAS 123

Query: 121 PV 122
           P 
Sbjct: 124 PA 125

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK     S S  L +        KW   + GP ++ +    + L IE    
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDI-TMTKWNGTILGPPHSNHENRIYSLSIECGPN 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
           YP  PP +TF    ++P  N   +TG+I  +      W   + +  +++ L + +  P 
Sbjct: 68  YPDSPPKVTFISKINLPCVNQ--TTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 37  KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITF-EPYSMPHCNVEFSTGKICLNI 95
           KW   + GP ++ +    + L IE    YP  PP +TF    ++P C V  +TG++  N 
Sbjct: 3   KWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLP-C-VSQTTGEVQTNF 60

Query: 96  LEHEHWSPVWNLMYVMVALYQLLQEPV 122
                W   + +  +++ L + +  P 
Sbjct: 61  HTLRDWKRAYTMETLLLDLRKEMATPA 87

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 35.0 bits (79), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK     S S  L +        KW   + GP ++ +    + L I+    
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDI-TMTKWNGTILGPPHSNHENRIYSLSIDCGPN 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPV 122
           YP  PP +TF    ++P  N   +TG++  +      W   + +  +++ L + +  P 
Sbjct: 68  YPDSPPKVTFISKINLPCVNP--TTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 33.9 bits (76), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK L   S S  L +     +   W   + GP ++ +    + L IE    
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDI-SMTTWNGTILGPPHSNHENRIYSLSIECGPN 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKICLNILEH-EHWSPVWNLMYVMVALYQLLQEPV 122
           YP  PP I F    ++P C V+  TG++  +       W   +N+  +++ L + +  P 
Sbjct: 68  YPDHPPTIKFISKINLP-C-VDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMATPA 125

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 33.9 bits (76), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK L   S S  L           W   + GP ++ +    + ++I+   E
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLANGEDI-TMTTWNGTILGPPHSNHENRIYSVVIKCGDE 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123
           YP  PP + F    ++P C V+ +TG++  N+    H    W   Y M  L   L++ + 
Sbjct: 68  YPDKPPTVKFISKINLP-C-VDQATGEVETNMF---HTLRDWKRSYTMETLLLDLRKEMA 122

Query: 124 DS 125
            S
Sbjct: 123 SS 124

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 33.1 bits (74), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 37  KWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITF-EPYSMPHCNVEFSTGKICLNI 95
           KW   + GP ++ +    + L IE    YP  PP +TF    ++P  N   +TG++  + 
Sbjct: 3   KWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPCVNP--TTGEVQTDF 60

Query: 96  LEHEHWSPVWNLMYVMVALYQLLQEPV 122
                W   + +  +++ L + +  P 
Sbjct: 61  HTLRGWKRAYTMETLLLDLRKEMATPA 87

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 33.5 bits (75), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 8/118 (6%)

Query: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSE 64
           RLL+E    EK L   S S  L +        KW   + GP ++ +    + +LIE    
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLSDSDDI-TMTKWNGTILGPPHSNHENRIYSVLIECGPS 67

Query: 65  YPLVPPAITF-EPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVM-VALYQLLQE 120
           YP  PP + F    ++P  N   +TG++   + E  H    W   Y M   L +L +E
Sbjct: 68  YPDEPPKVKFVSKINLPCVNS--TTGEV---VKEKFHTLKEWKRSYTMETVLLELRKE 120

>Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON}
           YCL008C (REAL)
          Length = 379

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 12/81 (14%)

Query: 54  SFKLLIELPSEYPLVPPAITFE---------PYSMPHCNVEFSTGKICLNILEHEHWSP- 103
           S  L++ +P+ YP+ PP I+ +           S+P      S G+I L IL  +HW+P 
Sbjct: 72  SLPLIMWIPNLYPVKPPFISIDLETFDVSTISSSLPVQAYIDSDGRIALPIL--DHWNPA 129

Query: 104 VWNLMYVMVALYQLLQEPVVD 124
             +L+ V+  L  LL EP  D
Sbjct: 130 TMSLIAVVQELMGLLNEPSQD 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,043,961
Number of extensions: 756823
Number of successful extensions: 2417
Number of sequences better than 10.0: 275
Number of HSP's gapped: 2189
Number of HSP's successfully gapped: 275
Length of query: 158
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 58
Effective length of database: 42,014,799
Effective search space: 2436858342
Effective search space used: 2436858342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)