Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042503.492ON62962923920.0
Kpol_480.143.492ON6993807215e-85
YGR130C3.492ON8163875286e-57
Smik_6.2263.492ON8393345084e-54
Suva_7.4183.492ON8312865059e-54
Skud_7.4413.492ON8073365012e-53
NCAS0E008103.492ON6923364523e-47
SAKL0F02772g3.492ON7732714527e-47
CAGL0I10516g3.492ON8132754511e-46
NDAI0G009403.492ON6563344241e-43
ZYRO0D09988g3.492ON9943343911e-38
KLTH0F14828g3.492ON8362673766e-37
TDEL0D056003.492ON7002763746e-37
KLLA0D16236g3.492ON8713373581e-34
Kwal_55.212293.492ON7872673392e-32
KAFR0C019603.492ON5632692856e-26
KNAG0B008103.492ON7572852869e-26
Ecym_12373.492ON7272922582e-22
AFR310C3.492ON6232622261e-18
TBLA0C044803.492ON8021132056e-16
KAFR0G036903.492ON3631271775e-13
KNAG0A079403.492ON275861364e-08
NCAS0F035503.492ON4411351341e-07
NDAI0B058603.492ON681741262e-06
SAKL0E14916g5.702ON17791721163e-05
TPHA0A011508.604ON8182681092e-04
Kpol_483.114.238ON25462341092e-04
Suva_2.5285.414ON9443061074e-04
YDL058W (USO1)4.238ON17902671065e-04
Suva_8.2518.604ON8291751056e-04
YDR356W (SPC110)5.414ON9442551048e-04
TBLA0E034903.106ON7492021030.001
Smik_4.6225.414ON9442831030.001
TBLA0A036205.414ON9702861030.001
NDAI0D044204.238ON19143081020.002
YKR095W (MLP1)5.702ON1875991010.002
TPHA0B008304.238ON25362701010.002
Smik_15.3828.604ON8291271000.002
KNAG0A078803.479ON764267980.004
TDEL0E013304.238ON1657302980.005
KAFR0G020908.604ON732117970.005
TPHA0H016805.414ON989268960.007
KNAG0B052301.295ON1225273950.010
Smik_2.677.488ON1377174950.010
Suva_11.3315.702ON1898302950.010
Smik_8.905.267ON1927265950.010
Skud_16.396.267ON71083940.012
NCAS0B018008.604ON791283940.012
NDAI0C058808.604ON846255940.012
TPHA0D017505.296ON881249940.012
TBLA0F027507.488ON1414187940.013
KNAG0D043404.238ON2220321940.014
TBLA0C027401.295ON1119324930.017
CAGL0F04609g7.488ON1311325930.017
Kpol_392.88.259ON1427206930.017
Smik_11.3585.702ON1878271930.018
ZYRO0B12144g4.238ON2005255930.018
KNAG0D006706.289ON537248920.019
CAGL0L00495g6.267ON70598920.020
Kpol_1031.155.414ON929111920.021
Skud_4.6255.414ON947264920.021
KLLA0E05281g4.238ON1755107910.030
Smik_4.1764.238ON1795119910.030
ZYRO0G06600g5.702ON1820371910.031
Skud_11.3345.702ON1885264910.031
Smik_13.3916.267ON71083900.035
YDR285W (ZIP1)5.296ON875263900.036
YBL047C (EDE1)7.488ON1381174900.039
KAFR0D022205.702ON1674174900.040
CAGL0G02497g5.702ON1780126900.040
TBLA0E017305.702ON1820284900.040
Ecym_21296.289ON636233890.045
KLLA0B04136g4.364ON668353890.045
Skud_15.3628.604ON829126890.047
NDAI0K011008.704ON888171890.048
KAFR0A016101.295ON1227202890.051
NDAI0E017402.385ON240114860.058
TBLA0G017306.289ON749255880.061
SAKL0H03300g4.238ON1707109880.069
Skud_4.1964.238ON1792250880.069
NDAI0G028203.149ON451254870.069
TDEL0B021905.702ON1810114880.069
YHR023W (MYO1)5.267ON1928265880.069
KNAG0E016702.215ON161110830.077
YMR186W (HSC82)6.267ON70583870.079
Skud_13.3526.267ON71183870.079
TDEL0C025201.487ON877109870.083
KAFR0B005907.488ON1261207870.087
Skud_8.785.267ON1927103870.091
NCAS0A024504.238ON1928231870.091
NCAS0A086803.106ON617126860.10
TBLA0A071106.4ON857284860.11
TPHA0D046105.702ON1183137860.11
NDAI0B055205.414ON1009234850.15
NDAI0G020707.186ON1171100850.15
KAFR0B027108.259ON1416102850.15
Suva_4.1914.238ON1782227850.16
KAFR0H024608.659ON446103840.16
ZYRO0C06732g5.593ON218104820.16
Suva_8.3248.726ON660188840.18
TPHA0F033701.487ON877118840.19
TPHA0C017708.484ON88254840.19
YOL034W (SMC5)7.101ON1093160840.19
Suva_2.707.488ON1380289840.20
TBLA0E024207.68ON1586124840.20
YIL149C (MLP2)5.702ON1679148840.20
NCAS0G028302.215ON21796810.22
KAFR0A041408.726ON664104830.23
NDAI0A084507.101ON1119114830.26
Skud_16.3363.330ON1180103830.26
ZYRO0F10824g8.609ON460210820.28
KNAG0M022602.590ON847255820.32
SAKL0H24200g4.46ON963315820.33
KAFR0J017702.215ON161147780.34
NDAI0J005307.488ON1389308820.34
Suva_10.1708.259ON1416125820.35
Kpol_1051.255.267ON1968177820.35
NCAS0B013108.636ON487347810.37
KNAG0F030606.77ON29086800.38
TPHA0E003907.488ON799129810.42
KAFR0L003706.16ON963155810.43
KLLA0D07502g8.68ON1243115810.45
Smik_15.783.124ON3076105810.48
TBLA0A070301.60ON458146800.48
TPHA0C044407.186ON1170117800.58
KAFR0G029307.186ON1170236800.58
KAFR0H002105.702ON1454272800.60
KLTH0D14102g4.238ON1712122800.60
Suva_15.2095.267ON1929265800.61
NDAI0E050405.702ON1973108800.61
CAGL0D00924g4.238ON1980109800.61
SAKL0H15378g8.331ON3729102800.63
NDAI0H012407.122ON224107770.71
TDEL0D051803.106ON837133790.73
ZYRO0F01188g2.590ON84865790.73
Kpol_2001.755.702ON1006241790.75
Kpol_1060.435.160ON15695750.79
KAFR0G032004.238ON1869187790.80
Skud_15.3838.636ON485233780.85
Kpol_274.48.121ON595122780.90
NCAS0D001402.16ON602225780.90
SAKL0A08206g6.69ON645277780.92
CAGL0G04917g4.217ON646102780.92
Kpol_1030.118.374ON695215780.93
Suva_13.3676.267ON70885780.93
YPL240C (HSP82)6.267ON70969780.93
NDAI0D043004.268ON743128780.94
TDEL0B068302.590ON89177780.97
Kpol_1065.433.303ON942138780.98
ZYRO0F03828g8.68ON1217126781.0
NDAI0C048608.425ON1350101781.0
KAFR0E017505.267ON1891107781.0
TBLA0A104705.267ON1999114781.1
TPHA0C019308.460ON56792771.2
TDEL0E031505.311ON640271771.2
Kpol_1002.646.188ON657276771.2
NCAS0C011608.704ON859160771.3
Suva_10.4054.46ON916253771.3
NDAI0D029304.46ON960132771.3
TPHA0I013502.134ON17991741.3
NDAI0G033208.68ON1231259771.3
NDAI0F002905.702ON1554191771.4
KLLA0E11595g5.267ON1848260771.4
TPHA0D023405.528ON506104761.5
KAFR0E013705.311ON601103761.6
SAKL0B09504g7.102ON65754761.6
TBLA0G002902.26ON66287761.6
Skud_15.4408.726ON671130761.6
TDEL0A054908.604ON781110761.6
ZYRO0E03542gsingletonON11963711.7
TPHA0N014102.590ON874106761.7
KAFR0L020908.872ON894258761.7
TBLA0H037208.560ON901111761.7
TDEL0E005102.16ON936228761.7
KLTH0E04774g7.186ON1170177761.7
NCAS0B027308.442ON165790761.8
TPHA0E023205.267ON1915183761.8
YOL069W (NUF2)3.149ON451246751.9
NCAS0I020603.167ON647114752.1
ZYRO0E07986g6.267ON71283752.1
KLLA0D12958g6.267ON71399752.1
TDEL0E021005.414ON761109752.1
KAFR0F030204.46ON82495752.2
TDEL0E033205.296ON855223752.2
TBLA0A102505.296ON950230752.2
TPHA0A011408.605ON97487752.2
SAKL0B06380g3.303ON1002187752.2
TPHA0F012202.257ON107899752.3
NDAI0F040001.110ON1305110752.3
Smik_14.851.110ON1312111752.3
TPHA0J007208.259ON1393103752.3
YMR219W (ESC1)8.736ON165894752.3
Kwal_23.55345.267ON190783752.4
KAFR0B057708.331ON2560158752.4
YOL081W (IRA2)3.124ON3079105752.4
TBLA0H001803.15ON72460742.8
KLLA0A03509g7.21ON776276742.8
SAKL0H05852g8.704ON86993742.9
TBLA0A072306.16ON1097127743.0
TPHA0I010901.295ON1216184743.0
CAGL0H02805g1.295ON1219156743.0
TDEL0D016201.295ON1223114743.0
CAGL0F02079g8.68ON122384743.0
YNL250W (RAD50)1.110ON1312109743.0
Suva_3.1336.377ON362113733.0
ZYRO0C01716g8.259ON1413130743.0
YMR294W (JNM1)5.32ON373152733.1
KNAG0K00940singletonON46693733.3
TPHA0B010204.199ON501114733.4
CAGL0K03047g2.535ON201101713.6
Skud_16.4353.479ON729112733.7
Skud_12.5104.301ON73095733.7
TPHA0E012905.322ON85238733.8
KAFR0E040105.414ON905118733.8
TBLA0G001802.16ON1016130733.9
NCAS0G041801.487ON1105112733.9
NDAI0D026005.88ON1167111733.9
AFR637W1.110ON1296142734.0
TPHA0M014903.336ON427185724.3
TPHA0L007907.157ON446123724.3
TPHA0F032208.636ON47897724.4
TBLA0B028408.786ON60760724.7
Kpol_543.95.475ON64286724.7
CAGL0H03179g6.188ON657117724.8
TPHA0B021304.268ON661189724.8
NCAS0F030305.380ON71887724.8
Ecym_31735.296ON83998725.0
Suva_2.4515.296ON877168725.0
Smik_12.3934.46ON910257725.0
SAKL0E12716g2.81ON921159725.0
Ecym_7269na 1ON980145725.1
KNAG0C050605.414ON104082725.1
NCAS0B027208.443ON1114186725.1
YJL074C (SMC3)1.295ON1230127725.2
Kpol_1013.697.488ON1244120725.2
TBLA0C043904.56ON1272192725.2
Kwal_33.135261.110ON1298112725.2
Suva_16.3028.472ON133248725.2
KNAG0G020208.259ON144460725.3
ACR068W5.267ON1805241725.3
NCAS0F007707.122ON172111695.4
Kpol_380.15singletonON38486715.4
TDEL0F045608.331ON238276725.4
TBLA0D044807.167ON385106715.4
Skud_15.723.124ON308089725.5
ZYRO0G03850g7.157ON418143715.6
KLLA0A03938g7.69ON42044715.6
KLLA0D02750g4.300ON423102715.6
TBLA0A106102.315ON423167715.6
Skud_15.833.149ON451122715.7
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TPHA0D04250
         (1890 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   926   0.0  
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   282   5e-85
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   207   6e-57
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   200   4e-54
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   199   9e-54
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   197   2e-53
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   178   3e-47
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   178   7e-47
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   178   1e-46
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   167   1e-43
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   155   1e-38
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   149   6e-37
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   148   6e-37
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   142   1e-34
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   135   2e-32
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   114   6e-26
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   114   9e-26
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   103   2e-22
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    92   1e-18
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    84   6e-16
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    73   5e-13
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    57   4e-08
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    56   1e-07
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    53   2e-06
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    49   3e-05
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    47   2e-04
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    47   2e-04
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    46   4e-04
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    45   5e-04
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    45   6e-04
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    45   8e-04
TBLA0E03490 Chr5 complement(868330..870579) [2250 bp, 749 aa] {O...    44   0.001
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    44   0.001
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    44   0.001
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    44   0.002
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    44   0.002
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    44   0.002
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    43   0.002
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...    42   0.004
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    42   0.005
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    42   0.005
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    42   0.007
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    41   0.010
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    41   0.010
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    41   0.010
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    41   0.010
Skud_16.39 Chr16 complement(70011..72143) [2133 bp, 710 aa] {ON}...    41   0.012
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    41   0.012
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    41   0.012
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    41   0.012
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    41   0.013
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    41   0.014
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    40   0.017
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    40   0.017
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    40   0.017
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    40   0.018
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    40   0.018
KNAG0D00670 Chr4 complement(98205..99818) [1614 bp, 537 aa] {ON}...    40   0.019
CAGL0L00495g Chr12 complement(55122..57239) [2118 bp, 705 aa] {O...    40   0.020
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    40   0.021
Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356...    40   0.021
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    40   0.030
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    40   0.030
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    40   0.031
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    40   0.031
Smik_13.391 Chr13 (616728..618860) [2133 bp, 710 aa] {ON} YMR186...    39   0.035
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    39   0.036
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    39   0.039
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    39   0.040
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    39   0.040
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    39   0.040
Ecym_2129 Chr2 complement(238725..240635) [1911 bp, 636 aa] {ON}...    39   0.045
KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} simila...    39   0.045
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    39   0.047
NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {...    39   0.048
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    39   0.051
NDAI0E01740 Chr5 (345054..345776) [723 bp, 240 aa] {ON} Anc_2.38...    38   0.058
TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {O...    39   0.061
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    39   0.069
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    39   0.069
NDAI0G02820 Chr7 (655932..657287) [1356 bp, 451 aa] {ON} Anc_3.1...    38   0.069
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    39   0.069
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    39   0.069
KNAG0E01670 Chr5 complement(336548..337033) [486 bp, 161 aa] {ON...    37   0.077
YMR186W Chr13 (632355..634472) [2118 bp, 705 aa] {ON}  HSC82Cyto...    38   0.079
Skud_13.352 Chr13 (606459..608594) [2136 bp, 711 aa] {ON} YMR186...    38   0.079
TDEL0C02520 Chr3 (438435..441068) [2634 bp, 877 aa] {ON} Anc_1.4...    38   0.083
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    38   0.087
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    38   0.091
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    38   0.091
NCAS0A08680 Chr1 complement(1716853..1718706) [1854 bp, 617 aa] ...    38   0.10 
TBLA0A07110 Chr1 complement(1756627..1759200) [2574 bp, 857 aa] ...    38   0.11 
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    38   0.11 
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    37   0.15 
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    37   0.15 
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    37   0.15 
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    37   0.16 
KAFR0H02460 Chr8 (470593..471933) [1341 bp, 446 aa] {ON} Anc_8.6...    37   0.16 
ZYRO0C06732g Chr3 (505681..506337) [657 bp, 218 aa] {ON} similar...    36   0.16 
Suva_8.324 Chr8 complement(578609..580591) [1983 bp, 660 aa] {ON...    37   0.18 
TPHA0F03370 Chr6 complement(726379..729012) [2634 bp, 877 aa] {O...    37   0.19 
TPHA0C01770 Chr3 complement(403223..405871) [2649 bp, 882 aa] {O...    37   0.19 
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    37   0.19 
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    37   0.20 
TBLA0E02420 Chr5 (600043..604803) [4761 bp, 1586 aa] {ON} Anc_7....    37   0.20 
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    37   0.20 
NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON...    36   0.22 
KAFR0A04140 Chr1 complement(832546..834540) [1995 bp, 664 aa] {O...    37   0.23 
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    37   0.26 
Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa] ...    37   0.26 
ZYRO0F10824g Chr6 complement(883483..884865) [1383 bp, 460 aa] {...    36   0.28 
KNAG0M02260 Chr13 complement(417569..420112) [2544 bp, 847 aa] {...    36   0.32 
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    36   0.33 
KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.2...    35   0.34 
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    36   0.34 
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...    36   0.35 
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    36   0.35 
NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {O...    36   0.37 
KNAG0F03060 Chr6 (582233..583105) [873 bp, 290 aa] {ON} Anc_6.77...    35   0.38 
TPHA0E00390 Chr5 complement(64714..67113) [2400 bp, 799 aa] {ON}...    36   0.42 
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...    36   0.43 
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    36   0.45 
Smik_15.78 Chr15 (135387..144617) [9231 bp, 3076 aa] {ON} YOL081...    36   0.48 
TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON}             35   0.48 
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    35   0.58 
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    35   0.58 
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    35   0.60 
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    35   0.60 
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    35   0.61 
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    35   0.61 
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    35   0.61 
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    35   0.63 
NDAI0H01240 Chr8 complement(298365..299039) [675 bp, 224 aa] {ON...    34   0.71 
TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {O...    35   0.73 
ZYRO0F01188g Chr6 (94085..96631) [2547 bp, 848 aa] {ON} similar ...    35   0.73 
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    35   0.75 
Kpol_1060.43 s1060 (105250..105720) [471 bp, 156 aa] {ON} (10525...    33   0.79 
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    35   0.80 
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    35   0.85 
Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)...    35   0.90 
NCAS0D00140 Chr4 complement(9836..11644) [1809 bp, 602 aa] {ON} ...    35   0.90 
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    35   0.92 
CAGL0G04917g Chr7 complement(470710..472650) [1941 bp, 646 aa] {...    35   0.92 
Kpol_1030.11 s1030 complement(22483..24027,24077..24085,24670..2...    35   0.93 
Suva_13.367 Chr13 (612556..614682) [2127 bp, 708 aa] {ON} YMR186...    35   0.93 
YPL240C Chr16 complement(96496..98625) [2130 bp, 709 aa] {ON}  H...    35   0.93 
NDAI0D04300 Chr4 complement(1008897..1011128) [2232 bp, 743 aa] ...    35   0.94 
TDEL0B06830 Chr2 complement(1208432..1211107) [2676 bp, 891 aa] ...    35   0.97 
Kpol_1065.43 s1065 (113142..115970) [2829 bp, 942 aa] {ON} (1131...    35   0.98 
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...    35   1.0  
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    35   1.0  
KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5....    35   1.0  
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    35   1.1  
TPHA0C01930 Chr3 (438203..439906) [1704 bp, 567 aa] {ON} Anc_8.4...    34   1.2  
TDEL0E03150 Chr5 (592206..594128) [1923 bp, 640 aa] {ON} Anc_5.3...    34   1.2  
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    34   1.2  
NCAS0C01160 Chr3 (214545..217124) [2580 bp, 859 aa] {ON} Anc_8.7...    34   1.3  
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    34   1.3  
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    34   1.3  
TPHA0I01350 Chr9 complement(306732..307271) [540 bp, 179 aa] {ON...    33   1.3  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}              34   1.3  
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    34   1.4  
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    34   1.4  
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    34   1.5  
KAFR0E01370 Chr5 (272717..274522) [1806 bp, 601 aa] {ON} Anc_5.3...    34   1.6  
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    34   1.6  
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    34   1.6  
Skud_15.440 Chr15 complement(777845..779860) [2016 bp, 671 aa] {...    34   1.6  
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    34   1.6  
ZYRO0E03542g Chr5 complement(275553..275912) [360 bp, 119 aa] {O...    32   1.7  
TPHA0N01410 Chr14 complement(310293..312917) [2625 bp, 874 aa] {...    34   1.7  
KAFR0L02090 Chr12 complement(396831..399515) [2685 bp, 894 aa] {...    34   1.7  
TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {O...    34   1.7  
TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {O...    34   1.7  
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    34   1.7  
NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {...    34   1.8  
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    34   1.8  
YOL069W Chr15 (198942..200297) [1356 bp, 451 aa] {ON}  NUF2Compo...    33   1.9  
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    33   2.1  
ZYRO0E07986g Chr5 (623313..625451) [2139 bp, 712 aa] {ON} highly...    33   2.1  
KLLA0D12958g Chr4 complement(1107587..1109728) [2142 bp, 713 aa]...    33   2.1  
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    33   2.1  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    33   2.2  
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    33   2.2  
TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5...    33   2.2  
TPHA0A01140 Chr1 complement(220669..223593) [2925 bp, 974 aa] {O...    33   2.2  
SAKL0B06380g Chr2 complement(545026..548034) [3009 bp, 1002 aa] ...    33   2.2  
TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {...    33   2.3  
NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {...    33   2.3  
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    33   2.3  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    33   2.3  
YMR219W Chr13 (707133..712109) [4977 bp, 1658 aa] {ON}  ESC1Prot...    33   2.3  
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    33   2.4  
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    33   2.4  
YOL081W Chr15 (171070..180309) [9240 bp, 3079 aa] {ON}  IRA2GTPa...    33   2.4  
TBLA0H00180 Chr8 (18713..20887) [2175 bp, 724 aa] {ON} Anc_3.15 ...    33   2.8  
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    33   2.8  
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    33   2.9  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...    33   3.0  
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    33   3.0  
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    33   3.0  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    33   3.0  
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...    33   3.0  
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    33   3.0  
Suva_3.133 Chr3 complement(205980..207068) [1089 bp, 362 aa] {ON...    33   3.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    33   3.0  
YMR294W Chr13 (856966..858087) [1122 bp, 373 aa] {ON}  JNM1Compo...    33   3.1  
KNAG0K00940 Chr11 complement(184711..186111) [1401 bp, 466 aa] {...    33   3.3  
TPHA0B01020 Chr2 complement(232252..233757) [1506 bp, 501 aa] {O...    33   3.4  
CAGL0K03047g Chr11 (284084..284689) [606 bp, 201 aa] {ON} weakly...    32   3.6  
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    33   3.7  
Skud_12.510 Chr12 (908374..910566) [2193 bp, 730 aa] {ON} YLR424...    33   3.7  
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    33   3.8  
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    33   3.8  
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    33   3.9  
NCAS0G04180 Chr7 complement(777741..781058) [3318 bp, 1105 aa] {...    33   3.9  
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    33   3.9  
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    33   4.0  
TPHA0M01490 Chr13 complement(316012..317295) [1284 bp, 427 aa] {...    32   4.3  
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    32   4.3  
TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {O...    32   4.4  
TBLA0B02840 Chr2 (655241..657064) [1824 bp, 607 aa] {ON} Anc_8.7...    32   4.7  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...    32   4.7  
CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} simila...    32   4.8  
TPHA0B02130 Chr2 complement(489226..491211) [1986 bp, 661 aa] {O...    32   4.8  
NCAS0F03030 Chr6 complement(603553..605709) [2157 bp, 718 aa] {O...    32   4.8  
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    32   5.0  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    32   5.0  
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    32   5.0  
SAKL0E12716g Chr5 (1049450..1052215) [2766 bp, 921 aa] {ON} some...    32   5.0  
Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}...    32   5.1  
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    32   5.1  
NCAS0B02720 Chr2 complement(456271..459615) [3345 bp, 1114 aa] {...    32   5.1  
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    32   5.2  
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    32   5.2  
TBLA0C04390 Chr3 (1057279..1061097) [3819 bp, 1272 aa] {ON} Anc_...    32   5.2  
Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL25...    32   5.2  
Suva_16.302 Chr16 (524191..528189) [3999 bp, 1332 aa] {ON} YPL01...    32   5.2  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....    32   5.3  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    32   5.3  
NCAS0F00770 Chr6 complement(155203..155721) [519 bp, 172 aa] {ON...    31   5.4  
Kpol_380.15 s380 complement(26295..27449) [1155 bp, 384 aa] {ON}...    32   5.4  
TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8....    32   5.4  
TBLA0D04480 Chr4 (1109816..1110973) [1158 bp, 385 aa] {ON} Anc_7...    32   5.4  
Skud_15.72 Chr15 (130194..139436) [9243 bp, 3080 aa] {ON} YOL081...    32   5.5  
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    32   5.6  
KLLA0A03938g Chr1 (351240..352502) [1263 bp, 420 aa] {ON} some s...    32   5.6  
KLLA0D02750g Chr4 (233381..234652) [1272 bp, 423 aa] {ON} simila...    32   5.6  
TBLA0A10610 Chr1 (2624948..2626219) [1272 bp, 423 aa] {ON} Anc_2...    32   5.6  
Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W...    32   5.7  
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    32   5.7  
TBLA0H01300 Chr8 complement(292876..293628) [753 bp, 250 aa] {ON...    32   5.8  
KLLA0B10329g Chr2 (902691..904532) [1842 bp, 613 aa] {ON} weakly...    32   6.2  
KNAG0F01680 Chr6 complement(305219..307360) [2142 bp, 713 aa] {O...    32   6.3  
Ecym_4650 Chr4 (1266410..1268584) [2175 bp, 724 aa] {ON} similar...    32   6.4  
TBLA0E03290 Chr5 (824952..827417) [2466 bp, 821 aa] {ON} Anc_5.6...    32   6.5  
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    32   6.5  
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    32   6.6  
TDEL0D05170 Chr4 complement(937328..940216) [2889 bp, 962 aa] {O...    32   6.6  
Skud_13.242 Chr13 (413093..416011) [2919 bp, 972 aa] {ON} YMR086...    32   6.6  
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    32   6.7  
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...    32   6.7  
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    32   6.8  
ZYRO0B00726g Chr2 complement(50044..55824) [5781 bp, 1926 aa] {O...    32   7.0  
Suva_15.85 Chr15 (143843..153082) [9240 bp, 3079 aa] {ON} YOL081...    32   7.2  
Kpol_1071.4 s1071 (9071..9763) [693 bp, 230 aa] {ON} (9071..9763...    31   7.2  
Suva_4.528 Chr4 (911502..912686) [1185 bp, 394 aa] {ON} YBR267W ...    32   7.2  
KAFR0D04980 Chr4 complement(978871..980082) [1212 bp, 403 aa] {O...    32   7.3  
Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}...    32   7.5  
KAFR0K01440 Chr11 (300847..301386) [540 bp, 179 aa] {ON} Anc_3.4...    31   7.6  
Kpol_197.3 s197 complement(7781..9256) [1476 bp, 491 aa] {ON} co...    32   7.7  
KAFR0J02360 Chr10 (448781..450274) [1494 bp, 497 aa] {ON} Anc_6....    32   7.7  
Suva_3.122 Chr3 (180777..181349) [573 bp, 190 aa] {ON} YCR086W (...    31   8.1  
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    32   8.1  
KLTH0D05170g Chr4 (464410..466272) [1863 bp, 620 aa] {ON} weakly...    32   8.1  
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    32   8.2  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    32   8.2  
KLLA0F02123g Chr6 (191154..193190) [2037 bp, 678 aa] {ON} simila...    32   8.3  
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    32   8.3  
TDEL0A06800 Chr1 (1186658..1188781) [2124 bp, 707 aa] {ON} Anc_6...    32   8.3  
TBLA0G01570 Chr7 (415006..417135) [2130 bp, 709 aa] {ON} Anc_6.2...    32   8.3  
KAFR0F00200 Chr6 (54570..55445) [876 bp, 291 aa] {ON} Anc_2.31 Y...    31   8.4  
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...    32   8.4  
YNL079C Chr14 complement(478566..479165) [600 bp, 199 aa] {ON}  ...    31   8.5  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    32   8.5  
SAKL0F05918g Chr6 (444390..446882) [2493 bp, 830 aa] {ON} simila...    32   8.5  
SAKL0D11990g Chr4 complement(994808..997408) [2601 bp, 866 aa] {...    32   8.6  
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    32   8.7  
Skud_7.385 Chr7 (642159..644966) [2808 bp, 935 aa] {ON} YGR089W ...    32   8.7  
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    32   8.8  
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    32   8.8  
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    32   8.9  
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    32   9.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...    32   9.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    32   9.0  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    32   9.2  
KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa...    32   9.2  
KLTH0D03124g Chr4 (301688..302095) [408 bp, 135 aa] {ON} similar...    30   9.4  
KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1...    32   9.5  
TPHA0B04590 Chr2 complement(1080849..1081538) [690 bp, 229 aa] {...    31   9.5  
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    31   9.9  

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
            Anc_3.492 YGR130C
          Length = 629

 Score =  926 bits (2392), Expect = 0.0
 Identities = 498/629 (79%), Positives = 498/629 (79%)
 Frame = +1

Query: 1    MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 180
            MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK
Sbjct: 1    MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60

Query: 181  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 360
            FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL
Sbjct: 61   FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120

Query: 361  HELQKSSRVLVLDEDKNELVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
            HELQKSSRVLVLDEDKNELVL                                       
Sbjct: 121  HELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEE 180

Query: 541  XXXXXXXXXXXXXXXXXXGELDSQNENVSKNAEILEEQSNVVDTEASQHXXXXXXXXXXX 720
                              GELDSQNENVSKNAEILEEQSNVVDTEASQH           
Sbjct: 181  EEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEE 240

Query: 721  XXXXXXQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 900
                  QDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA
Sbjct: 241  EEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 300

Query: 901  SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 1080
            SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED
Sbjct: 301  SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360

Query: 1081 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVD 1260
            EKYNTKKQEYEDKLVELQKQLDD                EIMEYQLVKNVLDVQSKYNVD
Sbjct: 361  EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD 420

Query: 1261 KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 1440
            KGKVIKETELMKLQKINAKEDLLAKQLDV            AITNEYNIWNGNLENLTTL
Sbjct: 421  KGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL
Sbjct: 481  LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHXXXXXXXXXXXXXXX 1800
            PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH               
Sbjct: 541  PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600

Query: 1801 XXXXXXXXXXXXXXHNEEMAEIQKKYQEK 1887
                          HNEEMAEIQKKYQEK
Sbjct: 601  DELLQKKLTELQEKHNEEMAEIQKKYQEK 629

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..31981)
            [2100 nt, 700 aa]
          Length = 699

 Score =  282 bits (721), Expect = 5e-85
 Identities = 148/380 (38%), Positives = 217/380 (57%)
 Frame = +1

Query: 748  VGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAV 927
            V PI+P   PM+ + P        P++++T  I ++  G   SN             +  
Sbjct: 312  VEPINPDEAPMLHMGP------PQPQSSST-GIMAIFKGNSSSN-------------IQP 351

Query: 928  PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 1107
               + ++SPENPEY+++T ++  +SKAVYD++ Y+Q +H  WL N    E+EKY  KK E
Sbjct: 352  VSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTE 411

Query: 1108 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 1287
            YED L ++Q ++D+                E+MEYQLVKN+LD+   +N  K K+ KETE
Sbjct: 412  YEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471

Query: 1288 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 1467
            LMKL+K+NAK+D ++KQ ++             +T+++N WN  L  +T  LD KI  I 
Sbjct: 472  LMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIR 531

Query: 1468 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 1647
            A N+  + I++++  L + K+ LE EIK +EE  K N ++L  LNV K+YLPR+NEID +
Sbjct: 532  AKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNE 591

Query: 1648 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHXXXXXXXXXXXXXXXXXXXXXXXX 1827
            IA + +KL+ IK ETI ENN+L+ILTKKLE+ERIA                         
Sbjct: 592  IAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLA 651

Query: 1828 XXXXXHNEEMAEIQKKYQEK 1887
                 HNEE+ EIQKKY++K
Sbjct: 652  ELKAKHNEELLEIQKKYEKK 671

 Score =  107 bits (266), Expect = 2e-23
 Identities = 47/115 (40%), Positives = 78/115 (67%)
 Frame = +1

Query: 46  GQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVP 225
           G   +   + + +  +  N EY+SPFR+P +   +NYAK+ K ++FPT SA+S+F++M P
Sbjct: 17  GNRSRSHSMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSP 76

Query: 226 GEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
            E+GY +++K+ KRAKDI FP +L+ NE+RQ  ++ +L++KE  L  L+ S  +L
Sbjct: 77  NELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
            Component of the eisosome with unknown function;
            GFP-fusion protein localizes to the cytoplasm;
            specifically phosphorylated in vitro by mammalian
            diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  207 bits (528), Expect = 6e-57
 Identities = 125/387 (32%), Positives = 208/387 (53%), Gaps = 1/387 (0%)
 Frame = +1

Query: 598  ELDSQNENVSKNAEILEEQSNVVDTEASQHXXXXXXXXXXXXXXXXXQDAVGPIDPSIVP 777
            E D++ E    +AE   E+++  +T   +                  ++   PIDPS  P
Sbjct: 318  EGDAEEETEQSSAEESAERTSTPETSEPES-----------------EEDESPIDPSKAP 360

Query: 778  MVRIPPICTDLLSAPKTNATFSI-KSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASP 954
             V          S  +    F++ KS  S +   +KTA               ++ VA+P
Sbjct: 361  KVPFQEP-----SRKERTGIFALWKSPTSSSTQKSKTAAP-------------SNPVATP 402

Query: 955  ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ 1134
            ENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E +KY+ K +EY++KL +LQ
Sbjct: 403  ENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQ 462

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             Q+D+                E+ + +LVK ++DV +++N  K  ++K+TE MK QK+  
Sbjct: 463  NQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQE 522

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 1494
            K ++L KQ +V             +  E+N W  NL NL+  LD +I KI  IN    ++
Sbjct: 523  KNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKV 582

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLA 1674
            Q +I+ L+ KK +L  + +++++  + N  VL+ +   K+YLP++N+ID QI++  +++ 
Sbjct: 583  QNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVE-NKEYLPQINDIDNQISSLLNEVT 641

Query: 1675 IIKNETISENNQLSILTKKLEEERIAH 1755
            IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 642  IIKQENANEKTQLSAITKRLEDERRAH 668

 Score =  100 bits (250), Expect = 2e-21
 Identities = 54/126 (42%), Positives = 78/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query: 49  QEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN---YAKSLKEKKFPTTSATSNFNK 216
           QE    FL + +S + +  E ++SPFR      R N   Y +  K +KFPT SATS ++K
Sbjct: 32  QESPYQFLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSK 91

Query: 217 MVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 396
             P ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  L
Sbjct: 92  QQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDL 151

Query: 397 DEDKNE 414
            +D+ +
Sbjct: 152 TKDEKD 157

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
            YGR130C (REAL)
          Length = 839

 Score =  200 bits (508), Expect = 4e-54
 Identities = 118/334 (35%), Positives = 184/334 (55%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 933
            PIDPS  P V            P        K+ I     S+ ++ A  SN     A P 
Sbjct: 376  PIDPSKAPKV------------PFQERPRKGKTGIFALWKSSTSSSAQKSN----TAAP- 418

Query: 934  THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 1113
            ++ VA+PE PE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K +EYE
Sbjct: 419  SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            +KL +LQ Q+D+                E+ + +LVK ++DV + +N  K  + K+TE M
Sbjct: 479  EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
            K QK+  K  +L KQ +V             +  ++N W  NL NL+  LD +I KI  I
Sbjct: 539  KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598

Query: 1474 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA 1653
            N    ++Q +I+ L+ KK  L  + +++E+  + N  VL+ +   ++YLP++N+ID QI+
Sbjct: 599  NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREYLPQINDIDNQIS 657

Query: 1654 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
               +++ IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 658  TLLNEMTIIKQENANEKTQLSAITKRLEDERRAH 691

 Score = 97.8 bits (242), Expect = 2e-20
 Identities = 54/125 (43%), Positives = 78/125 (62%), Gaps = 5/125 (4%)
 Frame = +1

Query: 49  QEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN----YAKSLKEKKFPTTSATSNFN 213
           + P Q FL + +S + +  E +ISPFR      + N    Y +  K +KFPT SATS ++
Sbjct: 33  ENPYQ-FLQKVVSNEPKGKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYS 91

Query: 214 KMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLV 393
           K  P ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  
Sbjct: 92  KQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITD 151

Query: 394 LDEDK 408
           L +D+
Sbjct: 152 LTKDE 156

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
            YGR130C (REAL)
          Length = 831

 Score =  199 bits (505), Expect = 9e-54
 Identities = 102/286 (35%), Positives = 170/286 (59%)
 Frame = +1

Query: 898  ASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAE 1077
            +S+   G A    + VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E
Sbjct: 398  SSSAKKGAATAPLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRARE 457

Query: 1078 DEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNV 1257
              KY+ K  EY++KL +LQ Q+D+                E+ + +LVK ++D+ +++N 
Sbjct: 458  KAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNN 517

Query: 1258 DKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTT 1437
             K  + K+TE MK QK+  K ++L KQ +V             +  E+N W  NL +L+ 
Sbjct: 518  KKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQ 577

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
             LD +I KI  IN    + Q +I+ L+ +K +L  + +++++  + N +VL+ +   K+Y
Sbjct: 578  QLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVE-NKEY 636

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            LP++N+ID QI+   +++ II+ E  +E   LS +TKKLE+ER AH
Sbjct: 637  LPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAH 682

 Score = 97.8 bits (242), Expect = 2e-20
 Identities = 55/128 (42%), Positives = 78/128 (60%), Gaps = 6/128 (4%)
 Frame = +1

Query: 49  QEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNF 210
           QE    FL + +S + +  E ++SPFR  QD +  N     Y    K +KFPT SATS +
Sbjct: 30  QEKPYQFLQKVVSNEPKGKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPY 87

Query: 211 NKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
           +K  P ++GY ++ K+ KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++ 
Sbjct: 88  SKQQPQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKIT 147

Query: 391 VLDEDKNE 414
            L  D N+
Sbjct: 148 DLTGDAND 155

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
            YGR130C (REAL)
          Length = 807

 Score =  197 bits (501), Expect = 2e-53
 Identities = 123/336 (36%), Positives = 185/336 (55%), Gaps = 2/336 (0%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 933
            PIDPS  P V            PK   T  I +L      S+  A+ G      GV  P 
Sbjct: 344  PIDPSKAPKVPFK-------ERPKKERT-GIFALWKSPTSSS--AQKG------GVTAP- 386

Query: 934  THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 1113
            ++ VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+     Y 
Sbjct: 387  SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYS 446

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            ++L +LQ Q+D+                E+ + +LVK ++DV + +N  K  + K+TE M
Sbjct: 447  ERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENM 506

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
            K QK+  K+++L KQ  V             +  E+N W  NL NL+  LD +I KI  I
Sbjct: 507  KNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQI 566

Query: 1474 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDEQ 1647
            N    ++Q +I+ LQ KK   E+ I   EE  KL++  +Q L +VE K+YLP++N+ID Q
Sbjct: 567  NLKQSKVQNEIDALQKKK---EDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQ 623

Query: 1648 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            ++   +K+ II+ E  +E  +LS +TK+LE+ER AH
Sbjct: 624  VSTLLNKMTIIRQENANEKTELSAITKRLEDERRAH 659

 Score = 98.6 bits (244), Expect = 1e-20
 Identities = 55/128 (42%), Positives = 78/128 (60%), Gaps = 6/128 (4%)
 Frame = +1

Query: 49  QEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNF 210
           +E    FL + +S + +  E ++SPFR  QD +  N     Y    K KKFPT SATS +
Sbjct: 32  EEKPYQFLQKVVSNEPKGKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAY 89

Query: 211 NKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
           +K  P ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L++  ++ 
Sbjct: 90  SKQQPKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKIT 149

Query: 391 VLDEDKNE 414
            L  D N+
Sbjct: 150 DLTSDGND 157

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
            YGR130C
          Length = 692

 Score =  178 bits (452), Expect = 3e-47
 Identities = 106/336 (31%), Positives = 176/336 (52%), Gaps = 2/336 (0%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 933
            PIDP++ PMV                      SL +  + S K  +A           PE
Sbjct: 235  PIDPALAPMVPF--------------------SLATPNQKSKKETEA-----------PE 263

Query: 934  --THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 1107
              ++ VASP N E +V+T ++  +SKAVYD++ Y+++ H +WL ++   ++EKY  K QE
Sbjct: 264  KPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQE 323

Query: 1108 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 1287
            Y+  L ++  Q+ +                ++M  QLVK V D +     DK K+  ET+
Sbjct: 324  YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETK 383

Query: 1288 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 1467
             +KL+K++ KE++L    +V             + +EY+ W  N+ N+ + LD K+ KI 
Sbjct: 384  QIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKIS 443

Query: 1468 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 1647
             IN   M +Q  I+ L  +K NL++EI  ++     N  +++ ++  K+YLP+LN+ID +
Sbjct: 444  QINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVD-NKEYLPKLNDIDNE 502

Query: 1648 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            I    +++ I+K E  +E  QL+ +TKKLE+ER AH
Sbjct: 503  INGLLNQMTIVKQENANEKVQLAEITKKLEDERRAH 538

 Score = 72.0 bits (175), Expect = 2e-12
 Identities = 39/98 (39%), Positives = 57/98 (58%)
 Frame = +1

Query: 103 TEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 282
           ++Y SPFR     V     ++ K ++FPT SATSN+    P + G++++ K    AKDI 
Sbjct: 71  SDYASPFRAEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127

Query: 283 FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 396
           FP YL +NE+RQ   L+ L+ KE  L  LQ S  ++ L
Sbjct: 128 FPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDL 165

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar to
            uniprot|P53278 Saccharomyces cerevisiae YGR130C Protein
            of unknown function green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm in a
            punctate pattern
          Length = 773

 Score =  178 bits (452), Expect = 7e-47
 Identities = 93/271 (34%), Positives = 155/271 (57%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            +A+P++PEY+VRT++   +SKA+YD++ Y++++H   L  FN  + +KY+  ++EY DKL
Sbjct: 351  LATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKL 409

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
              LQ Q+D+                ++ E +L K +LD+ + +   K  + KETE +K Q
Sbjct: 410  TLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQ 469

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            KI  ++++ AK  +V             +  E+N +   L++LT  LD K+ KI+ +N+ 
Sbjct: 470  KIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDK 529

Query: 1483 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
             M I   I  L  KKL +E E +D EE  K +  +L+ +   K+YLP++N ID Q+A   
Sbjct: 530  QMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLL 588

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEERIAH 1755
              L +IK E  ++  + + +TK+LEEER AH
Sbjct: 589  GSLTLIKQENANQKTEFAAITKRLEEERKAH 619

 Score = 73.6 bits (179), Expect = 8e-13
 Identities = 45/136 (33%), Positives = 74/136 (54%), Gaps = 3/136 (2%)
 Frame = +1

Query: 16  DTFTVLEDHPGQEPQQTFLTRHISRKS---ENTEYISPFRNPQDTVRSNYAKSLKEKKFP 186
           D F  L      + Q  FL + ++ K    E  +Y SPFR+ Q+ +    AK++K KKFP
Sbjct: 11  DPFAHLLQPEQPQEQPNFLRKVVTNKKKEEEEKDYSSPFRSQQELIA---AKNVKAKKFP 67

Query: 187 TTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHE 366
           T SATS        ++GY  +    +RAKDI  P+YL + +++Q + L +L+ KE+ L  
Sbjct: 68  TVSATSGTASAA--DLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQY 125

Query: 367 LQKSSRVLVLDEDKNE 414
           L+ S +++ + +   E
Sbjct: 126 LKDSQKIVDVRKKNKE 141

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
            to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  178 bits (451), Expect = 1e-46
 Identities = 99/275 (36%), Positives = 150/275 (54%), Gaps = 4/275 (1%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            +A+PENPE + +T EY  +SK +YD++ Y++  H  WLK F  +E  KY+ K +EY ++L
Sbjct: 419  IATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNEL 478

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
             ELQK++D                 E+ E  LVK + +  + +N  K K+ KETE +K Q
Sbjct: 479  EELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQ 538

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            KI  K+++L K   V             +  E++ W  N+  L   LD KI K+  I   
Sbjct: 539  KIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMK 598

Query: 1483 NMRIQKDIEVLQVKKLNLENEI----KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQI 1650
                QK+IE L+ +K   + +I    K+HEE  K+ +         K+YLP+++ ID QI
Sbjct: 599  QDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESY-----ENKEYLPKIHTIDNQI 653

Query: 1651 AAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            +   ++LAIIK E  +E  +LS +TK+LEEER AH
Sbjct: 654  SELLNELAIIKQENANEQTELSKITKELEEERRAH 688

 Score = 82.4 bits (202), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 2/106 (1%)
 Frame = +1

Query: 85  SRKSENTEYIS--PFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKN 258
           S  S+N + I+  PF N     +  Y K+ K+ KFPT SATS      P E+G+ +L K+
Sbjct: 94  SSDSDNEQKIAVNPFTN-----KPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKS 148

Query: 259 DKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 396
            KRAKDI+FP YL +NE RQ  +L EL++KE KL  L+ S +++ L
Sbjct: 149 TKRAKDIKFPVYLTENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
            YGR130C
          Length = 656

 Score =  167 bits (424), Expect = 1e-43
 Identities = 107/334 (32%), Positives = 170/334 (50%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 933
            PIDP + PMV         LS P  N               NK  K   + +       E
Sbjct: 190  PIDPKLTPMVSFQ------LSTPPVN---------------NKNKK---TQVVPEEEEKE 225

Query: 934  THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 1113
             +  A+P + E +V+T ++ I+SK++YDQ+ Y+Q+ H ++L ++ A   EKY+ K QEYE
Sbjct: 226  RNPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYE 285

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            ++L  L +++                  +IM  +LVK + D +S    DK K+  ET+L+
Sbjct: 286  NELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLI 345

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
            K +KI+ K ++      V             + +E+N W  N+ N+   LD K+ KI+ I
Sbjct: 346  KREKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQI 405

Query: 1474 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA 1653
            N   M +Q  I+ L  +KL L  EI+ ++     N + ++ ++  K YLP+LN ID QI 
Sbjct: 406  NITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYLPKLNNIDSQIN 464

Query: 1654 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
               ++L +IK E  +E  QLS LT+KLE+ER+ H
Sbjct: 465  DLLNQLTLIKQENANEKIQLSELTQKLEKERMDH 498

 Score = 77.0 bits (188), Expect = 6e-14
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 1/120 (0%)
 Frame = +1

Query: 58  QQTFLTRHISRKSENTE-YISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEM 234
           Q+T  T   S+K  +TE Y+SPFR+   T    Y ++ K K+FPT SATSN+      EM
Sbjct: 50  QKTPTTSSSSKKKVSTEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEM 109

Query: 235 GYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNE 414
           G+  + K+   AKDI FP YL  NE+RQ   L +L   E  L   + S  ++ L +  ++
Sbjct: 110 GFKKIPKDKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQ 169

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
            similar to uniprot|P53278 Saccharomyces cerevisiae
            YGR130C Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern
          Length = 994

 Score =  155 bits (391), Expect = 1e-38
 Identities = 98/334 (29%), Positives = 166/334 (49%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 933
            P+D + VP V         ++ P+     SI S+    K S   A               
Sbjct: 450  PVDYAAVPRV---------VTFPEVEKKRSIFSIFGRKKKSQNRAP-------------- 486

Query: 934  THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 1113
             + +A+PENPE LV+T+    +SKAVYD++ YE   HSEWL  F ++E ++Y  K+ +Y+
Sbjct: 487  -NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYD 545

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            ++L EL+K+++                 EI   +L K  L+   +Y   K  +  ET+ +
Sbjct: 546  NRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAI 605

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
            + QK    +++  +Q +V             I  E+  W   L + +  LD K+  +  +
Sbjct: 606  QDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTL 665

Query: 1474 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA 1653
             + + + Q  I+ L  KK  LE E+  H+E    N   ++K +  K+YLP+++EID++I+
Sbjct: 666  QQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK-HANKEYLPKVHEIDDKIS 724

Query: 1654 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
                +L++IK E+ +E  +L  +TKKLE ER AH
Sbjct: 725  NLLGELSVIKQESANEKLKLGSITKKLESERQAH 758

 Score = 83.6 bits (205), Expect = 7e-16
 Identities = 49/120 (40%), Positives = 71/120 (59%), Gaps = 3/120 (2%)
 Frame = +1

Query: 37  DHPGQEPQQTFLTRHISRKSENTEYISPFR---NPQDTVRSNYAKSLKEKKFPTTSATSN 207
           D   + P     +R  +RKS   E+ SPFR   N +D      A+  + ++FPT S  S 
Sbjct: 45  DRAEKSPSIKSSSRASARKSHLGEFASPFRLESNEKD------AEKRRLQRFPTVSPNSV 98

Query: 208 FNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRV 387
           F+K+ P E+GY ++ +  +RAKDIQFP YL +NE RQ QLL E++I+E KL  ++ S  V
Sbjct: 99  FSKVHPKELGYRTMGRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIV 158

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa] {ON}
            weakly similar to uniprot|P53278 Saccharomyces cerevisiae
            YGR130C Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern
          Length = 836

 Score =  149 bits (376), Expect = 6e-37
 Identities = 86/267 (32%), Positives = 140/267 (52%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            VASP +PE++V+ ++   +SKA+YD + YE+ +H   + ++    D KY  K  EYED+L
Sbjct: 377  VASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
              L+ Q+ +                EI E +L   ++D+ ++++  K  + KETE MK  
Sbjct: 436  TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAA 495

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            K+  KE + AKQ DV             I  E     G ++ LT  LD K+A I+ +N  
Sbjct: 496  KVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555

Query: 1483 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
               +Q  I+ LQ +K  L +E    +E+   N  VL+ +   K+YLP+LN ID +I+   
Sbjct: 556  QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEYLPKLNAIDTKISELL 614

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEE 1743
              L ++K ET +   + + ++K+LEEE
Sbjct: 615  TSLTVVKQETANHKTEFAAVSKRLEEE 641

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 39/108 (36%), Positives = 61/108 (56%)
 Frame = +1

Query: 67  FLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSS 246
           FL + +S++ E + Y SPFR  Q       A+  K +KFPT SA+ + +     +MGY  
Sbjct: 27  FLHKVVSKEQEQSAYNSPFRTSQSLAA---AQKRKMQKFPTVSASVSAHSS--SDMGYKV 81

Query: 247 LAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
           +    +RAKDI  P+YL  N++RQ + L +L+ KE  L   + S R++
Sbjct: 82  IDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] {ON}
            Anc_3.492 YGR130C
          Length = 700

 Score =  148 bits (374), Expect = 6e-37
 Identities = 77/276 (27%), Positives = 148/276 (53%)
 Frame = +1

Query: 928  PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 1107
            P  +  A+PENPE++V+T +   ++K +YD++  + + H+EW+  +   E +K++ K+ E
Sbjct: 337  PVPNPPATPENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAE 395

Query: 1108 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 1287
               K+  L+ Q+ +                E+ E +L +   ++   +   K +V K+TE
Sbjct: 396  SNRKINSLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTE 455

Query: 1288 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 1467
            ++K QK++ K+ +L KQ +V             +  E   W  ++E L+  +D K+A +E
Sbjct: 456  VIKSQKLSEKDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLE 515

Query: 1468 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 1647
             +N      Q++I  LQ +K+++ ++I+ +      N+ V++     K YLP+LNE+D Q
Sbjct: 516  EVNVKQKNTQEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQ 574

Query: 1648 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            I+    +L  I+    +E  +LS +TKKL++ER+ H
Sbjct: 575  ISVLLGQLTTIRQHCANERTELSAITKKLDKERLEH 610

 Score = 80.1 bits (196), Expect = 7e-15
 Identities = 42/103 (40%), Positives = 63/103 (61%)
 Frame = +1

Query: 106 EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 285
           +Y+SPFR+ Q+ +    A+  + ++FPTTSA S +    P E+GY  +   +KRAKDI F
Sbjct: 39  DYVSPFRDEQEVLS---AQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95

Query: 286 PKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNE 414
           P YL + EK+Q +LL EL++KE  L  L+    V  + E + E
Sbjct: 96  PVYLEEIEKKQLELLRELEVKEAHLRYLKDCQVVTEVKEKEKE 138

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa] {ON}
            weakly similar to uniprot|P53278 Saccharomyces cerevisiae
            YGR130C Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern
          Length = 871

 Score =  142 bits (358), Expect = 1e-34
 Identities = 95/337 (28%), Positives = 162/337 (48%), Gaps = 3/337 (0%)
 Frame = +1

Query: 754  PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAG--ASNMTLGVAV 927
            P D +  P V   P   +        +  +   L +  K S K   +   A+N   G  V
Sbjct: 379  PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 928  PETHA-VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 1104
            P   A VA+PE+PE +VRT E   VSK+VYD++ Y++  H   L  ++  +DE+Y TK Q
Sbjct: 439  PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497

Query: 1105 EYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKET 1284
            EYE+K+  +Q ++ +                ++ + +  + +L+   K+   KG + K+T
Sbjct: 498  EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557

Query: 1285 ELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKI 1464
            E +K Q I+ KED       V             +  E       +E LT  LD K + +
Sbjct: 558  EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617

Query: 1465 EAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDE 1644
                        +I+ L+ +K  LE EIK+ +E  + N   ++ ++  K+YLP++NEI+ 
Sbjct: 618  NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID-NKEYLPKVNEINT 676

Query: 1645 QIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            +I++    L +I+ E  ++  + S +T++LEEER  H
Sbjct: 677  EISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQH 713

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 45/141 (31%), Positives = 72/141 (51%), Gaps = 14/141 (9%)
 Frame = +1

Query: 37  DHPGQEPQQTFLTRHIS-------------RKSENTEYISPFRNPQDTVRSNYAKSLKEK 177
           DH  ++ QQ  LT   S              + ++ EY SPFR  ++T R   A+ ++++
Sbjct: 24  DHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSPFRTAEETQR---ARQVRQE 80

Query: 178 KFPTTSATSNFNKMVPGEMGYSSLA-KNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEH 354
           KFPT S      ++ P +MGYS +  K+ K+AKDI  P  L D E  Q   L  L+ KE 
Sbjct: 81  KFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEK 138

Query: 355 KLHELQKSSRVLVLDEDKNEL 417
           +L   +KS +++ L + +  +
Sbjct: 139 QLRYWRKSQKIVDLTKPQEAI 159

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
            YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  135 bits (339), Expect = 2e-32
 Identities = 78/267 (29%), Positives = 139/267 (52%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            VASP++PE++V+ ++   +SKA+YD + YE+ +H + +  +     +KY+ K QEYED L
Sbjct: 349  VASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
              L+ Q+ +                 I   +L   +++  +K++  K  + KETE  K  
Sbjct: 408  TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            KI+ K  ++AKQ +V                        ++ LTT LD K + I+ +N+ 
Sbjct: 468  KIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQ 527

Query: 1483 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
               IQ  I+ L+ +K  L  +    +E    N  +L+ ++  KDYLP++N +D QI+   
Sbjct: 528  QAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGIS-NKDYLPKINALDSQISQLL 586

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEE 1743
              LA++K ET +++ + + ++K+LEEE
Sbjct: 587  SSLALVKQETANQHTEFAAVSKRLEEE 613

 Score = 76.6 bits (187), Expect = 9e-14
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 2/130 (1%)
 Frame = +1

Query: 7   KRKDTFTVL--EDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 180
           K+ D F  L  +D P +E  + FL + ++++ E+  Y SPFR  Q  V    A+  K ++
Sbjct: 4   KKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVE---AQKRKVQR 60

Query: 181 FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 360
           FPT SA+S  N     EMG+  +    KRAKDI  P+YL  N++RQ + L +L+ KE  L
Sbjct: 61  FPTVSASSGGNSSA--EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSL 118

Query: 361 HELQKSSRVL 390
              + S +++
Sbjct: 119 QYKKDSQKIV 128

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
            Anc_3.492 YGR130C
          Length = 563

 Score =  114 bits (285), Expect = 6e-26
 Identities = 78/269 (28%), Positives = 134/269 (49%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            VASPEN E +V+      +SK VYD++ ++ K++ +++  +   +  K N  K EY +K+
Sbjct: 248  VASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKI 307

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
              +Q +                   E+++ +LVKN++D  + ++ +K K++++T  +KLQ
Sbjct: 308  KSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQ 367

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            K+N  + L  K+  +            +    +N  N +L  +   LD K+ K+   N  
Sbjct: 368  KLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIR 427

Query: 1483 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
            N  ++ +I  LQ KK  L +EI D  E  KL+ D       +      LNE+DEQI +K 
Sbjct: 428  NENLEHEINKLQSKKQTLLDEI-DSIEYKKLHPD-------DDSKQLELNEMDEQINSKL 479

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEERI 1749
              L +IK E I+E  ++S LT  L  + I
Sbjct: 480  SNLNLIKQEIINEKLKISKLTNDLNLQLI 508

 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 1/111 (0%)
 Frame = +1

Query: 73  TRHISRKSENTEYISPFRNPQDT-VRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSL 249
           T       +  +Y SPFRN   +  +    + LK  KFP  SATS +N        Y  L
Sbjct: 39  TNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDV--YKDL 96

Query: 250 AKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDE 402
                 A+DI+FP  L+DNE RQ Q+L++L+IK+  L  L+ S +V+ +++
Sbjct: 97  DPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDVED 147

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
            YGR130C
          Length = 757

 Score =  114 bits (286), Expect = 9e-26
 Identities = 72/285 (25%), Positives = 134/285 (47%), Gaps = 1/285 (0%)
 Frame = +1

Query: 895  GASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAA 1074
            G S     +  P T+  A+ + PE L++  +Y  VS AV++++ Y+ K+H   + ++   
Sbjct: 283  GVSTKQRLMDTPVTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQRE 342

Query: 1075 EDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYN 1254
            ++ K+  K QEYE KL ++  +                   E++E Q +K + D  + +N
Sbjct: 343  QESKFAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFN 402

Query: 1255 VDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLT 1434
              K KV+ E +L+KLQK+   + +  K+  +                +Y++W  NL N+T
Sbjct: 403  DSKVKVLHEAQLVKLQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNIT 462

Query: 1435 TLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE-EKDKLNKDVLQKLNVEK 1611
              LD ++ K+   N    +I + I  L  +K  LE EI  ++  K   ++++      + 
Sbjct: 463  ERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQH 522

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
                 L ++ + I  K D LA++K E   E  +L  +T ++E  R
Sbjct: 523  LKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 80.9 bits (198), Expect = 4e-15
 Identities = 44/96 (45%), Positives = 60/96 (62%), Gaps = 1/96 (1%)
 Frame = +1

Query: 106 EYISPFRNPQDTVRSNYAKSLKE-KKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 282
           EY+SPFR  Q T  S     L+  KKFPT SATS +N     E+G+S +  + +RA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 283 FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
           FP+YLL+NE RQ  +L +L+ +E  L  LQ+   VL
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
            Ashbya gossypii AFR310C
          Length = 727

 Score =  103 bits (258), Expect = 2e-22
 Identities = 69/292 (23%), Positives = 138/292 (47%)
 Frame = +1

Query: 862  GAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKL 1041
            G +G  K +K G   +      PE    A+PE+PE++V T E   +SK +YD++ YE++L
Sbjct: 296  GHRGPFKFSKKGIFALWKRSEKPEK-LNATPEDPEFIVLT-EKGYMSKNIYDRLEYEEEL 353

Query: 1042 HSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLV 1221
            H E L + +     KY    + YE+KL  L  ++ +                + +E  L 
Sbjct: 354  HQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLS 413

Query: 1222 KNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEY 1401
            +N++D+Q+K++  K  ++KE E  K  KI  K  +  K   V                E 
Sbjct: 414  QNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVEL 473

Query: 1402 NIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
              +   ++ LT  LD ++ +++ +++    +   +  L+ +++ +E +I +       NK
Sbjct: 474  QQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNK 533

Query: 1582 DVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
            ++LQ L    +  P +  +D Q++     ++ ++ E  ++ ++L+ L+ K E
Sbjct: 534  ELLQNL----ENHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581

 Score = 39.7 bits (91), Expect = 0.027
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = +1

Query: 106 EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKR-AKDIQ 282
           EY+SPFR+ +       A+ +++ KFPTT           G      +  N KR A+DI 
Sbjct: 56  EYVSPFRDDKAVAE---AERIRDLKFPTT-----------GHHSTVRVKDNVKRKAQDIA 101

Query: 283 FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 390
            P+     + +Q + L EL +KE++L  L+ S +++
Sbjct: 102 EPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIV 137

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 91.7 bits (226), Expect = 1e-18
 Identities = 63/262 (24%), Positives = 121/262 (46%), Gaps = 1/262 (0%)
 Frame = +1

Query: 949  SPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVE 1128
            +PE PE ++ TN    +SKAVYD++N E+K H   L N +    + Y    Q YE ++ +
Sbjct: 282  TPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIAD 340

Query: 1129 LQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKE-TELMKLQK 1305
            L  ++                  + +E  L KN+ D++++ N DK  V+ E  E  + ++
Sbjct: 341  LDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHEQAEAQRAEQ 399

Query: 1306 INAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 1485
            +  KE+++ +  ++                E       ++ L   LD +  ++  + +  
Sbjct: 400  LADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQ 459

Query: 1486 MRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 1665
              +   +  LQ +K  LE E+ D  E  K N++ L++LN + DY   + EID + +    
Sbjct: 460  AEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEILT 518

Query: 1666 KLAIIKNETISENNQLSILTKK 1731
            ++A I+ E   +  +L  L ++
Sbjct: 519  EIAKIRQEIEFQRKELVALKER 540

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 83.6 bits (205), Expect = 6e-16
 Identities = 44/113 (38%), Positives = 68/113 (60%)
 Frame = +1

Query: 61  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 240
           QT +  H +   +  +Y SPFR+ Q     N A   K  ++PT SATS ++ M P ++GY
Sbjct: 41  QTAINSH-TLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGY 99

Query: 241 SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLD 399
            ++  + KRAKDI FP  L++NE RQ +L  +L  KE +L  LQKS +++ ++
Sbjct: 100 KNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVE 152

 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 47/196 (23%), Positives = 89/196 (45%), Gaps = 6/196 (3%)
 Frame = +1

Query: 946  ASPENPEYLVRTNEYN---IVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYED 1116
            A+P+NPE LV+T   N   I+SK+VYD +NY  K+H++ +K++    + KY  K +E+ +
Sbjct: 379  ATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNN 438

Query: 1117 KLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQS---KYNVDKGKVIKETE 1287
             + EL  ++                   +M   + KN +D+++   K  + K ++IK+ +
Sbjct: 439  SINELDLKIKS---IEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKND 495

Query: 1288 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 1467
             +    + +     A  LD              I +    W      L   +D K+  I+
Sbjct: 496  EI-TYILQSSPPTAAISLDTKDAVTKQSDCTPLIKD----WKSEQSKLNEQIDSKVNVIK 550

Query: 1468 AINENNMRIQKDIEVL 1515
             +N+N   +++ I  L
Sbjct: 551  QLNKNLADVKQKITEL 566

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 72.8 bits (177), Expect = 5e-13
 Identities = 44/127 (34%), Positives = 68/127 (53%), Gaps = 3/127 (2%)
 Frame = +1

Query: 34  EDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFN 213
           E    + P + FL   I+    + +Y SPFR   +    NY +  K  K+  T+  S+FN
Sbjct: 17  EQERAKNPHRNFLKDTIAH---DAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFN 73

Query: 214 KMVPGEMGYSSLA---KNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSR 384
           K+    +GY ++    K+ K AKDI FP+ L +NE+ Q   L EL+ KE+ L  L+ S  
Sbjct: 74  KLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQN 133

Query: 385 VLVLDED 405
           ++ +DED
Sbjct: 134 LVYIDED 140

 Score = 58.5 bits (140), Expect = 2e-08
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 4/127 (3%)
 Frame = +1

Query: 937  HAVASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 1104
            +++A+P+N E ++   + +      SK V+D + YE K+H + LK  NA  DE++ +K  
Sbjct: 183  NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242

Query: 1105 EYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKET 1284
            EY+ ++  L  ++D                 +  +++  KN L   ++YN  K ++  E 
Sbjct: 243  EYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEI 302

Query: 1285 ELMKLQK 1305
            E +K Q+
Sbjct: 303  EAIKNQR 309

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 57.0 bits (136), Expect = 4e-08
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +1

Query: 169 KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIK 348
           K K  P ++  S++N + P E+GY       K A++I FP  L +NE RQ  +L +L  K
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAILQDLDEK 67

Query: 349 EHKLHELQKSSRVLVLDE--DKNELV 420
           E  L  L+KS RV+ +D+  +K ++V
Sbjct: 68  EQHLDHLKKSQRVVYIDKPVEKEDVV 93

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKA----VYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 1110
            VA+PE PE +V     N  +KA    ++D +  +   H+ WL +     +++  TK +EY
Sbjct: 122  VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181

Query: 1111 EDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 1287
              +L  L  Q+                  ++ E +L K  L    ++  +K K+ KETE
Sbjct: 182  NKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETE 240

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 7/135 (5%)
 Frame = +1

Query: 937  HAVASPENPEYLVRT--NEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 1110
            + +A+P+NPE LV+   N+  IVSK  YD++   Q  H  WLK++NA     YN + Q Y
Sbjct: 179  YPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWY 238

Query: 1111 EDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQ-LVK----NVLDVQSKYNVDKGKVI 1275
            + ++  L +++                  EI + + LVK    N L  + K  + K +  
Sbjct: 239  QKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKNRNY 298

Query: 1276 KETELMKLQKINAKE 1320
             +TE++KL++   +E
Sbjct: 299  LQTEIIKLKEQEERE 313

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] {ON} 
          Length = 681

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/74 (32%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = +1

Query: 928  PETHAVASPENPEYLVRTNE-YNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 1104
            P+ + +A+  NPE L++ N+   I++K  YD++    + H+ W+ N N      YNTK +
Sbjct: 380  PQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439

Query: 1105 EYEDKLVELQKQLD 1146
             Y++KL +L +Q++
Sbjct: 440  TYQEKLNKLNEQIN 453

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 38/172 (22%), Positives = 81/172 (47%), Gaps = 20/172 (11%)
 Frame = +1

Query: 1291 MKLQKINAKEDLLAKQLDVXXXXXXXXXXXXA---------------ITNEYNIWNGNLE 1425
            ++L+KIN   + L K+ D             A               +  +  I+  + +
Sbjct: 80   LQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQ 139

Query: 1426 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNV 1605
            ++  LL+EKI  +EA  +   ++ ++ + L+ + L LENE++  +  D   K  +Q+L  
Sbjct: 140  DVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQ 199

Query: 1606 EKDYLPRLNE-IDEQIAAKFDKLAIIKNETISE----NNQLSILTKKLEEER 1746
            E + L   N+ +++++A+K ++    +    SE     ++L+ +  +LE ER
Sbjct: 200  EMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIER 251

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 56/268 (20%), Positives = 109/268 (40%), Gaps = 10/268 (3%)
 Frame = +1

Query: 979  TNEYNIVSKAVYDQMNYEQKLHSEWLKNFNA--AEDEKYNTKKQEYEDKLVELQKQLDDX 1152
            + ++ +  + V D++   +K H   L N N   ++ EK  ++   YE+++ +L + +   
Sbjct: 408  SEKWKLSHEEVNDKLQALEKDHQAVLNNLNQLISDKEKLGSELSSYENQVKDLNENIHSL 467

Query: 1153 XXXXXXXXXXXXXXXEIMEY----QLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKE 1320
                           E  EY    Q +++ L  QS    D  K ++ET L K++  +  +
Sbjct: 468  EEKDKLNSNKLETITE--EYKTLQQKLQDTLSQQSGTTNDLNKQLEETRLAKIEVESQLD 525

Query: 1321 DLLAKQL-DVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL---LDEKIAKIEAINENNM 1488
            +L    + +              + N   + +  L   T+L   L EKI  IE + + N 
Sbjct: 526  ELKTSSISEKETLEIKLKETEQQLENNTKLVDELLAKKTSLETELHEKINSIELLKKQNT 585

Query: 1489 RIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDK 1668
                D E+ + +   L+ EI+  +EK+ +  D + K          L +  E+   K+  
Sbjct: 586  ESNDDSEINKAQVGQLKIEIQALKEKEMVLNDSINK----------LEDKTEEWKMKYQD 635

Query: 1669 LAIIKNETISENNQLSILTKKLEEERIA 1752
                 ++   E   L +  K +EEE +A
Sbjct: 636  KCSDLDKNRLEVESLQMKCKNMEEEHLA 663

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 60/262 (22%), Positives = 116/262 (44%), Gaps = 16/262 (6%)
 Frame = +1

Query: 997  VSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXX 1176
            + KA+++  N E          F+  + +K NT+     DK++  +KQ  D         
Sbjct: 218  IQKAIFETTNEETH-------RFDDMKADKKNTESNS--DKVITPEKQTRDDTPNLNKLT 268

Query: 1177 XXXXXXXEIMEYQLVKNVLDVQSKYNVDKG---KVIKETE---LMKLQKINAKEDL-LAK 1335
                    I     + ++ + + KY +D+    KVI E     + ++  +N + ++ L+ 
Sbjct: 269  PLYNTDLAIS--MQLNHLEENKKKYVIDEHNSFKVISERNKDLIAQINNLNKELNISLSA 326

Query: 1336 QLDVXXXXXXXXXXXXAITNEY----NIWNGNLENLTTLLDEKIAKIEAINENNMRIQKD 1503
            Q                ++ +Y    NI    +EN+ T  + +  KI+ + +     + +
Sbjct: 327  QEQTIYNFKLLKAEYDGLSEKYETKINITAEEMENIQTERENQNRKIDKLKKKISEYKDE 386

Query: 1504 IEVL-QVKKL--NLENEIKDHEEKDKL-NKDVLQKLN-VEKDYLPRLNEIDEQIAAKFDK 1668
            I +L Q +K+  N  N+  D  EK KL +++V  KL  +EKD+   LN +++ I+ K +K
Sbjct: 387  ISMLNQNQKILQNKYNQTSDESEKWKLSHEEVNDKLQALEKDHQAVLNNLNQLISDK-EK 445

Query: 1669 LAIIKNETISENNQLSILTKKL 1734
            L    +E  S  NQ+  L + +
Sbjct: 446  LG---SELSSYENQVKDLNENI 464

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 56/234 (23%), Positives = 103/234 (44%), Gaps = 13/234 (5%)
 Frame = +1

Query: 1090 NTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGK 1269
            NT+ ++ + KL+EL++ ++                 E     L+  + ++  +    K +
Sbjct: 1059 NTQLKQKDSKLIELEELVE--------VTKNNLNDSESQVSNLIAKISELDEENKSVKLE 1110

Query: 1270 VIKE----TELMKLQKINAKE-DLLAKQLD-VXXXXXXXXXXXXAITNEYNIWNGNLENL 1431
            V K     TE+    K   KE D L  +LD              ++ NEY+    + ENL
Sbjct: 1111 VEKLENEITEIKNSHKSAQKETDTLQTKLDETELLLQSSKEEILSLKNEYSSTLSDKENL 1170

Query: 1432 TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK-----DKLNK--DVL 1590
                 +   KIE + +N   +Q+  E +  +  +L+ E    EEK     +KL++  + +
Sbjct: 1171 ENSEKKSSEKIEELEKNFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETI 1230

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
              L+ EKD L  + +  E+I +  ++    K E+ISE+  +    K L EE++A
Sbjct: 1231 SSLSDEKDKLNGIIDDKEKIISNLNE----KLESISEDIDIIEKAKNLLEEKLA 1280

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 51/184 (27%), Positives = 81/184 (44%), Gaps = 21/184 (11%)
 Frame = +1

Query: 1255 VDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLT 1434
            V KG VI E EL         E+L  K  +              + N Y    G  E+++
Sbjct: 722  VSKGDVINELELKV-------EELSNKSKNSISDYESIKNEYDILKNNYEEKEGEFESVS 774

Query: 1435 TLLDEKIAKIEAIN----ENNMRIQKDIEVLQVKKLN---LENEIKDHEEK--------D 1569
              LDE + + E +N    E   +++++   L+  KLN   LENE+K+ +E+        +
Sbjct: 775  KKLDELLTEREKLNSVTSEQLKKLEQNKSDLEKCKLNIEKLENELKEVKERKDNAENGVN 834

Query: 1570 KLNKDVLQKLNVEKDYLPRLNE------IDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
            K+NK+ L  L+ EK+ L R+ +      I EQI+   D       E  S   Q++ L   
Sbjct: 835  KMNKE-LSNLSKEKEQL-RIEQGKLEKKIQEQISVYEDSKIKFNQELESTEKQITDLQSN 892

Query: 1732 LEEE 1743
            LE +
Sbjct: 893  LESK 896

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 61/283 (21%), Positives = 120/283 (42%), Gaps = 20/283 (7%)
 Frame = +1

Query: 958  NPEYLVRTNEYNIVSKAVYDQMN-----YEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            N EY  +  E       + ++ N     YE+K+    +++ N +    ++T+K+++EDK+
Sbjct: 1423 NSEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLG--HDTEKKQFEDKI 1480

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
              L++++                  +  + +++KN           K  + KE E +K Q
Sbjct: 1481 TSLKQEI------------ISIEKSKKQDEKVLKN----------QKNTLQKELEELKDQ 1518

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
              N++ + + K+LD                NE N       ++  +L+ KI  ++A    
Sbjct: 1519 FTNSENEYI-KKLD-------------NFQNEINSVRKEKLDIEAVLNSKIETLKA---- 1560

Query: 1483 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL------------PR 1626
                  D+   + K L LE   K+H  K ++ +  L+K N E D L              
Sbjct: 1561 ------DLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNEKDTLTMNLNNE 1614

Query: 1627 LNEIDEQIAAKFDKLAIIKNE--TISEN-NQLSILTKKLEEER 1746
            +  + E+I +K D++  +K E  T+SEN   + +   +L+EE+
Sbjct: 1615 IKGLKEEINSKVDQIGNLKTELNTVSENMEDIQVRYDQLKEEK 1657

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 53/255 (20%), Positives = 100/255 (39%), Gaps = 24/255 (9%)
 Frame = +1

Query: 976  RTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXX 1155
            +  EY ++ K        E K+  + L N      E+Y+  K+  E KL +L+ +LD   
Sbjct: 1695 KDEEYTLLKKEFE-----EVKISKQELDNQKDKLLEEYSIMKRTNESKLKDLRNELDSKI 1749

Query: 1156 XXXXXXXXXXXXXXEIMEYQLVKNVLDVQSK------YNVDKGKVIKETELMKLQKINAK 1317
                          + +  +  + V  ++ +      Y+ DK   ++E    K   +  K
Sbjct: 1750 IKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQKIYSDDKISELEENIKSKNNALTEK 1809

Query: 1318 EDLLAKQL----DVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 1485
             +LL K+L    ++            A     ++ N   EN+   L  K  +I+ I E  
Sbjct: 1810 SNLLQKRLEEIKELESTLSKYKADLEATMKNSDLKNDEFENVCKELSVKENEIKKIEEIL 1869

Query: 1486 MRIQKDIEVLQVKKLNLENEIKD--------------HEEKDKLNKDVLQKLNVEKDYLP 1623
               +  I  ++ +K NL++E+ +               +E  ++ K+ LQK   E D L 
Sbjct: 1870 SSKEDLIAEIESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKENLQKKITEYDNLQ 1929

Query: 1624 RLNEIDEQIAAKFDK 1668
            +L  +D +   K +K
Sbjct: 1930 KLMSLDNKKLVKCEK 1944

 Score = 39.3 bits (90), Expect = 0.041
 Identities = 74/347 (21%), Positives = 146/347 (42%), Gaps = 34/347 (9%)
 Frame = +1

Query: 805  DLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYL-VRT 981
            D+L   K   T ++ + I G K    +      N+       +T      EN E + VR 
Sbjct: 1598 DILGNEKDTLTMNLNNEIKGLKEEINSKVDQIGNL-------KTELNTVSENMEDIQVRY 1650

Query: 982  NEYNIVSKAVYDQM-NYEQKLHSEW--LKNFNAA----------EDEKYNTKKQEYEDKL 1122
            ++       + D++   E+KL   +  + + N++          +DE+Y   K+E+E+  
Sbjct: 1651 DQLKEEKSEISDKLIESEEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVK 1710

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVK--NVLDVQSKYNVDKGKVIKETELMK 1296
            +  Q +LD+                 + EY ++K  N   ++   N    K+IK  +  K
Sbjct: 1711 ISKQ-ELDNQKDKL------------LEEYSIMKRTNESKLKDLRNELDSKIIKFDKERK 1757

Query: 1297 LQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE--- 1467
            L  +N   D +A++                 + +       L N     D+KI+++E   
Sbjct: 1758 L--LNEGSDNIAQE----------------YSEKVTSLEEELRNQKIYSDDKISELEENI 1799

Query: 1468 -----AINENNMRIQKDIE-------VLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
                 A+ E +  +QK +E        L   K +LE  +K+ + K+   ++V ++L+V++
Sbjct: 1800 KSKNNALTEKSNLLQKRLEEIKELESTLSKYKADLEATMKNSDLKNDEFENVCKELSVKE 1859

Query: 1612 DYLPRLNEIDEQIAAKFDKLAII---KNETISENNQLSILTKKLEEE 1743
            + + ++ EI   +++K D +A I   K+    E N+ S+L  K E +
Sbjct: 1860 NEIKKIEEI---LSSKEDLIAEIESQKDNLKDELNEKSLLLDKKESQ 1903

 Score = 36.2 bits (82), Expect = 0.36
 Identities = 44/229 (19%), Positives = 93/229 (40%), Gaps = 5/229 (2%)
 Frame = +1

Query: 1081 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKN-----VLDVQS 1245
            +++   + EY  KL   Q +++                 E ++  L K+     +L+  +
Sbjct: 1517 DQFTNSENEYIKKLDNFQNEINSVRKEKLDIEAVLNSKIETLKADLSKSEEKSLILEKSN 1576

Query: 1246 KYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLE 1425
            K ++ K +VI+++    L+K N + D+L  + D              +  E N     + 
Sbjct: 1577 KEHLIKMEVIQKS----LEKQNKELDILGNEKDTLTMNLNNEIK--GLKEEINSKVDQIG 1630

Query: 1426 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNV 1605
            NL T       ++  ++EN   IQ   + L+ +K  + +++ + EEK K N   +  LN 
Sbjct: 1631 NLKT-------ELNTVSENMEDIQVRYDQLKEEKSEISDKLIESEEKLKENFSSISDLN- 1682

Query: 1606 EKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
                                 +  ++   IS++ + ++L K+ EE +I+
Sbjct: 1683 -------------------SSVISLEASIISKDEEYTLLKKEFEEVKIS 1712

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 59/270 (21%), Positives = 114/270 (42%), Gaps = 27/270 (10%)
 Frame = +1

Query: 1015 DQMNYEQKLHSEWLKNFNAAE---DEKYNTKKQEYEDKLV---ELQKQLDDXXXXXXXXX 1176
            D+ N E K+ +  ++   +      ++ + K+ EY D L    +L K+LD+         
Sbjct: 2213 DKYNDELKVANNTIREIESKIPNLQKQLDLKEIEYNDTLSSKKDLDKKLDNFSKESEILS 2272

Query: 1177 XXXXXXX-EIMEYQLVKNVLDVQ-SKYN---VDKGKVIKETEL----MKLQKINAKEDLL 1329
                    E ++ +  KN L V+  KY    +D    +KE E     ++ + I  K+ + 
Sbjct: 2273 KEVKSLKKEKLDLEKEKNDLIVELDKYKNDIIDLNNTLKENEKNGSEVETEIIGLKDKIE 2332

Query: 1330 AKQLDVXXXXXXXXXXXXAITNEYNIWNGNLEN-LTTLLDEKIAKIEAINE------NNM 1488
              +L+V               ++ N   G LE+ + TL+ E+  K+++         N +
Sbjct: 2333 FYKLNV---------------SQLNEEKGKLESDIKTLVGERDDKLKSSQSEIIELTNKL 2377

Query: 1489 RIQKDIEVL----QVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNE-IDEQIA 1653
               KDI V     +V+   L+N++ + E+  + + + +   N E   L  +N+ +     
Sbjct: 2378 ESFKDISVAYEESKVESDGLKNKLSEIEKSLEESNENVDSANKEISDLKVMNDKLQSHNL 2437

Query: 1654 AKFDKLAIIKNETISENNQLSILTKKLEEE 1743
               DK   +KN+T   N ++  + K  EEE
Sbjct: 2438 ELEDKFQQLKNDTTETNRKIQDINKLKEEE 2467

 Score = 33.1 bits (74), Expect = 3.2
 Identities = 49/226 (21%), Positives = 91/226 (40%), Gaps = 1/226 (0%)
 Frame = +1

Query: 1075 EDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYN 1254
            E +K N K +  E  L+  +K+                   +I EY  ++ ++ + +K  
Sbjct: 1880 ESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKENLQKKITEYDNLQKLMSLDNKKL 1939

Query: 1255 VDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLT 1434
            V   K I++ EL    K+ +  + L +Q                   +    +G  + L 
Sbjct: 1940 VKCEKQIEDLEL----KLESSSNHLKEQ--------------EGKYEKLEFESGENKKLI 1981

Query: 1435 TLLDEKIAKIEA-INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
            +  DE I  ++  I+ N   IQK  + +   + N EN     EEK+K+  ++  KL  EK
Sbjct: 1982 SEKDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQ-EK 2040

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
            +      E+D       +KL    ++ +  +++L I    L +E I
Sbjct: 2041 EAQVETLELD------LNKLKETLDKELESSSELQIAHDNLRDENI 2080

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 65/306 (21%), Positives = 127/306 (41%), Gaps = 14/306 (4%)
 Frame = +1

Query: 874  SNKTAKAGASNMTLG---VAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLH 1044
            + K  K   S  +LG   + + E  ++ + EN +   + N+ +     + +  NYE +L 
Sbjct: 497  NEKEDKYRFSKSSLGDENIKLNEKISILTTENSQLKSKLNDESTAISHLKE--NYETRLS 554

Query: 1045 SEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVK 1224
            S  ++N    E E+Y T  ++ E ++ EL+ ++ +                E    +L  
Sbjct: 555  S--MRN----EVEEYKTSAEKSESEVEELRIRITENSAKVSEKRSMELKQKEQQINELNN 608

Query: 1225 NVLDVQSKYNVDKG---KVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITN 1395
            N+ + + + N+ K    K  K+    K ++ N + DL ++ L++            ++ +
Sbjct: 609  NLKEQKDEINLLKHIIEKYKKDFNQSKTEQSNIQRDLNSQILNLESKLIESEDELRSLRD 668

Query: 1396 ----EYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
                E   W     +L+   D  +A+  + ++     + ++ +L  K   L+ E  + +E
Sbjct: 669  SQRTEIENWKRKYNDLSLENDRLLAERTSASDK----EHEVSILNRKLDELDKEKWNLQE 724

Query: 1564 KDKLNKDVLQKLNVEKDYLPR----LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
              +  K  LQKL    D L R    LNE    I    +K+  IK   + E   L    ++
Sbjct: 725  SKEKYKRELQKLITANDRLRREKEELNENSNNIRIMEEKMTRIKKNYLGEITSLQEENRR 784

Query: 1732 LEEERI 1749
            LEE  I
Sbjct: 785  LEERLI 790

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 59/267 (22%), Positives = 113/267 (42%), Gaps = 20/267 (7%)
 Frame = +1

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXX 1182
            K + D+ N+++K  SE      A+ED+           K +ELQK+ +            
Sbjct: 1261 KELQDECNFKEKEVSELEDKLKASEDKN---------SKYLELQKESEKIK--------- 1302

Query: 1183 XXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXX 1362
                 E ++ +  +  + ++   N+ K K   E+EL +L+K +++E   A++  +     
Sbjct: 1303 -----EELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKTSSEERKNAEE-QLEKLKN 1356

Query: 1363 XXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE-----AINENNMRIQK-DIEVLQVK 1524
                   A   E  + N     +T    EKI  +E       NEN ++ ++ D    +++
Sbjct: 1357 EIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNENELKAKEIDNTRSELE 1416

Query: 1525 KLNLENE---------IKDHEE-----KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
            K++L N+         IK  ++     KDK+ ++  + L++E+D    L  + EQ+ A  
Sbjct: 1417 KVSLSNDELLEEKQNTIKSLQDEILSYKDKITRNDEKLLSIERDNKRDLESLKEQLRAAQ 1476

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEE 1743
            +  A ++              KKLEEE
Sbjct: 1477 ESKAKVEEG-----------LKKLEEE 1492

>Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 45.1 bits (105), Expect = 6e-04
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 15/175 (8%)
 Frame = +1

Query: 1258 DKGKVIKETELMKLQKINAKEDL---LAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLEN 1428
            D+ K  K T  +K  +IN+  D    L KQ+D+                E+  W+ N EN
Sbjct: 549  DELKENKNTLSLKDSEINSLNDEINELKKQIDLKD-------------EEFKTWHNNYEN 595

Query: 1429 L-------TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI---KDHEEKDKLN 1578
            +       +  + E    IE + E+ +++ + I  L+ K L +ENE    K+  EK  L 
Sbjct: 596  VEDEAKIRSAEVTELNKDIEDLKESKLQLVETISELENKVLKVENEYNLEKEKFEKTSLE 655

Query: 1579 KDVLQ--KLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
             + LQ    N++ +++  L  + E + +       ++NE    ++++S+LTK+ E
Sbjct: 656  LESLQLKNSNIQAEHIKELENLHENLVS-------LQNELGISSDRISLLTKENE 703

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
            plaque spindle pole body (SPB) component, ortholog of
            human kendrin; involved in connecting nuclear
            microtubules to SPB; interacts with Tub4p-complex and
            calmodulin; phosphorylated by Mps1p in cell
            cycle-dependent manner
          Length = 944

 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 57/255 (22%), Positives = 106/255 (41%), Gaps = 13/255 (5%)
 Frame = +1

Query: 1024 NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEI 1203
            NYE++L S         + E+Y    ++ EDK+ EL+ ++ +                + 
Sbjct: 548  NYEKQLESL------RKDIEEYKESAKDSEDKIEELKIRIAENSAKVSEKRSKDIKQKDE 601

Query: 1204 MEYQLVKNVL----DVQS-KYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXX 1368
                L +N+     ++ S K  +D+ K  K+   +K ++ N + DL  + L++       
Sbjct: 602  QISDLTQNLKLQEDEISSLKSIIDRYK--KDFNQLKSEQSNIQHDLNLQILNLENKLIES 659

Query: 1369 XXXXXAITNEYNI----WNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNL 1536
                 ++ +   I    W     NL+   D  + + E+ ++     +++I +L  K   +
Sbjct: 660  EDELKSLRDSQKIEIENWKRKYNNLSLENDRLLTEKESASDK----EREISILNRKLDEM 715

Query: 1537 ENEIKDHEEKDKLNKDVLQKLNVEKDYLPR----LNEIDEQIAAKFDKLAIIKNETISEN 1704
            + E  + +E  +  K  LQK+    D L R    LNE    I    DK+  IK   +SE 
Sbjct: 716  DKEKWNLQESKEKYKRELQKVITANDRLRREKEELNENSNNIRIMEDKMTRIKKNYLSEI 775

Query: 1705 NQLSILTKKLEEERI 1749
              L    ++LEE  I
Sbjct: 776  TSLQEENRRLEERLI 790

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 53/253 (20%), Positives = 102/253 (40%), Gaps = 9/253 (3%)
 Frame = +1

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXX 1182
            K++  ++   +K  ++ L N++  E+E  + K     ++L  L+K+LD            
Sbjct: 166  KSLKHEIKELRKEKNDTLNNYDTLEEETDDLK-----NRLQALEKELDAKNKIVNSRKVD 220

Query: 1183 XXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ--KINAKEDLLAKQLDVXXX 1356
                      Q+ + + +++ K    K +V++      +Q  K+ +KED L         
Sbjct: 221  DHSGCIEEREQMERKLAELERKLKTVKDQVLELENNSDVQSLKLRSKEDELKN------- 273

Query: 1357 XXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNL 1536
                      + NE N    N E   T L+ K        +N +R          K+ N 
Sbjct: 274  ----------LMNELNELKSNAEEKDTQLEFK--------KNELR----------KRTNE 305

Query: 1537 ENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEID-------EQIAAKFDKLAIIKNETI 1695
             NE+K   + D+++  + QK N  K     LNE++        Q +AK ++L ++KN+  
Sbjct: 306  LNELKI--KSDEMDLQLKQKQNESKRLKDELNELETKFSENGSQSSAKENELKMLKNKIA 363

Query: 1696 SENNQLSILTKKL 1734
                ++S    +L
Sbjct: 364  ELEEEISTKNSQL 376

>TBLA0E03490 Chr5 complement(868330..870579) [2250 bp, 749 aa] {ON}
            Anc_3.106 YOL091W
          Length = 749

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 50/202 (24%), Positives = 94/202 (46%), Gaps = 22/202 (10%)
 Frame = +1

Query: 1198 EIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXX 1377
            ++ E +  KN+LD ++K  + + K  ++ E+ K+++ N + + L KQ+            
Sbjct: 392  KLQELENEKNILDQKNKLKIVENKRNEDKEI-KIKEFNVRFNSLQKQV-----------L 439

Query: 1378 XXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQ--------------KDIEVL 1515
               IT+E      NLEN    LDE+I     ++EN   +Q              KD E+ 
Sbjct: 440  EKKITSEELKIRNNLENKLKRLDEEI----LVHENKQNLQKEKLHSDLCKYNSHKDNELE 495

Query: 1516 QVKKLNLENEIKDHEEKDKLNKDVLQKLN-----VEKDY---LPRLNEIDEQIAAKFDKL 1671
            ++K+  ++NEI    EK+ L  + L +L      +EKD+     +L E+   ++A   K 
Sbjct: 496  KIKQ--IKNEITAQNEKNNLLNNELDQLKYKYGILEKDHAFVTKKLLELINLLSADISKE 553

Query: 1672 AIIKNETISENNQLSILTKKLE 1737
            +  K +   E ++L+   +K +
Sbjct: 554  SKEKEKLEGEESKLNDERRKYD 575

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 66/283 (23%), Positives = 116/283 (40%), Gaps = 18/283 (6%)
 Frame = +1

Query: 955  ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ 1134
            EN +  ++ +E +  S A   + NY+ +L S         E E+Y    +E E+K  EL+
Sbjct: 527  ENSQLKIKLDEES--SAAYRTKENYQTQLDSL------RKEVEEYRKSAEESEEKAEELK 578

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIM-------------EYQLVKNVLDVQSK-YNVDKGKV 1272
             ++ +                E               E   +K ++D   K +N  K + 
Sbjct: 579  IRISENSAKVSEKRSKDIKKKEEQINELTHHLKLQADEINSLKTIIDKYKKDFNESKSEE 638

Query: 1273 IKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEK 1452
                  + LQ +N +  L+  + ++                +YN  N +LEN   LL EK
Sbjct: 639  SNIQRDLNLQILNLENKLIESEDELRSLKDSQRIEIENWKRKYN--NLSLEN-DRLLAEK 695

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR-- 1626
             + ++  +E ++ + + ++ L  +K NL+      E K+K  ++ LQK+    + L R  
Sbjct: 696  DSTLDKEHEVSI-LNRKVDELNKEKWNLQ------ESKEKYKRE-LQKVITANERLRREK 747

Query: 1627 --LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
              LNE    I    DK+  IK   +SE   L    ++LEE  I
Sbjct: 748  EELNENGNNIRVMEDKMTRIKKSYLSEITSLQEENRRLEERLI 790

 Score = 35.0 bits (79), Expect = 0.75
 Identities = 59/289 (20%), Positives = 110/289 (38%), Gaps = 36/289 (12%)
 Frame = +1

Query: 982  NEYNIVSKAVYDQMNYEQKLHSEW-----LKNFNAAEDEKYNTKKQE-YEDKLVELQKQL 1143
            N Y+I+ +   D  N  Q+L +E      L N    ED     +++E  E KL E +K+L
Sbjct: 184  NNYDILEEETDDLRNKLQELKNELNTKNKLVNSKKVEDHSGCIEERERMERKLTESEKKL 243

Query: 1144 DDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKV-IKETELMKLQKINAKE 1320
                                    +   V ++++  NV   +V  KE +L +L  +N   
Sbjct: 244  KT----------------------MNDQVHELENNANVQNSRVKSKEDDLKRL--LNQLN 279

Query: 1321 DLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQK 1500
            +  +   +               TNE N      + + TLL EK ++ E +      ++ 
Sbjct: 280  ESKSSAEEKDKQLESKNSELKKRTNELNELKIKSDEVDTLLQEKKSESERLTNRLYELES 339

Query: 1501 DIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP------------------R 1626
             +     +    ENE++   E  K+   + +K+N +   L                   +
Sbjct: 340  KLNENGSQSSAKENELR---ESRKIIAQLEEKINAKSSQLTEKESELGSLMTLITELENK 396

Query: 1627 LNEIDEQIAAKFDKL-----------AIIKNETISENNQLSILTKKLEE 1740
            LN+ D Q+ ++ ++L            I + ET S + Q+S L  K+++
Sbjct: 397  LNQKDSQLGSREEELKTINEQLQRDVKIARQETASRDEQVSDLQTKIQK 445

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
            YDR356W
          Length = 970

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 71/286 (24%), Positives = 119/286 (41%), Gaps = 27/286 (9%)
 Frame = +1

Query: 964  EYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQL 1143
            EY + T+E  I  K + D +N+E K   E  K        + N  KQ  ED++  L  ++
Sbjct: 477  EYDIITSELKITKKKL-DTVNFELKKELELKK--------RINNSKQRLEDQVKSLTLEI 527

Query: 1144 DDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVI-KETELMKLQK----I 1308
             D                EI + Q  + +L+  S  +  + K+   E ++  LQK    I
Sbjct: 528  SDKHS-------------EISDLQ--EKLLEYTSNSDNSRSKISGMELKIKALQKELVEI 572

Query: 1309 NAKEDLLAKQLDVXXXXXXXXXXXX-----AITNE------YNIWNGNLE-------NLT 1434
               +D+L +  +                   I+N+        I N  L+       NL+
Sbjct: 573  KKNKDILQESYEELKQSKLELQSNIDRNLEKISNQKEEISRLKIENDKLQQTNFENLNLS 632

Query: 1435 TLLDEKIAK----IEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            T L  +I +    ++ I E N ++  DI    V+  +L+NE+  +E K KLNK       
Sbjct: 633  TKLQSEIEQSNEYVQTITEQNNKLTSDITSKIVRIDDLKNEL--NENKQKLNK------- 683

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
            +EKDY      I     ++ D+L  + +E  S+NN+L  +  K +E
Sbjct: 684  LEKDY----RHIKR---SQNDRLPKLLSELNSKNNELQYIENKFKE 722

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 57/246 (23%), Positives = 94/246 (38%), Gaps = 4/246 (1%)
 Frame = +1

Query: 1024 NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEI 1203
            N+ Q+L +   KN N  +  ++   K EYE K+  L+  L                    
Sbjct: 186  NFIQELDTFLEKNNNTIDLNQWENDKSEYELKIKNLKNNLS------------------- 226

Query: 1204 MEYQLVKNVLDVQSKYNVDKGKVIKETE---LMKLQKINAKEDLLAKQLDVXXXXXXXXX 1374
                        QSK   +K K+++ T     +K+  +    D L +QL           
Sbjct: 227  ------------QSK---EKMKILESTNNQLSLKMSNLQNSYDHLKEQL----------- 260

Query: 1375 XXXAITNEYNIWNGNLENLTTLLD-EKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK 1551
                I N  N    N +NL   L  EK   +  + EN   +    + L  K+L L   I+
Sbjct: 261  --LGIENNSN----NEKNLLLQLQSEKENLLRKVMENKHELDNSQKALSEKELQL---IE 311

Query: 1552 DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
             +++ DK  +D+ Q    + +    +N  DEQI      +A +  + +   NQL    KK
Sbjct: 312  LNKQLDKKAQDLKQLKTQQNE---NINNNDEQIEKLKQDIAELSKKNLDFQNQL----KK 364

Query: 1732 LEEERI 1749
             + +RI
Sbjct: 365  SQNDRI 370

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 65/308 (21%), Positives = 132/308 (42%), Gaps = 10/308 (3%)
 Frame = +1

Query: 856  ISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQ 1035
            +S  K S   A+    + T+ +A  ++ A       E  +++ +  + +KA       E+
Sbjct: 1393 LSEHKKSLLEAQEQEKSSTIELAKLKSAAADEKNKLEEEIKSCKVELKNKA--QAFEKER 1450

Query: 1036 KLHSEWLKNFNAAEDEKYNTKKQEYEDKLVEL----QKQLDDXXXXXXXXXXXXXXXXEI 1203
            KL +E   +      ++Y+ K  E EDKL  +    Q +L++                E 
Sbjct: 1451 KLLNEGSSSIT----KEYSEKVSELEDKLEAVNSAHQSKLEELDSLKTNMIELENKNSEQ 1506

Query: 1204 MEYQLVKNVL--DVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXX 1377
            ++ +    V+  +  SK   D   +  E E  + +  N  +DL  K  ++          
Sbjct: 1507 LKKEKASIVILEETISKQKKDIDNLHSEVEDSQEKCKNINKDLTKKLREMQ--------- 1557

Query: 1378 XXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDH 1557
                 +    ++ NL+ +   ++EK  +IE  +++   ++K++   Q+K  +L+NE   +
Sbjct: 1558 -----SASETYDSNLKRMEETIEEKNVEIEKSSKSIEELEKELGSQQLKLKDLQNE---N 1609

Query: 1558 EEKDKLNKDVLQKLNVE----KDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILT 1725
             E  K NKD+L +   E    K+    L+E +E ++   D+L   K+E    +  L I  
Sbjct: 1610 TEVIKKNKDILDEKISEIGNLKEKNESLSEENETLSKSADQL---KSEVSKRDEALKISK 1666

Query: 1726 KKLEEERI 1749
            K ++E ++
Sbjct: 1667 KVIDEYKV 1674

 Score = 40.0 bits (92), Expect = 0.023
 Identities = 25/99 (25%), Positives = 48/99 (48%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            +LDEKI++I  + E N  + ++ E L      L++E+   +E  K++K V+ +  V+   
Sbjct: 1619 ILDEKISEIGNLKEKNESLSEENETLSKSADQLKSEVSKRDEALKISKKVIDEYKVK--- 1675

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKL 1734
                   DEQ++    +LA +  E       +  L K++
Sbjct: 1676 -------DEQLSKLQSQLAQVNKEYSDSKQAMEDLQKRI 1707

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 22/99 (22%), Positives = 58/99 (58%), Gaps = 5/99 (5%)
 Frame = +1

Query: 1465 EAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-----KDYLPRL 1629
            E IN++++R  K++E  ++   +  ++IK++++  +     LQ+ N +     KD+  ++
Sbjct: 898  ETINDDSLR--KELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQI 955

Query: 1630 NEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
              + ++  +  DK++++K +  + NN+L +  K +E+E+
Sbjct: 956  KNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEK 994

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 58/286 (20%), Positives = 106/286 (37%), Gaps = 35/286 (12%)
 Frame = +1

Query: 991  NIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTK--KQEYEDKLVELQKQLDDXXXXX 1164
            N+  K    +   +Q L     +  N A++     K  K + E ++ ELQK+L++     
Sbjct: 555  NLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSV 614

Query: 1165 XXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIK----ETELMKLQK------INA 1314
                        +   QL +   D++S+    + ++ +     TE M L         ++
Sbjct: 615  PNEDASYS---NVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDS 671

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENL--------TTLLDEKIAKIEA 1470
            K D+  K                 ++N  ++     + L         T+L +     E 
Sbjct: 672  KSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHET 731

Query: 1471 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL---------- 1620
            +NE  +  +  + +++ + LNL+ E K     +K  K  L KL+ EKD L          
Sbjct: 732  LNEY-VSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTL 790

Query: 1621 -----PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
                   L E  +    K D+L    +E   E +Q     K+LEE+
Sbjct: 791  QKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEED 836

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 60/270 (22%), Positives = 114/270 (42%), Gaps = 14/270 (5%)
 Frame = +1

Query: 970  LVRTNEYNIVSKAVYDQ-------MNYE--QKLHSEW--LKNFNAAEDEKYNTKKQEYED 1116
            LV+ N Y I +   +D        +++E  +KL S+   LKN  +A +   ++K    E+
Sbjct: 674  LVQKNYYRIKAALSHDPNEEPVSTLSFEIFEKLQSDCTNLKNSLSALENDSSSKIDTLEE 733

Query: 1117 KLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMK 1296
            KL ELQ   +                     Y+ +KN L+  S+         KE E +K
Sbjct: 734  KLTELQNDFNILSEKHSILSGDNISLNS--NYENIKNELNSISE---QLSMASKENENLK 788

Query: 1297 LQKINAKEDL--LAKQLDVXXXXXXXXXXXXAITN-EYNIWNGNLENLTTLLDEKIAKIE 1467
                + + D+  L K+L+              +T  E +     +  +   L + +  I+
Sbjct: 789  ATNASQEVDVKSLNKELNEKEKSIYELEKQLNLTKTEKDKAQEGINKMNNELRKLMTSID 848

Query: 1468 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 1647
             +NE+  R+Q +I++ +++  + E +I    EK     D L+KL   K+    + E+  +
Sbjct: 849  TLNEDKSRLQNEIKLQKIELDDKETKINSEMEKTSKEYDNLKKLLALKE--EEIEELKSK 906

Query: 1648 IAAKFDKLAIIKNETISENNQLSILTKKLE 1737
            +      L   K +  S ++ +  LT+KL+
Sbjct: 907  LLISARDLKEYKGKFQSHDSLVPKLTEKLK 936

 Score = 40.8 bits (94), Expect = 0.014
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 17/136 (12%)
 Frame = +1

Query: 1396 EYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVK------KLN-------- 1533
            E  + N  L +  +    K+  I  +  NN  + K++E L ++      KLN        
Sbjct: 1833 ELELLNKQLSDALSDAQSKVNCISELQSNNEALIKEVESLHLQITDLDSKLNEANVNSNS 1892

Query: 1534 LENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA-AKFDKLAIIKNETISENNQ 1710
             ENEI D   K K N D L +++     L    E++E++   K ++L+ IK  T  + N+
Sbjct: 1893 KENEISDLLIKAKDNSDQLSEMHSRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENE 1952

Query: 1711 LSILTKK--LEEERIA 1752
            +  LT++  L EE IA
Sbjct: 1953 IKKLTQELALSEEEIA 1968

 Score = 38.1 bits (87), Expect = 0.093
 Identities = 46/243 (18%), Positives = 104/243 (42%)
 Frame = +1

Query: 979  TNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXX 1158
            TN+YN +  +   +++ E++L S+        E ++ +T   E   KL E+  +      
Sbjct: 1192 TNDYNALESS---KLDLEEELSSQ------TTELDQKDTSLAELSKKLEEISSEKLKLNS 1242

Query: 1159 XXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQ 1338
                         ++ E + ++ +  ++ +  V K    KET+  KLQ+++ K D ++++
Sbjct: 1243 LLQNTETNLKDLEKVNEDKEIR-IQSLEKELKVVKSNS-KETD-NKLQELSDKHDQMSRE 1299

Query: 1339 LDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQ 1518
             ++               ++ ++ N   E L    ++ + KI    E+  +++K+   LQ
Sbjct: 1300 YEILK------------ADKESLLNSK-EKLYKQYNDNVEKINNYEESLKQLKKEKTTLQ 1346

Query: 1519 VKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETIS 1698
                  E E+ D +EK   N +    +  EKD L    ++ +    + + +   K++ I+
Sbjct: 1347 ANLKTTEAELNDLQEKYSANVNSYNDIISEKDKLTEEIKLSDDKIKELELVLEEKDKVIT 1406

Query: 1699 ENN 1707
              N
Sbjct: 1407 NQN 1409

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 63/288 (21%), Positives = 109/288 (37%), Gaps = 35/288 (12%)
 Frame = +1

Query: 979  TNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXX 1158
            T EY     ++ DQ+       SE  K+  AAE++K     +   D+   L K  ++   
Sbjct: 1785 TLEYKNKLTSIIDQL-------SETEKDLTAAEEDK-KILTETLNDQKTSLDKSHEEL-- 1834

Query: 1159 XXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNV------DKGKVIKETELMKLQ------ 1302
                         E++  QL   + D QSK N       +   +IKE E + LQ      
Sbjct: 1835 -------------ELLNKQLSDALSDAQSKVNCISELQSNNEALIKEVESLHLQITDLDS 1881

Query: 1303 -----------KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDE 1449
                       K N   DLL K  D              +TNE+ +     E L     E
Sbjct: 1882 KLNEANVNSNSKENEISDLLIKAKDNSDQLSEMHSRIKTLTNEFEL----NEKLLNEKSE 1937

Query: 1450 KIAKIEAINENNMR-----------IQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQK 1596
            +++ I+A+ E                +++I V++ K  N +      E K    K++L +
Sbjct: 1938 ELSAIKAVTEGKENEIKKLTQELALSEEEIAVIKSKLKNSDETAASTERKLLETKEILSQ 1997

Query: 1597 LNVEKDYLPR-LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
            +  +     +  +++  Q+     +L ++ N  I+EN  L  L+ K+E
Sbjct: 1998 MPTDLTTANKDKSDLSIQLTETKKQLDVL-NLQINENGDL--LSSKIE 2042

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 57/254 (22%), Positives = 103/254 (40%), Gaps = 15/254 (5%)
 Frame = +1

Query: 1024 NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEI 1203
            N E K+      + N  E +     K+E E+ ++ L +QL+D                  
Sbjct: 997  NLESKIEDMITAHTN--EKKALEESKEELEEFVISLNEQLEDLETSKLESSNKASELEAK 1054

Query: 1204 M-----EYQLVKNVLDVQ----SKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXX 1356
            +     E    KN LD      SK  +   +   + E ++  K++  ++L  K   +   
Sbjct: 1055 IKSFNNEVNSYKNQLDTANNLISKLQISLDEANSKIEQLEEDKVSDLKNLTKKDQKL--- 1111

Query: 1357 XXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAIN--ENNMRIQKDIEVLQVKKL 1530
                     A  NE +  N  L+N   L + +  K E ++  E    +  D+E L  K +
Sbjct: 1112 --------EARDNELS--NAKLQNDELLRERQSLKDELLSTKEKFNSVNDDLEELNSKYV 1161

Query: 1531 NLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRL-NEIDEQIAAKFD---KLAIIKNETIS 1698
             +E E +  E     N+  +++L   KD +  L N+ +   ++K D   +L+    E   
Sbjct: 1162 TIEEEKRTLENSINENQFTIKEL---KDNISGLTNDYNALESSKLDLEEELSSQTTELDQ 1218

Query: 1699 ENNQLSILTKKLEE 1740
            ++  L+ L+KKLEE
Sbjct: 1219 KDTSLAELSKKLEE 1232

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 36/152 (23%), Positives = 68/152 (44%), Gaps = 32/152 (21%)
 Frame = +1

Query: 1387 ITNEYNIWNGN-------LENLTTLLDEK-------IAKIEAINENNMRIQ--------- 1497
            +TN+YN    +       L + TT LD+K         K+E I+   +++          
Sbjct: 1191 LTNDYNALESSKLDLEEELSSQTTELDQKDTSLAELSKKLEEISSEKLKLNSLLQNTETN 1250

Query: 1498 -KDIEVL----QVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEI----DEQI 1650
             KD+E +    +++  +LE E+K  +   K   + LQ+L+ + D + R  EI     E +
Sbjct: 1251 LKDLEKVNEDKEIRIQSLEKELKVVKSNSKETDNKLQELSDKHDQMSREYEILKADKESL 1310

Query: 1651 AAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
                +KL    N+ + + N      K+L++E+
Sbjct: 1311 LNSKEKLYKQYNDNVEKINNYEESLKQLKKEK 1342

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 38/188 (20%), Positives = 76/188 (40%), Gaps = 21/188 (11%)
 Frame = +1

Query: 1216 LVKNVLDVQSKY------NVDKGKVIKET----ELMKLQKINAKEDLLAKQLDVXXXXXX 1365
            L++N+ +++SK       + ++ K ++E+    E   +      EDL   +L+       
Sbjct: 991  LLENISNLESKIEDMITAHTNEKKALEESKEELEEFVISLNEQLEDLETSKLESSNKASE 1050

Query: 1366 XXXXXXAITNEYNIWNGNLENLTTL-------LDEKIAKIEAINENNMRIQKDIEVLQVK 1524
                  +  NE N +   L+    L       LDE  +KIE + E+ +    D++ L  K
Sbjct: 1051 LEAKIKSFNNEVNSYKNQLDTANNLISKLQISLDEANSKIEQLEEDKV---SDLKNLTKK 1107

Query: 1525 KLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL----PRLNEIDEQIAAKFDKLAIIKNET 1692
               LE    +       N ++L++    KD L     + N +++ +     K   I+ E 
Sbjct: 1108 DQKLEARDNELSNAKLQNDELLRERQSLKDELLSTKEKFNSVNDDLEELNSKYVTIEEEK 1167

Query: 1693 ISENNQLS 1716
             +  N ++
Sbjct: 1168 RTLENSIN 1175

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 44/186 (23%), Positives = 78/186 (41%), Gaps = 10/186 (5%)
 Frame = +1

Query: 1207 EYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXA 1386
            E +L + +  ++ KY+  K K  +E  L+K       + L  K L++             
Sbjct: 2277 ERRLDEELTSLKQKYDDLKSKSTEEAILLK-------DKLQHKALNIETLNTEITRLETN 2329

Query: 1387 ITNEYNIWNGNLENLTTLL-------DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENE 1545
            I+ E N+     ++L   +       D    KI+ I +    ++   E L +K   LE E
Sbjct: 2330 IS-ELNLDTSKFKSLNEDILLKQSDNDSLSKKIDEIVKEKTDLKSANEELVIKSRTLEEE 2388

Query: 1546 IKD-HEEKDKLNKDV--LQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
            +K+    K+ L  ++  L KL  EK+    LNE  ++   +  K        I+E N+ S
Sbjct: 2389 MKELSNSKNALQAELKTLSKLKEEKEIQTSLNEKSKEENIQLSKSNDELQSKIAELNKDS 2448

Query: 1717 ILTKKL 1734
            +  K+L
Sbjct: 2449 MEQKRL 2454

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = +1

Query: 1393 NEYNIWNGNLENLTTLLDEKIAKIEAIN-------ENNMRIQKDIEVLQVKKLNLENEI- 1548
            +E+ IW    EN+      + A++  +N       E+N+ +Q+ I  L+ K  +LENE  
Sbjct: 584  DEFKIWQSKYENVEDEAKIRNAEVTELNRDIDDLRESNLHLQETITELENKVHDLENEYD 643

Query: 1549 --KDHEEKDKLNKDVLQ--KLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
              K++ EK  L  + LQ    N++ +++  L  + E + +       ++NE    +++++
Sbjct: 644  LEKENFEKTSLELESLQLKNSNIQAEHIKELENLHENLMS-------LQNELKFSSDRIA 696

Query: 1717 ILTKKLE 1737
             LTK+ E
Sbjct: 697  TLTKENE 703

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 63/279 (22%), Positives = 118/279 (42%), Gaps = 16/279 (5%)
 Frame = +1

Query: 958  NPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAE--DEKYNTKKQEYEDKLVEL 1131
            N E  V  +   I+ +   D +     L SE     N     ++  N K  E E+   EL
Sbjct: 392  NTEIKVLNSNQKILQEKYDDSITDLNNLRSEHENTVNTLHINEKNLNEKNVELENVKEEL 451

Query: 1132 QKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLD---VQSKYNVDKGKVI---KETELM 1293
            +  +D                 ++ EYQ + N L+    +    ++   ++   KETEL 
Sbjct: 452  RTNVD-----------------KLSEYQAMVNELNSCITELNDKIESTNIVLKSKETELD 494

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
             L K++ KE L                   +I+ ++N        L T L+E I+     
Sbjct: 495  NL-KLSLKETL-------------------SISKDFND-----SELVTQLNELIS----- 524

Query: 1474 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR-LNEIDEQI 1650
             +N++++    E+  +  LN +N +K  ++K   N++ L+  + E D L   LNE+ +QI
Sbjct: 525  TKNSLQL----ELNDLNNLNSDN-LKTLQDKLIENENTLRLKDAEMDSLNNELNELKKQI 579

Query: 1651 AAKFDKLAI-------IKNETISENNQLSILTKKLEEER 1746
            A+K D+  I       +++E    N +++ L + +++ R
Sbjct: 580  ASKDDEFKIWQSKYENVEDEAKIRNAEVTELNRDIDDLR 618

 Score = 32.7 bits (73), Expect = 3.8
 Identities = 31/141 (21%), Positives = 63/141 (44%), Gaps = 19/141 (13%)
 Frame = +1

Query: 1384 AITNEYNIWNGNLENLTTLLDEKIAKIEAINENNM----RIQKDIEVL--QVKKLNLENE 1545
            +I+ +Y   N N + L    +EK+ K+    ENN+    + +K I+ L  ++K LN   +
Sbjct: 344  SISFQYEKLNKNHQQLIDSSNEKVEKLSTERENNISKVEKFKKRIKELNTEIKVLNSNQK 403

Query: 1546 IKDHEEKDKL---------NKDVLQKLNVEKDYL----PRLNEIDEQIAAKFDKLAIIKN 1686
            I   +  D +         +++ +  L++ +  L      L  + E++    DKL+  + 
Sbjct: 404  ILQEKYDDSITDLNNLRSEHENTVNTLHINEKNLNEKNVELENVKEELRTNVDKLSEYQA 463

Query: 1687 ETISENNQLSILTKKLEEERI 1749
                 N+ ++ L  K+E   I
Sbjct: 464  MVNELNSCITELNDKIESTNI 484

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] {ON}
            Anc_3.479 YPR141C
          Length = 764

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 63/267 (23%), Positives = 110/267 (41%), Gaps = 10/267 (3%)
 Frame = +1

Query: 973  VRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAA---EDEKYNTKKQEYEDKLVELQKQL 1143
            ++T  YN   K   D++    ++  + LK    A   E    NTK+Q+   +  EL K  
Sbjct: 143  LQTTLYN--RKMELDELRDNLEVRKDQLKEQKYAVGRESGSKNTKEQQLRLRQTELSKLK 200

Query: 1144 DDXXXXXXXXXXXXXXXXEIMEY--QLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAK 1317
            +D                + ME   Q  KN L ++ +   DK + +K    +K++K+  +
Sbjct: 201  EDLEARKKFLLDGFKLHLKQMEVENQTKKNKLAIEYR---DKLEAVKR---VKIKKMEDE 254

Query: 1318 EDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQ 1497
            +D LAK++DV                               L EKIA  ++  ++ +R  
Sbjct: 255  KDQLAKEVDV-------------------------------LREKIANNDSTLDDMLR-- 281

Query: 1498 KDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-----NVEKDYLPRLNEIDEQIAAKF 1662
               +V Q  +   E  +K  E K K N ++ +K       + K+    L    E++ +KF
Sbjct: 282  ---DVTQKYENMKEPWLKSFEVKWKENVEINEKCIQEITELRKELEENLQPKAEKLKSKF 338

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEE 1743
            D L   ++E I++  Q     +K+EEE
Sbjct: 339  DSLKEQRDELIAKLKQQQKEHRKIEEE 365

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 42.4 bits (98), Expect = 0.005
 Identities = 72/302 (23%), Positives = 123/302 (40%), Gaps = 43/302 (14%)
 Frame = +1

Query: 979  TNEYNIVSKA-------VYDQMNYEQKLH------SEWLKNFNAAEDEKYNTKKQEY--- 1110
            TNEY   S+        + D +   +KLH      S+ ++  N  E EK  T + EY   
Sbjct: 735  TNEYEKYSEENKSLGLKISDLLESNKKLHKDVNQASQTIEELNV-EREKLLTSRDEYKND 793

Query: 1111 -EDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLV------KNVLDVQSKYNVDKGK 1269
             E   ++L K ++                  ++E +L       K   D  +K + +   
Sbjct: 794  TETNSLKLNKSME---------------RISVLEKELKDIRAEKKKAEDGINKMSRELFS 838

Query: 1270 VIKETELMK-LQKINAKE-----DLLAKQ---LDVXXXXXXXXXXXXAIT-NEYNIWNGN 1419
            + KE + +K  QK N KE     D L+++   L++             IT  E N W   
Sbjct: 839  LTKENQNLKESQKRNEKERKKEADELSEKRRSLEIITKQMEALQSEKQITLKELNEWKSK 898

Query: 1420 LENLTTLLDEKIAKIEAINEN-------NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLN 1578
             ++  TLL +   K+ ++ EN         ++ K +E +++++     E+K+  EK    
Sbjct: 899  FQSCETLLPKLTEKLRSLAENFKETEDERDKLAKTLESIKLERDKNVAELKEAVEKLSNE 958

Query: 1579 KDVLQKLNVEKD-YLPRLNEIDEQIAAKF--DKLAIIKNETISENNQLSILTKKLEEERI 1749
            K  L   N +K   + +LN+  E+I  KF  +  A  +N T  ENN   + T+    E  
Sbjct: 959  KAELASDNEKKSLQIKQLNQAVEEIERKFEAENHATSQNRTEMENNLSKLRTEVESMETR 1018

Query: 1750 AH 1755
             H
Sbjct: 1019 TH 1020

 Score = 35.0 bits (79), Expect = 0.79
 Identities = 47/225 (20%), Positives = 93/225 (41%), Gaps = 22/225 (9%)
 Frame = +1

Query: 1081 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVD 1260
            EKY  +  + E+ + ELQ+Q+ +                       +   +D + + N  
Sbjct: 1115 EKYKRESTKLEENIKELQRQITNNTTTIAG----------------LNKAIDQERQTNAR 1158

Query: 1261 KGKVIKETELMK-LQKINAKEDL--LAKQLDVXXXXXXXXXXXXAIT--NEYNI------ 1407
                ++ET   K +    AKED   L+K +D             A T  N  N+      
Sbjct: 1159 LASELEETRKDKEISNSQAKEDALQLSKTIDELREERKGLEDGLAETKLNNTNLVSELDA 1218

Query: 1408 -------WNGNLENL---TTLLDEKIAKIEA-INENNMRIQKDIEVLQVKKLNLENEIKD 1554
                    NGN++ L          ++KI+A  +E   R++  I+ LQ K    E +++D
Sbjct: 1219 LKVTVGEKNGNIQELEKKKETASSALSKIKADFDETEKRLKAQIQSLQTKH---ERKVQD 1275

Query: 1555 HEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNE 1689
             +++ +L  +      V ++Y  ++N ++EQI+    ++  +K++
Sbjct: 1276 FDKERQLFAEGSDM--VTQEYSKKINTLEEQISVSEKQIEEVKSQ 1318

 Score = 32.3 bits (72), Expect = 5.3
 Identities = 42/184 (22%), Positives = 82/184 (44%), Gaps = 14/184 (7%)
 Frame = +1

Query: 1237 VQSKYNVDKGK--VIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIW 1410
            +QS+ +  K K  V++ET   +LQ++ +K D                    ++TNEY  +
Sbjct: 702  LQSECSTLKSKLNVLEETSETQLQELTSKLD--------------------SLTNEYEKY 741

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQ--VKKLNLENE----IKDHEEKD- 1569
            +   ++L         KI  + E+N ++ KD+      +++LN+E E     +D  + D 
Sbjct: 742  SEENKSLG-------LKISDLLESNKKLHKDVNQASQTIEELNVEREKLLTSRDEYKNDT 794

Query: 1570 -----KLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKL 1734
                 KLNK  +++++V +  L  +    ++     +K++        EN  L    K+ 
Sbjct: 795  ETNSLKLNKS-MERISVLEKELKDIRAEKKKAEDGINKMSRELFSLTKENQNLKESQKRN 853

Query: 1735 EEER 1746
            E+ER
Sbjct: 854  EKER 857

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
            Anc_8.604 YOR195W
          Length = 732

 Score = 42.0 bits (97), Expect = 0.005
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 10/117 (8%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINEN----NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            +NL  L   K+  ++   +N    N    K IE++  +   L  E+ D  +  K+N+  L
Sbjct: 191  DNLDELFSHKLTPVKPSADNGEDENYDFNKVIELVNKRNNELNKEVYD--KNSKINEISL 248

Query: 1591 QKLNVEKDYLPRLNEID------EQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
                +  +Y+ +  EID       +I  K +++ ++ NE +S+N +L +   + + E
Sbjct: 249  NFDRLNNEYVNQKKEIDNLMTEKNEIVTKLNEMQVVNNELVSKNEKLKVKVTEFKNE 305

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 50/256 (19%), Positives = 111/256 (43%), Gaps = 11/256 (4%)
 Frame = +1

Query: 1003 KAVYDQMNYEQ---KLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXX 1173
            K+ YD +  E    K + E L N +  E+EK   + + +E +  EL+ + D         
Sbjct: 317  KSKYDNLISENDALKKNKELLNNLSI-ENEKLINQGKNWETRFSELENEKDSADEKFA-- 373

Query: 1174 XXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXX 1353
                         Q+ +   ++ S+    + ++ +  EL+ +    AKE+   K  D+  
Sbjct: 374  -------------QIKEQFSELTSRNESLENQITELNELLSV----AKEE--NKNSDLLN 414

Query: 1354 XXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN 1533
                       +  +      + EN  ++L+ KI+ +     +    QK+IE L   K N
Sbjct: 415  EVNSLQEERKELQKKLEKIELDKENEVSILESKISALNETISSLQSCQKEIENLNSTKTN 474

Query: 1534 LENEI-------KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD-KLAIIKNE 1689
            LEN++       ++  +   +    + +LN + + L   N+  +++ +K D ++ I+K+E
Sbjct: 475  LENDLTALKSKFEEVNDNSSIRTAEVTELNSQIESLRESNDQLQELNSKLDEEIEILKSE 534

Query: 1690 TISENNQLSILTKKLE 1737
            ++ ++ +   ++ +LE
Sbjct: 535  SLKQDEEYKKVSIELE 550

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 39/161 (24%), Positives = 64/161 (39%), Gaps = 3/161 (1%)
 Frame = +1

Query: 1198 EIMEYQL--VKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQL-DVXXXXXXX 1368
            E+  ++L  VK   D     N D  KVI        + +N + + L K++ D        
Sbjct: 195  ELFSHKLTPVKPSADNGEDENYDFNKVI--------ELVNKRNNELNKEVYDKNSKINEI 246

Query: 1369 XXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI 1548
                  + NEY      ++NL T  +E + K+  +   N  +    E L+VK    +NEI
Sbjct: 247  SLNFDRLNNEYVNQKKEIDNLMTEKNEIVTKLNEMQVVNNELVSKNEKLKVKVTEFKNEI 306

Query: 1549 KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKL 1671
                    L K     L  E D L +  E+   ++ + +KL
Sbjct: 307  NTLNANQSLLKSKYDNLISENDALKKNKELLNNLSIENEKL 347

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
            YDR356W
          Length = 989

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 56/268 (20%), Positives = 112/268 (41%), Gaps = 3/268 (1%)
 Frame = +1

Query: 955  ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDE---KYNTKKQEYEDKLV 1125
            +N   L R  + N+  K V  ++N  ++ H +  K  +A  D+   +  + ++EYEDK+ 
Sbjct: 475  QNNLTLERKLKENLDEKNV--EINKLRRQHVDMQKTNSALVDKLTKESQSLRKEYEDKIN 532

Query: 1126 ELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQK 1305
            +L+ QL                   I +    K++L V+  YN    K+ KE E  K   
Sbjct: 533  DLENQLKS----------------NITDLSTNKDLLAVE--YNSKMDKLNKELEENK-HA 573

Query: 1306 INAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 1485
            +   E+++    +             A   E    N  +E+L + ++    K     E  
Sbjct: 574  LKTSEEIIKDLKNQLIENVTNSSQKLAKLTEAK--NSEIESLLSQMESLRNKYRKKTETL 631

Query: 1486 MRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 1665
            +  Q++     ++KL  E ++    EKD  +K +LQ  + +   +    E+++ +  K +
Sbjct: 632  INEQEEERQSYIRKLR-EEKLSTEREKDNYDKLLLQFNSEKNAIINSKKELEDNLNNKIN 690

Query: 1666 KLAIIKNETISENNQLSILTKKLEEERI 1749
             L  +  +T S + +L  L  +L  + +
Sbjct: 691  SLEKLLQQTSSTDVELETLKSELRGKEL 718

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 61/273 (22%), Positives = 113/273 (41%), Gaps = 19/273 (6%)
 Frame = +1

Query: 991  NIVSKAVYDQM-NYEQKLHSEWLKNFNAAEDEKYNTKKQEY---EDKLVELQKQLDDXXX 1158
            N+  KAV D++ NY+  L  ++    +A E E+  +  Q      ++L    + L+    
Sbjct: 770  NLSIKAVEDKISNYKDNLTQDFENELSANEKEELESVSQSVLTISNELDVTTESLESITS 829

Query: 1159 XXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGK----VIKETELMKLQKINAKEDL 1326
                            E  L   + DV   Y  D  K    ++++  L+ ++  +A +D+
Sbjct: 830  TIDQLNAELDSKLVPQEILLKSKLSDVGDSYTDDLKKNVDALMQQQHLVSIESESAVKDV 889

Query: 1327 --LAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQK 1500
              + K++D             ++T E N     LE   +     + KIE         QK
Sbjct: 890  DEIQKEID-------------SLTGEKNNNEKILEKANSQQRSLLKKIEGF-------QK 929

Query: 1501 DIEVLQVKKLNLENEIKDHEEKDK----LNKDVLQKLNV--EKDYLPRLNEIDEQIA--A 1656
            D+E   +KK  L     + ++K +    L +D L K      +D L +LNE+++ IA  +
Sbjct: 930  DVEKNMIKKTTLTARRDELQQKIREIGLLAEDALNKFTALSSEDLLSKLNEVNKNIAGLS 989

Query: 1657 KFDKLAIIKNETISE-NNQLSILTKKLEEERIA 1752
              +K A    +  +E   +LS    +LEE +++
Sbjct: 990  NVNKRAFENFKRFNEKQRELSQRAAELEESKVS 1022

>Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON}
            YBL047C (REAL)
          Length = 1377

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1273 IKETELMKLQKI--NAKEDLLAKQLDVXXXXXXXXXXXX-AITN---EYNIWNGNLENLT 1434
            +K+TE ++ Q I  N + + L +QL V              +TN   E    N  L+   
Sbjct: 655  VKQTEQLEAQVIQANKENETLTQQLAVSEANYHAAESKLNELTNDLQESQAKNAELKEQI 714

Query: 1435 TLLDEKIAKIEA-INENNMRIQ----------KDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
            T L+   A +++ +NE    ++          K +E+ Q+  +NL+ EI+   EK  +  
Sbjct: 715  TNLNSMTASLQSQLNEKQQHVKQERSMVDVNSKQLELSQITVVNLQKEIEGLGEKITVYL 774

Query: 1582 DVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
               ++LN   DY   + E   Q+ AK+ +L+    +      QL    K++EE+
Sbjct: 775  TKQKELN---DYQKTVEEQHAQLQAKYQELSNKDTDLSDREKQLEERNKQIEEQ 825

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 64/302 (21%), Positives = 111/302 (36%)
 Frame = +1

Query: 841  SIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQ 1020
            S++ + S    SNK       N+T      E       E    L   NE ++ ++A+ ++
Sbjct: 936  SLQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNL--NNELDLQNQAM-EK 992

Query: 1021 MNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXE 1200
               E K     L+N N    ++    K EYE KL ++QK LD                 +
Sbjct: 993  EKAEFKKKISILQNNN----KEIEAVKTEYESKLSKIQKDLDQ----------------Q 1032

Query: 1201 IMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXX 1380
             +     +N  + + + + D  K I E           +E L   +  V           
Sbjct: 1033 TIYANTAQNNYEQELQKHADVSKTISE----------LREQLHTYKGQVETLNLARGQFE 1082

Query: 1381 XAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE 1560
             A+      WN   E+L   LD   ++IE ++  N  +   IE+         N+  D +
Sbjct: 1083 KALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELY----TTTGNKPTDAK 1138

Query: 1561 EKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
                LN D+L  L  E+D L               K+A+ + +      ++S++  +L+E
Sbjct: 1139 SGSVLNNDILITLRRERDILD-------------TKVAVAERDAKMLRQKISLIDVELQE 1185

Query: 1741 ER 1746
             R
Sbjct: 1186 AR 1187

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 16/99 (16%), Positives = 59/99 (59%), Gaps = 5/99 (5%)
 Frame = +1

Query: 1465 EAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKD-----YLPRL 1629
            E+IN++++R  +++E  ++   +  ++I+++++  +     LQ+++ + D     +  ++
Sbjct: 898  ESINDDSLR--RELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQI 955

Query: 1630 NEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
              + ++  +  DK+++++ +  + NN+L +  + +E+E+
Sbjct: 956  QNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEK 994

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 56/264 (21%), Positives = 110/264 (41%), Gaps = 22/264 (8%)
 Frame = +1

Query: 1018 QMNYEQKLHS-----EWLKNFNAAEDEKYNTKK-QEYEDKLVELQKQLDDXXXXXXXXXX 1179
            ++  E K+H      E  KN+   ++   N    Q+  +   EL+ Q  D          
Sbjct: 593  KVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTR 652

Query: 1180 XXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKE--DLLAKQLDVXX 1353
                   ++  +L +++ D +S  +++ G+        K  +I A+E   LL+  LD+  
Sbjct: 653  ESTENMSLLNKEL-QDLYDSKSSLSIELGRE-------KSSRILAEERFKLLSNTLDLAK 704

Query: 1354 XXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKI-----------AKIEAINE--NNMRI 1494
                      A  ++    + NL+N  +  D K            +K+ AI    +N+++
Sbjct: 705  ----------AENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKL 754

Query: 1495 QKDIEVLQVKKLNLENEIKD-HEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKL 1671
            ++ +++   K  NL+ E+ +   EK  L+  V Q   ++K+    L+E  +    K D L
Sbjct: 755  ERTLKIELEK--NLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDAL 812

Query: 1672 AIIKNETISENNQLSILTKKLEEE 1743
               +NE  +E  +     K+LEE+
Sbjct: 813  QNAQNELKTEAIRKDQYIKQLEED 836

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 58/265 (21%), Positives = 107/265 (40%), Gaps = 4/265 (1%)
 Frame = +1

Query: 964  EYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLK---NFNAAEDEKYNTKKQEYEDKLVELQ 1134
            EYL R  + +I +KA YD  N    LHS++ K     + +  E Y  K +  E+++  L+
Sbjct: 1324 EYLKR--QLDIETKAHYDAENAISALHSKFRKIQAEGSMSSSEIYKLKFEASEERVKSLE 1381

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             +L                             + ++ + N+  G +IK            
Sbjct: 1382 DKL---------------------------KTMPLRDRTNLPVGDIIKN----------- 1403

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 1494
              D ++K  +              I NE N   G +  LT  L +  +K   ++E   R+
Sbjct: 1404 -RDSISKYEEEIRYYKLENYKLQEILNESN---GKMSQLTLDLRQSKSKDALLSEQLERL 1459

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-KDYLPRLNEIDEQIAAKFDKL 1671
            QKD+E  + +K  L + IK  +++ +   D LQ   +  ++++  L + +E +      +
Sbjct: 1460 QKDLESTERQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIHALKQAEEDV----KNM 1515

Query: 1672 AIIKNETISENNQLSILTKKLEEER 1746
            A I  +  ++N Q   L  + E ER
Sbjct: 1516 ASIIEKLKTQNKQKEKLIWEREMER 1540

 Score = 35.4 bits (80), Expect = 0.61
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 4/103 (3%)
 Frame = +1

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLN 1632
            + + +  NE   +++ D++ ++ KK  LE   K+ +  D+L KD  + LN EK+ L R  
Sbjct: 860  MTRTKKFNEQINKLKNDLQEMESKKKFLEE--KNRKTIDEL-KDTHELLNQEKENLKRNE 916

Query: 1633 EIDEQIAAKFDKLAIIKNETISE----NNQLSILTKKLEEERI 1749
             +  +I      L    N+ +SE    N Q   + +KLEE  +
Sbjct: 917  NLLNRIKTSSGTLQKQFNDLVSEKDEINRQKLQIMQKLEESEL 959

>Skud_16.39 Chr16 complement(70011..72143) [2133 bp, 710 aa] {ON}
            YMR186W (REAL)
          Length = 710

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E +  ++  +   I++L  K++  E  I + E KD+ NKD  +K   E D  
Sbjct: 185  LEEKKIK-EVVKRHSEFVAYPIQLLVTKEVEKEVPIAEEENKDEENKDEEKK--DEDDKK 241

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNE 1689
            P+L E+DE+   K  K   +K E
Sbjct: 242  PKLEEVDEEEEEKKPKTKKVKEE 264

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
            Anc_8.604 YOR195W
          Length = 791

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 61/283 (21%), Positives = 107/283 (37%), Gaps = 17/283 (6%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            +   +N + L + NE         +Q     K   E    FNA  +E Y TK +EY+ K+
Sbjct: 458  IKEQQNTQDLTKENE------KYREQFESLFKEKDELTNKFNAMNEE-YLTKIEEYQQKV 510

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYN-VDKGKVIKETELMKL 1299
            +E + +L                             ++++ KYN V      K   +  L
Sbjct: 511  IEAETEL-----------------------------INIREKYNAVTVELEAKNGSMASL 541

Query: 1300 QKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINE 1479
            +K + + D   K                  TNEY     ++  L  ++ E   K E +  
Sbjct: 542  KKTSEELDDANKIKAAEVTELNDDLAEIKETNEY--LEKSVSKLEKVVSEWKVKYETLQS 599

Query: 1480 NNMRIQKDIEVLQVKKLNLENE-IKD----HEEKDKL------NKDVLQKLNVEKDYLPR 1626
            +  +   ++E  Q+K  N+E E +K+    HE    L      N D++  L +E + L  
Sbjct: 600  DYDKASLELESFQLKNDNIETEHLKELEDLHESMSSLQSALKDNSDLVHTLKIENETLKS 659

Query: 1627 LNEIDEQI-----AAKFDKLAIIKNETISENNQLSILTKKLEE 1740
                +EQ+       K +K+  I+ E   +   +  L K+L+E
Sbjct: 660  DLSRNEQMLKTATLEKDNKIVSIETEGTDKEQTIISLKKQLDE 702

>NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8.604
            YOR195W
          Length = 846

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 50/255 (19%), Positives = 101/255 (39%), Gaps = 35/255 (13%)
 Frame = +1

Query: 1081 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVD 1260
            E ++ K ++ ++++ +L  + DD                + +   L +N   +Q+KY+  
Sbjct: 360  EVFDEKTKDLKEQINQLSMERDDLSTRRENLKTKLKSCKDEL-LMLNQNQTILQNKYDT- 417

Query: 1261 KGKVIKETELMK-------LQKINAKEDLLAKQLD----------VXXXXXXXXXXXXAI 1389
               V+ E ++ K       L+    K++L  K  +          +             +
Sbjct: 418  ---VVNECDIWKNNYQTLELESTKLKDELKLKDTELNSISSQLNEIDRHMSELGDENVRL 474

Query: 1390 TNEYNIWNGNLENLTTLLDEKIAKIEA-------------INENNMRIQKDIEVLQVKKL 1530
             NE    N NL+ +   L  K ++++              INE +  ++++ E L ++K 
Sbjct: 475  KNENESLNSNLKIIEEKLHSKKSEVDQLNKTIEESLETQRINETSKNLKEEYETLLLEKE 534

Query: 1531 NLENEIKDHEEKD-----KLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETI 1695
             LE +  +  E+      +L  D+  K N  KD     NEI EQ+  K  +L  +K +  
Sbjct: 535  ELEKKTNEQIEEHNRTIFELRNDITAKENEFKDLQDTKNEIQEQLETKTKELEELKIQYE 594

Query: 1696 SENNQLSILTKKLEE 1740
              N+  +I   ++ E
Sbjct: 595  DVNDDANIKGAEVSE 609

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 1/109 (0%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            ENL T L     ++  +N+N   +Q   + +  +    +N  +  E +    KD L+  +
Sbjct: 388  ENLKTKLKSCKDELLMLNQNQTILQNKYDTVVNECDIWKNNYQTLELESTKLKDELKLKD 447

Query: 1603 VEKDYLP-RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
             E + +  +LNEID  ++   D+   +KNE  S N+ L I+ +KL  ++
Sbjct: 448  TELNSISSQLNEIDRHMSELGDENVRLKNENESLNSNLKIIEEKLHSKK 496

>TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {ON}
            Anc_5.296 YDR285W
          Length = 881

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 60/249 (24%), Positives = 106/249 (42%), Gaps = 13/249 (5%)
 Frame = +1

Query: 1048 EWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKN 1227
            E LK F     E  N  KQ Y+D +V L K+                    + +     +
Sbjct: 379  EILKTFEIKLKENENNIKQNYQDDVVIL-KEFCKTENNNIINSINSSFSNTVSDSS---S 434

Query: 1228 VLDVQSKYNVDKG--KVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEY 1401
             L+     N+  G  KVI+ +  MK    N  +++  + ++             ++ +EY
Sbjct: 435  TLEKSIMQNIHNGNDKVIENSNNMK----NCIDEVKIQLVEDRNQINAEISKFSSLMSEY 490

Query: 1402 NIWNGNLENLTTLLDE-KIAKIEAINENNMRIQKDIEVL-QVKKLNLENEIKDHEEK--- 1566
              +   LE ++    E KI K + +     +  +  E+L QV  L L     +  EK   
Sbjct: 491  KEFEKKLETVSQENTELKIQKTQLLTSIGTKEAQYEELLNQVGNLKLSTTTLEENEKCLK 550

Query: 1567 DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD-KLA---IIKNETISENNQLSILTKKL 1734
            D+  K +L+K++  +  + RL  ++   +A ++ KLA    I N   SEN+ L  + K+L
Sbjct: 551  DQTEK-LLEKVSEYEKSIERLKNLESNSSANYENKLASQVTISNTLTSENDMLKNMVKRL 609

Query: 1735 EE--ERIAH 1755
            EE  E+++H
Sbjct: 610  EESKEQLSH 618

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 40.8 bits (94), Expect = 0.013
 Identities = 40/187 (21%), Positives = 82/187 (43%), Gaps = 12/187 (6%)
 Frame = +1

Query: 1219 VKNVLDVQSKYN-VDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITN 1395
            +K++ + Q   N ++      +T+L+ L+  N + +L   +L              A  N
Sbjct: 631  IKDIENTQLSINTINNENTNLQTQLVTLENTNKESELKLNELT-------------AQFN 677

Query: 1396 EYNIWNGNL-ENLTTL------LDEKIAKIEAINENNMRI----QKDIEVLQVKKLNLEN 1542
            E    N  L E +TT+      L+ KI +++++ +    +     K +E+ ++    L  
Sbjct: 678  ESQKLNDELKEKMTTINTTTNDLENKIEELKSVYQKEKSMTDVNSKQLELKEINVETLNT 737

Query: 1543 EIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSIL 1722
            E+ D +EK  +    L+K     DY  ++ +   Q+ + + +LA   NE     N+L + 
Sbjct: 738  ELSDLQEKIDI---YLKKQKELDDYKTQVEQQHAQLESTYQQLATKTNELNERQNELDLQ 794

Query: 1723 TKKLEEE 1743
             K + E+
Sbjct: 795  NKNIVEQ 801

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 40.8 bits (94), Expect = 0.014
 Identities = 73/321 (22%), Positives = 132/321 (41%), Gaps = 33/321 (10%)
 Frame = +1

Query: 883  TAKAGASNMTLGVAVPETHAVASPENPEY--LVRTNEYNIVS---------------KAV 1011
            +AKA ASN T  VA  +   +   +  E    +R NE NI +               KA 
Sbjct: 1522 SAKADASN-TENVAAQQRIDILKADLGEQDKKIRENEANIETLINEKEKLLLELKRVKAN 1580

Query: 1012 YDQMNYEQKLHSEWLKNFNAAEDEKYNTKK-----------QEYEDKLVELQKQLDDXXX 1158
             ++   E K   + LK     + +++  ++           Q+Y DK+ EL+++L+    
Sbjct: 1581 MEKSGKEHKEEMQKLKTDLKVKTQEFEKERKMLNEGSSSITQKYSDKVTELEEKLE---- 1636

Query: 1159 XXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM---KLQKINAKEDLL 1329
                         E M+    K  L+ Q K   D+ K ++E +L+   K  K++AKE  L
Sbjct: 1637 KSDNDIKSKLEIIEEMKTDFDKR-LEAQQKLADDQVKEVEELKLIISSKSSKLDAKEAEL 1695

Query: 1330 AKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI-NENNMRIQKDI 1506
                D              + +E  +    LEN  +  ++ +A+ E+   E   ++   +
Sbjct: 1696 KNTKDT----------NEKLLSELKLQISTLENKISAKEKALAETESTGKEKEKQLNSQL 1745

Query: 1507 EVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKN 1686
            E LQ      E ++   + KD ++    Q   V+KD   + NE  + +A          N
Sbjct: 1746 EALQE-----EVKLAGKKAKDSVSGLETQLNLVKKDVESKNNENSKLVA---------DN 1791

Query: 1687 ETIS-ENNQLSILTKKLEEER 1746
            +T+  EN++L  + +K+ EE+
Sbjct: 1792 KTLQLENSKLLAIKEKIIEEK 1812

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 66/324 (20%), Positives = 132/324 (40%), Gaps = 25/324 (7%)
 Frame = +1

Query: 820  PKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVA-SPENPEYLV------- 975
            PK N   SI+  I   K   +       N+T G  +    +V  S  NP  +V       
Sbjct: 24   PKPNNEVSIRRTIGLKKDDYQI---NDRNITRGDMIRMLESVGFSMSNPYNIVPQGKIIA 80

Query: 976  ----RTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ--EYEDKLVELQK 1137
                +  E  ++ + V    ++E KL +  LK  +  E +++   K+  E E+KL E+++
Sbjct: 81   LTNAKDKERLLLLEEVVGAKSFENKLQASLLK-MDETEQKRFQINKEMKELENKLNEMEQ 139

Query: 1138 QLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAK 1317
            +  +                 + + +L  ++++   K +++   ++  +E   LQ+++ K
Sbjct: 140  EKIELEKYNNLEKNKKVIQFNLYDREL-NDIINQIEKLDIEYNSILISSEKY-LQELD-K 196

Query: 1318 EDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQ 1497
             +L+ +QL +             I +E  I N +             + E +N     I 
Sbjct: 197  RELIIEQLKMKLNH---------IEDELKIKNQS-------------EFEELNNTKDAIS 234

Query: 1498 KDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQ-----------KLNVEKDYLPRLNEIDE 1644
            + I   Q+K    EN+IK ++ + K+N   L+           +LN  K     LN +++
Sbjct: 235  QKITNYQIKIKEFENKIKTNKSQLKINNQNLKLLDELINEKQLELNEIKPQYEELNNVNQ 294

Query: 1645 QIAAKFDKLAIIKNETISENNQLS 1716
             +  + +KL   +   I +NN+ S
Sbjct: 295  DLKFEINKLKDQEKILIIKNNKYS 318

>CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} similar to
            uniprot|P34216 Saccharomyces cerevisiae YBL047c
          Length = 1311

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 67/325 (20%), Positives = 131/325 (40%), Gaps = 15/325 (4%)
 Frame = +1

Query: 826  TNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSK 1005
            TNA  S  + I+GA G+      GA     G A        S  N +          +S 
Sbjct: 539  TNAAGSGINAITGATGA---VLGGAIGAVAGAATGTVSGAISGANRDIFADGESSRQLST 595

Query: 1006 AVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXX 1185
            A  D  N   + +S  L N      EK +   QE + ++ E++  ++             
Sbjct: 596  ATTDLANLSNQANS--LSNQAGIASEKKSKVSQELQ-RVNEMKANIESKLATLRAKYDQD 652

Query: 1186 XXXXEIMEYQLVKNVLDVQS----------KYNVDKGKVIK-ETELMKLQKINAKEDLLA 1332
                E ME QL +   +V++           Y+  + K+ + +T+  + Q+ N+K     
Sbjct: 653  VKATEEMETQLTQTNREVETLNQQLGVVEANYHATESKLNELKTQYEEAQQKNSK----- 707

Query: 1333 KQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEK--IAKIE-AINENNMRIQKD 1503
                              +  +   +N  + ++   L+EK  +AK E ++ + NM   K 
Sbjct: 708  ------------------LKEDIANFNTMIASMEAQLNEKKQVAKQELSVVDVNM---KQ 746

Query: 1504 IEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIK 1683
            +E+ Q+    +E EI   +E+  +  +  ++L+   +Y   + +   Q+ AK+ +++   
Sbjct: 747  LELNQITVAGIEKEISGLDEQVNVYVNKRKELD---EYKKTIEDQHAQLQAKYQEISDKN 803

Query: 1684 NETISENNQLSILTKKLEE-ERIAH 1755
            NE     N+L    +++EE E++ H
Sbjct: 804  NELTERQNELDERNQQIEEQEKLYH 828

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 45/206 (21%), Positives = 89/206 (43%), Gaps = 16/206 (7%)
 Frame = +1

Query: 1018 QMNYEQKLHSEWLKNFNAAEDE--KYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXX 1191
            QMN   K + E LKN  A++++  K N +K+ Y+ + V L++Q  +              
Sbjct: 434  QMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELED 493

Query: 1192 XXEIMEY------QLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXX 1353
              + +         L KN  + +S+ +    ++  E  L++  KI+ K+  +    ++  
Sbjct: 494  CNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQ 553

Query: 1354 XXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIE----VLQV 1521
                          E   WN  L+   + +  K ++I  I E  ++++ DIE    ++ V
Sbjct: 554  HE-----------KELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLISV 602

Query: 1522 K---KLNLENEIKD-HEEKDKLNKDV 1587
            K   K++ E EI     E +++ K+V
Sbjct: 603  KIEEKISREKEIGSLRNELNRITKEV 628

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 25/84 (29%), Positives = 48/84 (57%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            L+++K  +IEA+NE  +  +   E++  +K +LE+  KD E  + L K+    L   K Y
Sbjct: 339  LIEKKFEEIEALNEICIEKENRFEIVDREKASLESG-KD-EALEFLEKEKELTLVKSKLY 396

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNE 1689
              +L + +++++   +KL+ IK E
Sbjct: 397  QYKLWQDNKKLSTTLEKLSNIKEE 420

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 40.4 bits (93), Expect = 0.018
 Identities = 46/271 (16%), Positives = 119/271 (43%), Gaps = 10/271 (3%)
 Frame = +1

Query: 964  EYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQL 1143
            EY+   ++ NI    +Y+ +  EQKL  +  +N    E +K +++K      + +LQ   
Sbjct: 730  EYISCKSKLNICETELYN-LKEEQKLKIDSEQNLKQ-EMQKLSSEKTGLRIMVTQLQTLQ 787

Query: 1144 DDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKED 1323
             +                + +E+    N L  ++ +   + K ++E     ++    K +
Sbjct: 788  KERENLLDETRKSYQNKIDELEH--AHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845

Query: 1324 LLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINE-----NNM 1488
            +L K  +                 E       +++L   +DE   ++   N      N+ 
Sbjct: 846  VLKKDNESIICSMNDKQA------EIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDD 899

Query: 1489 RIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-----KDYLPRLNEIDEQIA 1653
             ++K++E  ++   +  ++I++++E  + N   L++++ +     KD+  R+  +  + +
Sbjct: 900  SLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKS 959

Query: 1654 AKFDKLAIIKNETISENNQLSILTKKLEEER 1746
            +  +K++++K +  + NN+L +  K ++EE+
Sbjct: 960  SLEEKISLLKEQIFNLNNELDLQNKGMKEEK 990

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 60/311 (19%), Positives = 117/311 (37%), Gaps = 3/311 (0%)
 Frame = +1

Query: 823  KTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVS 1002
            +TNA  S+K + S  + S+K       N+T        +  +S E    L++   +N+ +
Sbjct: 927  ETNAK-SLKQMHSKFEESSKDFSNRIKNLT--------NEKSSLEEKISLLKEQIFNLNN 977

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTK--KQEYEDKLVELQKQLDDXXXXXXXXX 1176
            +        +++  +E+ K  +  ++     +  K EYE KL ++QK LD          
Sbjct: 978  ELDLQNKGMKEE-KAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQ--------- 1027

Query: 1177 XXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXX 1356
                   + +     +N  + + + + D  K I E           +E L   ++ V   
Sbjct: 1028 -------QTIYANTAQNNYEQELQKHADVSKTISE----------LREQLHTYRVQVNTL 1070

Query: 1357 XXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNL 1536
                      +      W    + L   L+   ++IE +   N  +   IE+        
Sbjct: 1071 TLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELY----TTA 1126

Query: 1537 ENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF-DKLAIIKNETISENNQL 1713
            +  + D  +K  LN  +L  L  E+D L     + E+ A     K++++  E      +L
Sbjct: 1127 DKGVTDTNDKPALN-SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKL 1185

Query: 1714 SILTKKLEEER 1746
                 +LEEE+
Sbjct: 1186 D--NSRLEEEK 1194

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 40.4 bits (93), Expect = 0.018
 Identities = 52/255 (20%), Positives = 110/255 (43%), Gaps = 8/255 (3%)
 Frame = +1

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXX 1182
            +A+ +    E +L  + LKN + + DE+     +E + +++E++K+ D+           
Sbjct: 1154 EAISNSKELENEL--DQLKNKHKSLDEQNTKSVEELKTRVLEVEKERDEKHNNVQKIENK 1211

Query: 1183 XXXXXEIMEYQLVKNVLDVQSKYNVDKGK---VIKETELMKLQKINAKEDLLAKQLDVXX 1353
                 + +E  L K+    +SK  V + K   +++E   +  +K N KE+    + D   
Sbjct: 1212 LQEESKSLE-SLQKSQESNKSKLKVLQDKLDSLLQEKNDLVSEKNNLKENFAKVKEDFEE 1270

Query: 1354 XXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN 1533
                      +   + +  +   +     LD K  +I  +  +   + K+++ LQV   N
Sbjct: 1271 SQRKIHGLKESEKKKNHELHELQKKFKGELDVKQKQIADLERSREEVDKNLKNLQVDVKN 1330

Query: 1534 LENEIKDHEEKDKLNKDVLQKLNVEKDYLP-RLNEIDEQIAAKFD----KLAIIKNETIS 1698
            +  E          NK V++KL  EK+ L   LN++ +      D    K+  ++ +   
Sbjct: 1331 VSEE----------NKKVIEKLEKEKEALSLELNKLRKSSKENLDDRDKKIKDLEGKETK 1380

Query: 1699 ENNQLSILTKKLEEE 1743
             +++L+ LT K +E+
Sbjct: 1381 LSSELNQLTNKFKED 1395

 Score = 39.7 bits (91), Expect = 0.031
 Identities = 64/319 (20%), Positives = 131/319 (41%), Gaps = 23/319 (7%)
 Frame = +1

Query: 865  AKGSNKTAKAGASNMT-LGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKL 1041
            +K      K+  SN + L V   +  ++   +N     + N     +K   D    ++K+
Sbjct: 1216 SKSLESLQKSQESNKSKLKVLQDKLDSLLQEKNDLVSEKNNLKENFAKVKEDFEESQRKI 1275

Query: 1042 HSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQL- 1218
            H   LK     ++ + +  +++++ +L   QKQ+ D                 +   Q+ 
Sbjct: 1276 HG--LKESEKKKNHELHELQKKFKGELDVKQKQIADLERSREEVDK------NLKNLQVD 1327

Query: 1219 VKNVLDVQSKY--NVDKGKVIKETELMKLQKINAK--EDLLAKQLDVXXXXXXXXXXXXA 1386
            VKNV +   K    ++K K     EL KL+K + +  +D   K  D+             
Sbjct: 1328 VKNVSEENKKVIEKLEKEKEALSLELNKLRKSSKENLDDRDKKIKDLEGKETKLSSELNQ 1387

Query: 1387 ITNEYNIWNG-NLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK---- 1551
            +TN++   +  N EN+  L +EK    +   E     + D+E  + K  +LEN +K    
Sbjct: 1388 LTNKFKEDSKKNQENIQHLEEEKKIITDQRAELQKNSKMDLEKKEKKIRDLENSVKRISS 1447

Query: 1552 -----------DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF-DKLAIIKNETI 1695
                       D EE + + KD+ +K+   +     LNE  + +  ++ +++ +++++  
Sbjct: 1448 ELSKLQKSSQNDKEEVESVKKDLQEKVQAFEKERKLLNEGSDAVTKQYSERITVLEDKVH 1507

Query: 1696 SENNQLSILTKKLEEERIA 1752
                ++    K+LE  + A
Sbjct: 1508 QTELEVQRKNKELESAKSA 1526

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +1

Query: 1432 TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
            T+LLD +  K+ ++NE + ++ K+ EVLQ        ++    ++ K  +D LQ +  E+
Sbjct: 714  TSLLDLE-KKLHSLNEEHEKLNKEHEVLQKDHSEASEQLSKIRQECKELRDTLQAVTNER 772

Query: 1612 DYLPRLN 1632
            D L   N
Sbjct: 773  DNLSSEN 779

>KNAG0D00670 Chr4 complement(98205..99818) [1614 bp, 537 aa] {ON}
            Anc_6.289 YMR198W
          Length = 537

 Score = 40.0 bits (92), Expect = 0.019
 Identities = 54/248 (21%), Positives = 106/248 (42%), Gaps = 16/248 (6%)
 Frame = +1

Query: 1048 EWLKNFNAAEDEKYNTKKQEYEDKLVELQKQL----DDXXXXXXXXXXXXXXXXEIMEYQ 1215
            E+  N   A   K   + + +ED +    +QL    ++                 ++E +
Sbjct: 4    EYQLNRRVAMCRKVTVQCERFEDGMNHCSEQLTSIEEEFKSTEEKLKVDFANDKSLLEEK 63

Query: 1216 LVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITN 1395
              +++ ++ S YN          ELM+L+KI AK++L  +                    
Sbjct: 64   FAESINEMSSNYN---------HELMELEKITAKDELEVEM------------------- 95

Query: 1396 EYNIWNGNLENLTTLLDE----KIAKIEAINENNMRIQKDIEVLQVKK-----LNLENEI 1548
                 N   ++L  LL++    K++  +A+ +    + ++ E  +++K     L + N  
Sbjct: 96   -----NRLRKDLIDLLEDCDTLKLSNEKAVAQKGKTLAEEFEQHKLEKNSSLELLITNYK 150

Query: 1549 KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA---AKFDKLAIIKNETISENNQLSI 1719
            +  +EK  L  D  Q      +   RLN+++++IA   ++ DK A+ + E I EN +L+I
Sbjct: 151  QSMDEKISLLNDTAQLRQQNSEMEKRLNDLEKEIAQITSEIDK-AVSEKEAI-ENEKLNI 208

Query: 1720 LTKKLEEE 1743
              K +EEE
Sbjct: 209  -EKNIEEE 215

>CAGL0L00495g Chr12 complement(55122..57239) [2118 bp, 705 aa] {ON}
            highly similar to uniprot|P15108 Saccharomyces cerevisiae
            YMR186w HSC82 heat shock protein or uniprot|P02829
            Saccharomyces cerevisiae YPL240c HSP82
          Length = 705

 Score = 40.0 bits (92), Expect = 0.020
 Identities = 27/98 (27%), Positives = 49/98 (50%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            E+    L+EK  K E + +++  +   I+++  K++  E  + + E+KD+  KD      
Sbjct: 178  EDQLEYLEEKRIK-EVVKKHSEFVAYPIQLMVTKEVEKEVPVTEEEKKDEEKKD------ 230

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
             E D  P+L E+DE    K +K      ET+ E  +L+
Sbjct: 231  -EDDKKPKLEEVDEDEEKKDEKKTKTVKETVKELEELN 267

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 26/111 (23%), Positives = 60/111 (54%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            +N+  L  E+ +K  +++ N+ +++KD E ++    NL++++     ++KL +D + KL+
Sbjct: 368  DNIKQLKSERDSKYVSLDTND-KVRKDFERMRENNANLDSKLSQISNENKLFRDKISKLS 426

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
             + D   R  E D Q+     ++  I      EN+  +  ++++ E++ AH
Sbjct: 427  NQLDDTKR--ERDNQVELMKRRIDEIITNNNRENSIAADKSEEIREKQEAH 475

>Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356W
            (REAL)
          Length = 947

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 56/264 (21%), Positives = 114/264 (43%), Gaps = 32/264 (12%)
 Frame = +1

Query: 1054 LKNFNAAEDEKYNTKKQEYE---DKLVELQKQLDDXXXXXXXXXXXXXXXXEI---MEYQ 1215
            LKN +  +D +   K+ E +   +KL EL+K+L++                     +E +
Sbjct: 312  LKNESDEKDSQLQQKESELKRLTNKLNELEKRLNENSSQSSAKESELKESKSQITELEEK 371

Query: 1216 LVKNVLDVQSKYNVDKGKVIKETEL-----MKLQKINAKEDLLAKQLDVXXXXXXXXXXX 1380
            + K    +++K N  K  + + T+L      K  ++ +KED L K ++            
Sbjct: 372  INKKNSQLETKENELKSLMAQLTQLENRLNQKDSQLGSKEDEL-KTINEKLQRDIKIARQ 430

Query: 1381 XAITNEYNIWN-----GNLENLTTLLDEKIAKIEAINENNMR--------IQKDIEVLQV 1521
               + +  I+       NLEN  +++ +   + +++  + +         ++ D+EV Q 
Sbjct: 431  ETASKDERIYALQMKIQNLENDLSMMKKTHNESKSVTNDELESKSKVIKILETDLEVAQE 490

Query: 1522 KKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAK--------FDKLAI 1677
            K L L++E+K+ E + K+++  L+  N+      RLNE    +A +         DK   
Sbjct: 491  KYLKLQSELKERENRYKISESNLEDENI------RLNERISDLARENSRLKSTVDDKSTA 544

Query: 1678 IKNETISENNQLSILTKKLEEERI 1749
            +     S   +L  L K++EE ++
Sbjct: 545  VYRMKESYEARLDSLRKEVEEYKV 568

 Score = 39.3 bits (90), Expect = 0.037
 Identities = 65/266 (24%), Positives = 108/266 (40%), Gaps = 16/266 (6%)
 Frame = +1

Query: 1000 SKAVYDQM-NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXX 1176
            S AVY    +YE +L S         E E+Y    ++ E K+ EL+  + +         
Sbjct: 542  STAVYRMKESYEARLDSL------RKEVEEYKVNAEKSESKVEELRIMITENSARVSEKR 595

Query: 1177 XXXXXXXEIMEYQLVKNVLDVQSKYNVDKG---KVIKETELMKLQKINAKEDLLAKQLDV 1347
                   E    +L  N+   + + +  K    K  KE    K ++ N +  L  + L++
Sbjct: 596  SKEMKEKERKNKELTDNLKMQEDEISSLKAMIEKYKKEFSQSKSEQSNIQRTLNLQILNL 655

Query: 1348 XXXXXXXXXXXXAITN----EYNIWNGNLENLTT----LLDEKIAKIEAINENNMRIQKD 1503
                        ++ +    E + W     NL+     LL+EK +  +  +E ++ + + 
Sbjct: 656  ENKLIESEDELKSLRDSQETEIDNWKRKYNNLSLENDRLLEEKASASDKEHEVSI-LNRK 714

Query: 1504 IEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR----LNEIDEQIAAKFDKL 1671
            I+ L+ +K NL+        K+K  K  LQK+    D L R    LNE    I    +K+
Sbjct: 715  IDELEKEKWNLQ------ASKEKY-KHELQKVITANDRLRREKEELNENSGTIRMMEEKM 767

Query: 1672 AIIKNETISENNQLSILTKKLEEERI 1749
            A IK   +SE   L    +KLEE  I
Sbjct: 768  ARIKKNYLSEITSLQDENRKLEERLI 793

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 9/107 (8%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKD------ 1584
            E LT+ LDE +    A+ E   +++K I  L+ K       IKD  E + L K+      
Sbjct: 1496 EILTSQLDEAVTSTSALLEEQTKLKKSISDLEAKN------IKDCGEMEILRKELSKCQE 1549

Query: 1585 ---VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
               V Q+LN EKD   +  E D  I +   ++  +K E  ++N+++S
Sbjct: 1550 SLKVSQRLNEEKDEANKRTETD--IVSLQKEINTLKEELRTKNDEIS 1594

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 8/119 (6%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            LE  T  +  ++ KI  +NE  ++ + DIE  ++KK   E++    E+ DK+  ++  K 
Sbjct: 1306 LEAKTAEVKNQLEKISNLNE--LKEKSDIEFTRLKKTWSEDKKNMEEQLDKVKNEMQIKN 1363

Query: 1600 NVEKDYLPRLNEIDEQIAAKF--------DKLAIIKNETISENNQLSILTKKLEEERIA 1752
               +     LNE    I  ++        DKL I++NE  S+  Q+  +   LE   ++
Sbjct: 1364 QAFEKERKLLNEGSSTITQEYSEKINMLEDKLMILQNENESKTKQIDAVRNDLERATLS 1422

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 39.7 bits (91), Expect = 0.031
 Identities = 73/371 (19%), Positives = 149/371 (40%), Gaps = 37/371 (9%)
 Frame = +1

Query: 739  QDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKA-GASNMTL 915
            QD V  ++ S+  +              K      I +L + +KGS++  +   A  + L
Sbjct: 986  QDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKL 1045

Query: 916  GVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAE------ 1077
               + +  + A+     Y     + + VSK + +     QK      +  N+ E      
Sbjct: 1046 QRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVL 1105

Query: 1078 ---DEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSK 1248
               ++ ++ +K+EYE +L   ++ L+D                   +  L+ + +++ SK
Sbjct: 1106 EQNEKSWSAQKEEYERQLETSRQHLEDLS----------------TQNSLLYDQIELFSK 1149

Query: 1249 YNVD--KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXA-ITNEYNIWNGN 1419
             N D   G+  +  E+  L  +  + D+L  +L V            A + NE +     
Sbjct: 1150 DNSDGVNGETAEVREI--LTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQ 1207

Query: 1420 L----ENLTT---------LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE 1560
            L    + +TT          + E++ ++  + E+N+ ++   E    K   L+ E+    
Sbjct: 1208 LSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLR 1267

Query: 1561 EK--------DKLNKDVLQK---LNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENN 1707
            E+        + L+  VL+K   LN+ K+   R  E  ++I  K D++    ++ + E  
Sbjct: 1268 ERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKE-- 1325

Query: 1708 QLSILTKKLEE 1740
            ++SIL  KL+E
Sbjct: 1326 KVSILETKLDE 1336

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 39.7 bits (91), Expect = 0.031
 Identities = 54/264 (20%), Positives = 106/264 (40%), Gaps = 13/264 (4%)
 Frame = +1

Query: 997  VSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE---DKLVELQKQLDDXXXXXX 1167
            V++     +  EQKL  +  K+    E +K +++K        +L  LQK+ +D      
Sbjct: 744  VTETALSNLKLEQKLKIDSEKSLKQ-ELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEAR 802

Query: 1168 XXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLD- 1344
                      +I E +   N L V++ +       ++E    K++    K + L K  D 
Sbjct: 803  KSCQN-----KINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDS 857

Query: 1345 VXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVK 1524
            V             +  +       +E     L       E IN++++R +     L++ 
Sbjct: 858  VMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKE-----LEMS 912

Query: 1525 KLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEI---------DEQIAAKFDKLAI 1677
            K+NL       +E  KL +   Q L      L   NE          DE+I  + DK+++
Sbjct: 913  KINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLE-DKVSL 971

Query: 1678 IKNETISENNQLSILTKKLEEERI 1749
            +K ++ + NN+L +   ++E++++
Sbjct: 972  LKEQSFNLNNELDLQKNEMEKKKV 995

 Score = 33.1 bits (74), Expect = 3.1
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI--KDHEEKDKLNKDVLQK 1596
            E L  L D K+A   ++N+ N RIQ ++E  +V + N  +E+  +  E+ +K ++++ +K
Sbjct: 1353 EQLNELKDAKVALERSLNDANTRIQ-ELEGEKVAEDNNRSEMIKRSQEDAEKSSRELEEK 1411

Query: 1597 LNVEK-DYLPRLNEIDEQIA 1653
            L      Y   + +++E+IA
Sbjct: 1412 LEENAISYSSTVRKLNEEIA 1431

>Smik_13.391 Chr13 (616728..618860) [2133 bp, 710 aa] {ON} YMR186W
            (REAL)
          Length = 710

 Score = 39.3 bits (90), Expect = 0.035
 Identities = 28/83 (33%), Positives = 44/83 (53%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E I  ++  +   I++L  K++  E  I + E+KD+  KD  +K   E D  
Sbjct: 185  LEEKRIK-EVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKDEEKK--DEDDKK 241

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNE 1689
            P+L E+DE+   K  K   +K E
Sbjct: 242  PKLEEVDEEEEEKKPKTKKVKEE 264

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
            ZIP1Transverse filament protein of the synaptonemal
            complex; required for normal levels of meiotic
            recombination and pairing between homologous chromosome
            during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 59/263 (22%), Positives = 116/263 (44%), Gaps = 12/263 (4%)
 Frame = +1

Query: 979  TNEYNIVSKAVYDQMNYEQKL---HSEWLKNFNAAED--EKYNTK---KQEYEDKLVELQ 1134
            T+  NI +  V +  N  Q+L    S+  KN+ + E+  + Y  +     EYE+++  L+
Sbjct: 448  TSSGNIQTALVSEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYEERIKHLE 507

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             +                      + Q++ ++   +++Y     K+  E + +++ +I+ 
Sbjct: 508  SERSTLSS---------------QKNQIISSLGTKEAQYEDLVKKL--EAKNIEISQISG 550

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWN-GNLENLTTLLDEKIAKIEAINENNMR 1491
            KE  L ++ +                N  NI    N EN  +  +E +  +  ++EN+  
Sbjct: 551  KEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKAL--VSENDTL 608

Query: 1492 IQKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
             Q+  +++++K    ENE KDH  K +    N + LQKLNVE   L + +E++ +   + 
Sbjct: 609  KQRIQQLVEIK----ENEQKDHTTKLEAFQKNNEQLQKLNVEVVQL-KAHELELEEQNRH 663

Query: 1663 DKLAIIKNETISENNQLSILTKK 1731
             K  + K ET  E +   + T K
Sbjct: 664  LKNCLEKKETGVEESLSDVKTLK 686

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
            EDE1Endocytic protein; involved in a network of
            interactions with other endocytic proteins, binds
            membranes in a ubiquitin-dependent manner, may also bind
            ubiquitinated membrane-associated proteins; interacts
            with Cmk2 and functions upstream of CMK2 in regulating
            non-apoptotic cell death
          Length = 1381

 Score = 39.3 bits (90), Expect = 0.039
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 17/174 (9%)
 Frame = +1

Query: 1273 IKETELMKLQ--KINAKEDLLAKQLDVXXXXXXXXXXXX----AITNEYNIWNGNLENLT 1434
            +K+TE ++ Q  ++N + + LA+QL V                    E    N  L+   
Sbjct: 659  VKQTEQLEAQVLQVNKENETLAQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQI 718

Query: 1435 TLLDEKIAKIEA-INENNMRIQ----------KDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
            T L+   A +++ +NE   +++          K +E+ QV   NL+ EI    EK  +  
Sbjct: 719  TNLNSMTASLQSQLNEKQQQVKQERSMVDVNSKQLELNQVTVANLQKEIDGLGEKISVYL 778

Query: 1582 DVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
               ++LN   DY   + E   Q+ AK+  L+    +      QL    +++EE+
Sbjct: 779  TKQKELN---DYQKTVEEQHAQLQAKYQDLSNKDTDLTDREKQLEERNRQIEEQ 829

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score = 39.3 bits (90), Expect = 0.040
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1231 LDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQL-DVXXXXXXXXXXXXAITNEYNI 1407
            L+   K  +D  K + E    + +K++ K  LL KQ  +                +E   
Sbjct: 1172 LEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKA 1231

Query: 1408 WNGNLENLTTLLDEKIAKIE-AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKD 1584
             N  LE +    D+KI +IE  + EN  +  KD      +KL  E   K++E K      
Sbjct: 1232 SNLQLEEVMKEKDKKIREIELTLKENLEKFDKD------EKLVSEKTFKENEAKLNKTIT 1285

Query: 1585 VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
            +LQKLN           +++++ +  +++ +++ +   E NQL I T KL+ ER
Sbjct: 1286 MLQKLN---------ETLNQEVVSLREEINVLRKKD-DETNQL-ISTMKLDFER 1328

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 39.3 bits (90), Expect = 0.040
 Identities = 27/126 (21%), Positives = 65/126 (51%), Gaps = 11/126 (8%)
 Frame = +1

Query: 1402 NIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVL-QVKKLNLE-----NEIKDHEE 1563
            ++ N  LE        +I   E IN+NN   Q++ +V+ +++K  +E     +++++ + 
Sbjct: 886  HLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKN 945

Query: 1564 KDKLNKDVLQKLNV-----EKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
              + ++D L++LN      ++DY   +  + E+      +  I+K +  +  N+L++ ++
Sbjct: 946  LSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSE 1005

Query: 1729 KLEEER 1746
            + E ER
Sbjct: 1006 EAESER 1011

 Score = 36.6 bits (83), Expect = 0.27
 Identities = 62/263 (23%), Positives = 105/263 (39%), Gaps = 41/263 (15%)
 Frame = +1

Query: 1078 DEKYN---TKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIME-YQLVKNVLDVQS 1245
            D K N   T+K   + KL ++Q +L++                +++  YQ ++   D++ 
Sbjct: 1177 DTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRG--DLEQ 1234

Query: 1246 KYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLE 1425
               + +  V    EL   Q ++ K D +AK L +               NE      NLE
Sbjct: 1235 LNLLRESNVTLRNELK--QALDEK-DKIAKDLQICR-------------NELLPLQSNLE 1278

Query: 1426 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVK--KLN-----------------LENEI 1548
            +   L+ EK  KI + N+ + R +  +E +  K  K+N                 L+N++
Sbjct: 1279 SANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKV 1338

Query: 1549 KDHEEKD----KLNKDVLQKLNVEKDYLPRLNE-IDEQIAAKFD--KLAIIKNETISE-- 1701
            ++  E +    +L K   +KLN  K+    L E I   I+ K D  K   +K E  SE  
Sbjct: 1339 QETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELL 1398

Query: 1702 ---------NNQLSILTKKLEEE 1743
                      N L  L ++L +E
Sbjct: 1399 SELNNFREKQNDLETLREELNKE 1421

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 39.3 bits (90), Expect = 0.040
 Identities = 68/284 (23%), Positives = 116/284 (40%), Gaps = 25/284 (8%)
 Frame = +1

Query: 955  ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ------EYED 1116
            EN      T EY+     +   +  E+  +SE +   N         KK       EYE+
Sbjct: 938  ENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEE 997

Query: 1117 KLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQS----KYNVDKGK---VI 1275
            K+ +LQ QL+                 E  E  L K+  ++QS    K  ++K     VI
Sbjct: 998  KISKLQSQLE-------LKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVI 1050

Query: 1276 KETEL-MKLQKINAKEDLLAKQLDV-XXXXXXXXXXXXAITNEYNIWNGNLENLT---TL 1440
             E++L  K   ++  E L  K+ D               +TN+  ++   LE L    + 
Sbjct: 1051 IESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSS 1110

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKD----VLQKLNVE 1608
            +D      E  +  N R++ D +VL+ K    E + K++  K +  +D    V  KL   
Sbjct: 1111 MDSSQLSSETKHMFN-RLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISS 1169

Query: 1609 KDYLPR---LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
            ++ L R   L E  E+I ++ +++ + K    +  NQ+S L +K
Sbjct: 1170 ENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEK 1213

>Ecym_2129 Chr2 complement(238725..240635) [1911 bp, 636 aa] {ON}
            similar to Ashbya gossypii AFL170C
          Length = 636

 Score = 38.9 bits (89), Expect = 0.045
 Identities = 50/233 (21%), Positives = 95/233 (40%)
 Frame = +1

Query: 1054 LKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVL 1233
            ++N  A  D+K N  ++E+E KL+ L+K   D                +I   QL K   
Sbjct: 178  VQNLEAELDQKINAVREEWELKLLSLEKFKPD------EALVKEIEHLKIERNQLQKKWN 231

Query: 1234 DVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWN 1413
            ++ S  N +K K  ++     LQ+   K+ +   QL               +  E   W 
Sbjct: 232  EIHS-MNEEKRKNHEKKLEKALQEFKDKKSMFLGQL---------MTKQSVLLKEKQEWE 281

Query: 1414 GNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQ 1593
              ++ +   L+E+              +++ E L+ +   LE E+K HE         +Q
Sbjct: 282  LQVKEMHNTLEEQ--------------KQEKEKLRQEIQTLEFELKSHELS-------IQ 320

Query: 1594 KLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
             L+       +L++++EQ+     + A +K + I    + + L  K+EE +I+
Sbjct: 321  PLST------KLHKLEEQLDLNRSETADVKQQAIQSEAEYNALYDKMEEAQIS 367

>KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} similar to
            uniprot|P47166 Saccharomyces cerevisiae YJR134C SGM1
            Protein of unknown function required for wild- type
            growth rate on galactose and mannose localizes to COPI
            coated vesicles and the Golgi apparatus
          Length = 668

 Score = 38.9 bits (89), Expect = 0.045
 Identities = 83/353 (23%), Positives = 141/353 (39%), Gaps = 42/353 (11%)
 Frame = +1

Query: 823  KTNATFSIKSLISG--AKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNI 996
            K   T S K L      K  NKT K   S+ +L   + E   V +    + L  TN   +
Sbjct: 147  KEGETLSKKELQQSDKIKKLNKTIKDLESDFSL--KLDELQDVKT--QADVLETTNASLM 202

Query: 997  VS-KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXX 1173
            VS K + +Q     K + +  K +    DE  NT   EYE K VEL+K +++        
Sbjct: 203  VSLKDMENQFGTLNKKYEDLKKEY----DEHLNT---EYESKKVELKKLVEENEVLNTEL 255

Query: 1174 XXXXXXXXEIME-YQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKE-DLLAKQLDV 1347
                    ++   ++     L+  SK  VD+ ++  E   + L+ IN K  D        
Sbjct: 256  SQIREHEDQMQRTFESKYKALEETSKEEVDRLEIRLEQLRIDLENINTKSGDSTTTDNTT 315

Query: 1348 XXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKI-----AKIEA--------INENNM 1488
                        A  +E N  N N  ++   L+EK      AK+EA           N +
Sbjct: 316  NDAYSKLMSQYKAAQHELNESNKNWASIEYALNEKCDSLKSAKVEADQIIDSLTTEMNGI 375

Query: 1489 RIQKDIEVLQVKKL-----NLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEI----- 1638
            +  +D  +L++ KL      L++ +K+  +   + K  L  ++ + + L + ++I     
Sbjct: 376  KQSRDEILLKLNKLTVMNGELQSTLKETTDDLLVTKGKLSNISDDYEILQKQHDIQKVQL 435

Query: 1639 ---------DEQIAAKFDKLA----IIKNETISENNQLSILTK-KLEEERIAH 1755
                     +++IA K +  A    I+    IS++ Q   LTK  L  E++ H
Sbjct: 436  GNALSNQLTEKKIALKKENEALNQVILDTTEISDSTQEHPLTKWDLNHEKMDH 488

>Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 21/126 (16%)
 Frame = +1

Query: 1393 NEYNIWNGNLENL-------TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI- 1548
            NE+  W    EN+          + E    I+ + E+ + +Q+ I  L+     LEN+  
Sbjct: 584  NEFETWKSKYENVEDEAKIRNAEVTELTRDIDDLKESKVHLQETITELENHVHKLENDYD 643

Query: 1549 --KDHEEKDKLNKDVLQ--KLNVEKDYLPRLNEIDEQIAAKFDKLAII---------KNE 1689
              K+  EK  L  + LQ    N++ +++  L  + E + +  D+L I          +NE
Sbjct: 644  LEKEKFEKTSLELESLQLKNSNIQAEHIKELENLHENLLSLQDELKISSERVTALTKENE 703

Query: 1690 TISENN 1707
            T+ +NN
Sbjct: 704  TLKQNN 709

>NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {ON}
            Anc_8.704 YPL174C
          Length = 888

 Score = 38.9 bits (89), Expect = 0.048
 Identities = 37/171 (21%), Positives = 78/171 (45%), Gaps = 7/171 (4%)
 Frame = +1

Query: 1219 VKNVLDVQSKYNVDKG-KVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITN 1395
            V   LD+Q+K + DK  ++  +TEL  + +   KE       D              + N
Sbjct: 646  VHKQLDMQNKVSKDKRFEITGDTELKSILEEKVKEK------DAYIQELTLRLQLIDVKN 699

Query: 1396 EYNIWNGNL-----ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE 1560
              N+   NL       ++T+ DEKI  +E+I +   ++    + L+ +KLN    I  ++
Sbjct: 700  TRNLERENLIGQLKNQISTINDEKIKYMESIRDLKRKLTNTTKALKYEKLNQYQLIISNQ 759

Query: 1561 EKDKLNKDVLQKLNVEK-DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQ 1710
                LN++++ +  + + D +  +N++ + ++ K +  A  ++ T    N+
Sbjct: 760  ----LNEEIVDRETLSRVDLISEINDLRKALSYKCNTAAYSESVTFEWLNE 806

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 38.9 bits (89), Expect = 0.051
 Identities = 39/202 (19%), Positives = 87/202 (43%), Gaps = 23/202 (11%)
 Frame = +1

Query: 1213 QLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAIT 1392
            +L+    D++SK +   G  I +  + +L+ + ++ + L  + +              I 
Sbjct: 847  KLIPQQQDIESKISEIGGGSIAQDLVEELRSLESQRERLDSEQE------EAKNDIYTIQ 900

Query: 1393 NEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK-- 1566
            NE +  NG   N   +L++  ++   + +     QK +E   +KK  L +   + ++K  
Sbjct: 901  NEIDGLNGEKTNNEKILEKANSQQRLLLKKIENYQKSVEKTLIKKTTLASRRDELQQKIR 960

Query: 1567 -------DKLN-------KDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISEN 1704
                   D LN       +D+L+KLN     + +L  ++++    F +    + E +  +
Sbjct: 961  EIGLLAEDALNDFNSLSSEDLLEKLNEANSEISKLVNVNKRAFENFRRFGEKQTELVERS 1020

Query: 1705 NQLSI-------LTKKLEEERI 1749
             +L +       L +KL+E++I
Sbjct: 1021 RELELSKISIQELIEKLKEQKI 1042

>NDAI0E01740 Chr5 (345054..345776) [723 bp, 240 aa] {ON} Anc_2.385
            YMR144W
          Length = 240

 Score = 37.7 bits (86), Expect = 0.058
 Identities = 29/114 (25%), Positives = 58/114 (50%), Gaps = 4/114 (3%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK----DHEEKDKLNKDV 1587
            +EN     DE  A I  +N+   R+Q+ +   +++ + LEN  K    ++E + KL+K+ 
Sbjct: 51   IENQVLSADEASATIVHLNKQLGRLQQLLNQKKLRNMLLENNAKSLKSNNEVERKLHKEQ 110

Query: 1588 LQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
              ++  +  YL +  ++   +  K  K+   K   IS+N +++ LTK L +  +
Sbjct: 111  FDQMKYQ-SYLEK-EKLLRNLRLKDMKIRKYKKRIISKNKEINRLTKILNDNSV 162

>TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {ON}
            Anc_6.289 YMR198W
          Length = 749

 Score = 38.5 bits (88), Expect = 0.061
 Identities = 61/255 (23%), Positives = 107/255 (41%), Gaps = 10/255 (3%)
 Frame = +1

Query: 1015 DQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXX 1194
            D  N +  L  + L      E+E  N    E + KL    K ++D               
Sbjct: 205  DSKNKDYDLKVQNLNEKLVLENENMNIYLSEVKLKLENKLKNINDDLIDKYND------- 257

Query: 1195 XEIMEYQL-VKNVLDVQ-SKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXX 1368
             EI +++L +K V +++ SK  + + + +KET   K  ++N  ++  + QL +       
Sbjct: 258  -EIKDWELKIKEVKEMKPSKEFLIELEALKETLAEKENELNELKN--SNQLKLIDYENKL 314

Query: 1369 XXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI 1548
                     E ++    L+NLT      I +I+ +NE    + K+IE L  +  ++ N I
Sbjct: 315  KEEFELFKLEKSM---PLQNLTNESYSLIEQIKQLNEQKSNLLKEIESLDSQISDVNNNI 371

Query: 1549 KDHEEK--DKLNKDVLQKLNVEK------DYLPRLNEIDEQIAAKFDKLAIIKNETISEN 1704
            +D  +K  D  N ++  KL +EK      + L   NEI ++      +L+ I       N
Sbjct: 372  EDKNKKIEDLSNGNIPLKLELEKLEKIFEEKLKESNEIKKEA-----ELSNISYRKSLNN 426

Query: 1705 NQLSILTKKLEEERI 1749
             +L  L  K+ E  I
Sbjct: 427  LKLQELKNKILENSI 441

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 38.5 bits (88), Expect = 0.069
 Identities = 28/109 (25%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            L+ L +  +  +  +E  N+    +  +IE ++ +K NL  E+  ++++ K N+D LQK+
Sbjct: 1572 LKELESKHNRYMNDLETCNKAKTSLLTEIETIRNQKNNLSEELLKNQKQYKENEDSLQKI 1631

Query: 1600 NVEKDYLPRLNEIDEQIAAKFDKLAIIKN--ETISENNQLSILTKKLEE 1740
              E     ++N ++E++A   +   + K+  E  SE + L +L  +L+E
Sbjct: 1632 ADEN--ARKINLLEEELANLKEDAMLWKSKAEDRSEVDDLMLLVTELDE 1678

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 38.5 bits (88), Expect = 0.069
 Identities = 48/250 (19%), Positives = 104/250 (41%), Gaps = 32/250 (12%)
 Frame = +1

Query: 1084 KYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIM-----EYQLVKNVLD-VQS 1245
            K+N+ K++YE ++  L++QL+                   +     E +  KN  D +++
Sbjct: 1044 KFNSSKEDYESQIGLLKEQLETVATENGESVNKISELSHNIDDLKGELETQKNFKDDLEA 1103

Query: 1246 KYNVDKGKVIKETEL------------------MKLQKINAKEDLLAKQLDVXXXXXXXX 1371
            K    K KV+KET+                   +K Q  N +++L + + +         
Sbjct: 1104 KLEASK-KVLKETQANEQHLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVE 1162

Query: 1372 XXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK 1551
                 I+++   +NG L  L   ++    K E I +NN +++ +IE ++          K
Sbjct: 1163 EYKKQISDKEKEYNGKLSELNNEINSVQQKNETICQNNEKLKGEIEEIE----------K 1212

Query: 1552 DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDE--------QIAAKFDKLAIIKNETISENN 1707
              E++  L    ++ LN + + L    +I E         +  + +K+  ++ E+ ++  
Sbjct: 1213 ASEDQSNLKGSKIEALNAQIEELEESKQITETKLLDSVKNMKTEMEKMRELQKESDAKMV 1272

Query: 1708 QLSILTKKLE 1737
            +++ L +K E
Sbjct: 1273 KINELEEKQE 1282

 Score = 38.5 bits (88), Expect = 0.069
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 10/85 (11%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMR-IQKDIEVLQVKKLNLENEIKDHEEKD-------KLNKDVLQKL 1599
            +EK+   E  NE  +  ++K +EV+Q  K+ +E E+K+ EEK        + +K++++KL
Sbjct: 1451 NEKLLSTEQGNEQELNSLRKQLEVVQEAKVKIEGELKEMEEKTTSQTLELERSKEIMRKL 1510

Query: 1600 NVEKDYLPRLNEIDEQI--AAKFDK 1668
              E   + +  EID  I    +FDK
Sbjct: 1511 --ESTIVSKEKEIDSSIEFRKEFDK 1533

>NDAI0G02820 Chr7 (655932..657287) [1356 bp, 451 aa] {ON} Anc_3.149
            YOL069W
          Length = 451

 Score = 38.1 bits (87), Expect = 0.069
 Identities = 57/254 (22%), Positives = 111/254 (43%), Gaps = 6/254 (2%)
 Frame = +1

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXX 1182
            ++ +D  N  Q+   E+ +  N  +    N  K+   +KL E  K L++           
Sbjct: 150  RSKFDDYNLLQQQMKEYEEEINILDAGDDNGTKEL--NKLEENNKNLEN----------- 196

Query: 1183 XXXXXEIMEYQLVKNVLDVQ-SKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXX 1359
                 ++ +   V+  L +  S Y  +K K++KE E +  Q +      L  Q D     
Sbjct: 197  -----QLKKLTQVQETLSINYSNYKSEKQKILKELESLGFQIVE-----LESQRDKLE-- 244

Query: 1360 XXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLE 1539
                          N  N ++E L T +++    +  I EN    +K ++ L++K+ NLE
Sbjct: 245  --------------NYTNIDIEELNTTVED----LSKILENK---EKVLQNLRIKQKNLE 283

Query: 1540 NEIKDHEEKDKLNKDVLQKLN--VEKDYLPRLNEID--EQIAAKFDKLA-IIKNETISEN 1704
             +I   E+      D+L+ ++  V+  +  ++N ID   Q+    DKL  I+ N  + ++
Sbjct: 284  TKITTFEKISTELYDILRLISTEVQNSHGTQVNLIDIQNQLLENRDKLQDILSNAVLLKS 343

Query: 1705 NQLSILTKKLEEER 1746
            N   +L ++L+++R
Sbjct: 344  N---VLKEQLKDQR 354

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 38.5 bits (88), Expect = 0.069
 Identities = 26/114 (22%), Positives = 59/114 (51%), Gaps = 1/114 (0%)
 Frame = +1

Query: 1402 NIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
            N+   N + +  LL+EKI+++EA    +  +  D + L+ + +  +NE++  +     +K
Sbjct: 133  NVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDK 192

Query: 1582 DVLQKLNVEKDYLPRLNE-IDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
              L+ +  +   L + NE +++++ +K ++L   + E  +E      L K L+E
Sbjct: 193  SELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTE------LQKSLQE 240

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 47/241 (19%), Positives = 96/241 (39%), Gaps = 2/241 (0%)
 Frame = +1

Query: 1018 QMNYEQKLHSEWLKNFNAAEDEKYNTK--KQEYEDKLVELQKQLDDXXXXXXXXXXXXXX 1191
            Q N  ++  +E LK   + E  +++    K+EY+ KL +LQK L+               
Sbjct: 993  QKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQ--QTAYANIAQKNY 1050

Query: 1192 XXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXX 1371
              E+ ++  V  ++  Q +  V  G+   E + +K  +  AKE                 
Sbjct: 1051 EEELQKHAEVSKIIS-QLRSEVQSGR--SEIQQLKASEQQAKE----------------- 1090

Query: 1372 XXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK 1551
                 + N    W      L   +D+   +++ I+  N  +   +E+L   +   EN++ 
Sbjct: 1091 ----VLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLL 1146

Query: 1552 DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
                    + ++L  L  E+D L    E    ++ + +KL  +  + ++  ++L+   KK
Sbjct: 1147 PG------SSELLISLRRERDIL----ETKLTVSKREEKL--LHQKQVALEDELAEARKK 1194

Query: 1732 L 1734
            L
Sbjct: 1195 L 1195

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 38.5 bits (88), Expect = 0.069
 Identities = 56/265 (21%), Positives = 107/265 (40%), Gaps = 4/265 (1%)
 Frame = +1

Query: 964  EYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLK---NFNAAEDEKYNTKKQEYEDKLVELQ 1134
            +YL R  + +I ++A YD  N    LHS++ K     + +  + Y  K +  E+++  L+
Sbjct: 1325 DYLKR--QLDIETRAHYDAENAISALHSKFRKIQGESSLSSSDIYKLKFEASEERVKSLE 1382

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             +L                             + ++ + N+  G +IK            
Sbjct: 1383 DKL---------------------------KTMPLRDRTNLPVGDIIKN----------- 1404

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 1494
              D ++K  +              I NE N   G L  LT  L +  +K   ++E   R+
Sbjct: 1405 -RDSISKYEEEIRYYKLENYKLQEILNESN---GKLSQLTLDLRQSKSKEALLSEQLDRL 1460

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-KDYLPRLNEIDEQIAAKFDKL 1671
            QKD+E  + +K  L + IK  +++ +   D LQ   +  ++++  L + +E +      +
Sbjct: 1461 QKDLESTERQKELLSSTIKQQKQQFENCMDDLQGNELRLREHIHALKQAEEDV----KNM 1516

Query: 1672 AIIKNETISENNQLSILTKKLEEER 1746
            A I  +  ++N Q   L  + E ER
Sbjct: 1517 ASIIEKLKTQNKQKEKLIWEREMER 1541

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 8/171 (4%)
 Frame = +1

Query: 1240 QSKYNVDKGKVIK---ETELMKLQK-----INAKEDLLAKQLDVXXXXXXXXXXXXAITN 1395
            Q K N+ K + +    +T    LQK     ++ K+++  ++L+V             +  
Sbjct: 907  QEKENLRKNESLLNRVKTSSETLQKQFDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQE 966

Query: 1396 EYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKL 1575
                    LE L +  +E I +I  +N +  + Q    +++  KL LENEIK    KD +
Sbjct: 967  TIREREATLEKLHSKNNELIKQISDLNCDISKEQSSQSLIKESKLKLENEIK--RLKDVI 1024

Query: 1576 NKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
            N     K    K +  +L+  +E +  K   + + KN  I+ +   S++T+
Sbjct: 1025 N----SKEEEIKSFNDKLSSSEEDLDIKL--VTLEKNCNIAMSRLQSLVTE 1069

>KNAG0E01670 Chr5 complement(336548..337033) [486 bp, 161 aa] {ON}
            Anc_2.215 YNL079C
          Length = 161

 Score = 36.6 bits (83), Expect = 0.077
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 1/110 (0%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            N NLE     L++++++ + + EN+  +Q   E    K   LE ++++ + K K   D L
Sbjct: 50   NENLETEVAKLEDQLSESKQLAENSSTLQSTNENFTKKNEQLEADLEETDSKLKETMDKL 109

Query: 1591 QKLNVEKDYLPR-LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
            +  +++ + L R L  IDE+     DK   +  +      +L  +   LE
Sbjct: 110  RDADLKAEELERKLAAIDEEKTQLEDKNEELAAQYAEAKQELDDIAASLE 159

 Score = 30.4 bits (67), Expect = 8.9
 Identities = 20/103 (19%), Positives = 47/103 (45%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP 1623
            +E   + + + ++N   +  I+ L VK  NLE E+   E++   +K + +  +  +    
Sbjct: 23   EELKEQYKQLEQDNTEKENQIKSLTVKNENLETEVAKLEDQLSESKQLAENSSTLQSTNE 82

Query: 1624 RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
               + +EQ+ A  ++      ET+ +     +  ++LE +  A
Sbjct: 83   NFTKKNEQLEADLEETDSKLKETMDKLRDADLKAEELERKLAA 125

>YMR186W Chr13 (632355..634472) [2118 bp, 705 aa] {ON}
            HSC82Cytoplasmic chaperone of the Hsp90 family, redundant
            in function and nearly identical with Hsp82p, and
            together they are essential; expressed constitutively at
            10-fold higher basal levels than HSP82 and induced 2-3
            fold by heat shock
          Length = 705

 Score = 38.1 bits (87), Expect = 0.079
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E I  ++  +   I++L  K++  E  I + E+KD+  KD       E D  
Sbjct: 185  LEEKRIK-EVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKD-------EDDKK 236

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNE 1689
            P+L E+DE+   K  K   +K E
Sbjct: 237  PKLEEVDEEEEEKKPKTKKVKEE 259

>Skud_13.352 Chr13 (606459..608594) [2136 bp, 711 aa] {ON} YMR186W
            (REAL)
          Length = 711

 Score = 38.1 bits (87), Expect = 0.079
 Identities = 27/83 (32%), Positives = 44/83 (53%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E I  ++  +   I++L  K++  E  I + E+KD   K+  +K + E D  
Sbjct: 185  LEEKKIK-EVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDDEEKEDEEKKD-EDDKK 242

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNE 1689
            P+L E+DE+   K  K   +K E
Sbjct: 243  PKLEEVDEEEEEKKPKTKKVKEE 265

>TDEL0C02520 Chr3 (438435..441068) [2634 bp, 877 aa] {ON} Anc_1.487
            YEL043W
          Length = 877

 Score = 38.1 bits (87), Expect = 0.083
 Identities = 31/109 (28%), Positives = 60/109 (55%), Gaps = 5/109 (4%)
 Frame = +1

Query: 1417 NLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKD--HEEKDKLNKDVL 1590
            +LEN   L D K+ KI+          K+I+    K L +E ++++  H+++++LNK+VL
Sbjct: 250  SLENSKLLSDLKLEKID----------KNIDQANAKILKMERDMENWSHQDQERLNKEVL 299

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNE-TISE--NNQLSILTK 1728
            +     ++Y  +L  I+E + +  D++   + E T+ E  N +L+ L K
Sbjct: 300  R-----ENYNKQLKLINENVESLSDRIKQCQREVTLQEDKNKELNSLKK 343

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +1

Query: 913  LGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFN 1068
            L  A  +   + +    EYL + N  + V K V DQ+  +Q L S+W  N N
Sbjct: 370  LNEATMDKSGLLANSGEEYLSKLNPNSPVVKLVRDQLKLDQDLDSKWKSNKN 421

>KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1261

 Score = 38.1 bits (87), Expect = 0.087
 Identities = 50/207 (24%), Positives = 84/207 (40%), Gaps = 30/207 (14%)
 Frame = +1

Query: 1213 QLVKNVLDVQSKYNVDKGKV-------IKETELMKLQ--KINAKEDLLAKQLDVXXXXXX 1365
            Q +K V++++       GK+       +K+TE+++ Q  ++N + + L +Q  V      
Sbjct: 568  QELKRVIEMKLSIQDKLGKIRAAHEENVKKTEMLENQLIELNNENNSLQQQFSVTEANFQ 627

Query: 1366 XXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI----------------- 1494
                  A  N+ N       N T    E  AKI   NE N  +                 
Sbjct: 628  ------ASENKMNEVTLQFNNATRENQELKAKISQFNEQNNLLLSQLNEKQALLQKEMSI 681

Query: 1495 ----QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
                +K +E+  +   NL NEI   +EK ++    + K N   DY   L     Q+  K+
Sbjct: 682  ADVNRKQVELNDITVANLTNEISGLDEKLQI---FISKTNELNDYQKTLESKHAQLEDKY 738

Query: 1663 DKLAIIKNETISENNQLSILTKKLEEE 1743
            + L    NE     +QL+  TK++EE+
Sbjct: 739  NDL----NE---RESQLNERTKQIEEQ 758

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 38.1 bits (87), Expect = 0.091
 Identities = 26/103 (25%), Positives = 52/103 (50%), Gaps = 7/103 (6%)
 Frame = +1

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLE-------NEIKDHEEKDKLNKDVLQKLNVEK 1611
            +++ +  N+  ++++ D++ ++ KK  LE       NE+KD +E   L K+ L+K    +
Sbjct: 860  MSRTKKFNDLIIKLKNDLQEMESKKKFLEEKNQKTINELKDTQELLSLEKENLKK---NE 916

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
              L R+    E +  +FD   + KNE   +  Q+    +K E+
Sbjct: 917  SLLNRVKSSSETLQKQFDDTVLEKNEISKQKLQIMQNLEKAEQ 959

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            NG L  L   L +  +K   ++E   R+QKD E  + +K  L + IK  +++ +   D L
Sbjct: 1433 NGKLSQLALDLRQSKSKEVLLSEQLDRLQKDFESTERQKELLSSTIKQQKQQFEDCMDDL 1492

Query: 1591 QKLNVE-KDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
            Q   +  ++++  L + +E + +    +A I  +  ++N Q   L  + E ER
Sbjct: 1493 QGNELRLREHIHALKQAEEDVKS----MASIIEKLKTQNKQKERLIWEREMER 1541

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 38.1 bits (87), Expect = 0.091
 Identities = 54/231 (23%), Positives = 97/231 (41%), Gaps = 4/231 (1%)
 Frame = +1

Query: 1075 EDEKYNTKKQ-EYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKY 1251
            E EK + KKQ E +DKL+E   +L++                +   Y+ +K  L+     
Sbjct: 1669 EKEKDSLKKQKEQDDKLIEKSSKLEE------------ELRNKSNNYEDLKEQLE----- 1711

Query: 1252 NVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENL 1431
                 K+  ETE+++L++  +  D   K+L                  + N     +E+ 
Sbjct: 1712 KCQMTKLNLETEIVQLKESISSTDADMKRLSSEHDED---------KEKINTLEKVIESQ 1762

Query: 1432 TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
             T + +  + I    E    +QKD E+  +K      +I + E +DK N +V+++L +E 
Sbjct: 1763 KTNMKKSQSTITKFEE--AILQKDEELAAIK-----TKITEIENRDKNNSNVIEQLKLET 1815

Query: 1612 DYLPRLNEID-EQIAAKFDKLAIIKNETISENNQLSILTKKLEE--ERIAH 1755
            + L +    D E    K  K+   K +   E  +  I  +KL E  E++ H
Sbjct: 1816 EKLKQEQTNDREDYQVKATKMEEAKKKCDEEKQEQIIELQKLREKLEKLEH 1866

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 45/224 (20%), Positives = 91/224 (40%), Gaps = 10/224 (4%)
 Frame = +1

Query: 1102 QEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKE 1281
            QEY +K+ +L+++LD+                       V+ +        ++  K+I+E
Sbjct: 1450 QEYSEKISKLEERLDEAKFENESKGAE------------VEKIKKASKNSEMETQKIIEE 1497

Query: 1282 TELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAK 1461
             +    Q    +E + +K+ D+                E +  N NLE L   + E   K
Sbjct: 1498 KD---TQITTLRETITSKEKDLDERSQTIKNLISEKEQELSASNQNLEELKNQISE--IK 1552

Query: 1462 IEAINENNMRIQKDIEVLQVKK--LNLENEIKDHE-EKDKLNKDVLQ-KLNVEKDYL--- 1620
             E  +      +KD+ ++ + K   +L+ ++KD     +KLN+ +   K N++   L   
Sbjct: 1553 EELKSSKEEMAKKDMMLIDLNKTLASLKGDVKDKVLAIEKLNETLASLKGNIKDKDLAIE 1612

Query: 1621 ---PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
                 LN + + I  K   +  +K +  SE ++  I  +  ++E
Sbjct: 1613 KLEKTLNSLKDDIKDKDQTIEDLKKKKASEESEFKITIEGKDKE 1656

>NCAS0A08680 Chr1 complement(1716853..1718706) [1854 bp, 617 aa] {ON}
            Anc_3.106 YBR148W
          Length = 617

 Score = 37.7 bits (86), Expect = 0.10
 Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 8/126 (6%)
 Frame = +1

Query: 1393 NEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQV---KKLNLENEIKDHEE 1563
            N+Y+     L+   TLL+E+I ++++ ++ N  +++ IE  +V   +K     E+ D + 
Sbjct: 350  NDYSSKIEQLKKKNTLLNEQINRLKSYSKENNELKRKIESFEVEMREKQVTAEELDDEKN 409

Query: 1564 KDKLNKDVLQ-KLNV----EKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
            K +L  D L+ KL++    E  Y   L  + ++++    +LA+ K  +       S   +
Sbjct: 410  KMRLKLDDLRDKLSIVSEKEVSYKQELENLSQKLSINEKELALRKKRSAKYREAYSKERR 469

Query: 1729 KLEEER 1746
            K+ + R
Sbjct: 470  KVLDLR 475

>TBLA0A07110 Chr1 complement(1756627..1759200) [2574 bp, 857 aa] {ON}
            Anc_6.4 YPL269W
          Length = 857

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 55/284 (19%), Positives = 113/284 (39%), Gaps = 12/284 (4%)
 Frame = +1

Query: 835  TFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIV----S 1002
            +FS+K L+     +N+          L   +P   ++      EYL  T +   +    +
Sbjct: 192  SFSLKQLLDLLNSTNEN---------LSYKIPAFTSIDEVVYREYLELTKKIEPIDLSLN 242

Query: 1003 KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE---DKLVELQKQLDDXXXXXXXX 1173
            K + +++N  +K     +K  +   DEKY    +EY     ++ +L+K+L D        
Sbjct: 243  KFLLERINNFKKREVSIIKKLSIRLDEKYKIILEEYNFMTQEIKDLKKELVDKRWNILFI 302

Query: 1174 XXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXX 1353
                     + E  L+KN +      N  K K+IK+        +  K +++ +   V  
Sbjct: 303  NLSHEIEFLMEEIDLIKNKIRNYYLSNRIKEKLIKQ--------LTKKTEIITRTFQVIF 354

Query: 1354 XXXXXXXXXXAITNEYN----IWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQV 1521
                       +    N     W   ++++  + ++   + ++I++ + RI   + +   
Sbjct: 355  KAIELALLDTTVVKRINEISKRWLVEIKSINKIFNKYEEERDSIDDISSRI-NSLTLRNG 413

Query: 1522 KKLNLE-NEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQI 1650
            K  N E N++ D++  + L  +       EK  +  LN+IDE I
Sbjct: 414  KARNAENNKLIDNDNNELLPMNDKHNNKTEKRDI-ELNQIDEYI 456

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 33/137 (24%), Positives = 67/137 (48%), Gaps = 21/137 (15%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTL-------LDEKIAKIEAINEN--NMRIQKDIEVLQVKKLNLE 1539
            ++N  N+ N N  N           L+++   I +INE   N    K+ E  Q+K+   +
Sbjct: 41   LSNSLNLSNNNSNNSINKKQLDFSELEKRFEVINSINEQLKNELYTKNKEYFQIKQ-ECD 99

Query: 1540 NEIKDH-----EEKDKLNKDVLQK-------LNVEKDYLPRLNEIDEQIAAKFDKLAIIK 1683
             +I+D+     E K +L+K++LQ        +NV +  +    E D++    F+KL  ++
Sbjct: 100  VKIEDYKSNLNELKHRLSKEILQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLE 159

Query: 1684 NETISENNQLSILTKKL 1734
            ++ +   +Q++I+  K+
Sbjct: 160  SKFLETYDQMNIMKNKI 176

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 42/190 (22%), Positives = 84/190 (44%), Gaps = 23/190 (12%)
 Frame = +1

Query: 1219 VKNVLDVQSKYNVDKGKVIKETELMKLQKINAK---------EDLLAKQLDVXXXXXXXX 1371
            +  +L  QS  N D  K++ E EL  ++ + A+         +++++++L          
Sbjct: 377  INYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNIISERL---------- 426

Query: 1372 XXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEV------------L 1515
                  +N  ++   N++ L +L+ E   K+E+I + N +   D+E+            +
Sbjct: 427  ---LKFSNVSDLTAKNIK-LISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMI 482

Query: 1516 QVKKLNLENE--IKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNE 1689
             +K+ N++N+  I     + KL +D +  LN     L +  EI  +   K  +L      
Sbjct: 483  VLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQS 542

Query: 1690 TISENNQLSI 1719
             + +NNQLSI
Sbjct: 543  LLEKNNQLSI 552

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_5.414
            YDR356W
          Length = 1009

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 47/234 (20%), Positives = 96/234 (41%), Gaps = 8/234 (3%)
 Frame = +1

Query: 1033 QKLHSEWLKNFNAAEDEKYNTKK-QEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIME 1209
            ++L ++  +N   +     N K  +E +D++ +LQ++L D                ++  
Sbjct: 587  KQLQNQLFENVKNSTTSDINEKVIKEKQDQIEDLQRKLADLRDAIRTDQNKNLKKFDL-- 644

Query: 1210 YQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAI 1389
                  + + + KY  + GK+ ++  L+K ++   K  L   +                 
Sbjct: 645  -----RIKETEMKYTEELGKLKEDVRLLKNERAKLKNQLETIKESKVNMETQHDRELNEW 699

Query: 1390 TNEYNIWNGNLENLTTLLDEKIAK-----IEAINENNMRIQKDIEVLQVKKLNLENEIKD 1554
             +++N  +    NL    D K        +E +NEN  R+   +E LQ ++ ++E EI  
Sbjct: 700  ISKFNSMSKEHNNLINRQDNKRDSYRNEIMETLNENK-RLLAQLEALQNQRSDMEIEITK 758

Query: 1555 HEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA--AKFDKLAIIKNETISENNQ 1710
              +     KD L      K+ L  L+ I ++ +   + +K    KNE++S+  Q
Sbjct: 759  LSKSRDAYKDTL------KNTLSNLDSITKEFSEYKRRNKNNDEKNESMSDRYQ 806

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
            YFR031C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 31/100 (31%), Positives = 55/100 (55%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L E I K E I+E+     ++++V ++++LN  +EIK  EE  K+ +  L KL  +K   
Sbjct: 804  LTESINKQEKISEHEYEKYQNLQV-EIEQLN--SEIKSDEESLKVTEMNLDKLLKDK--- 857

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
               +EI++  ++    L  I+ E   E N+L  L ++L+E
Sbjct: 858  ---SEIEKNFSSLDKSLVDIRGELDEERNRLLGLDEELKE 894

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 25/102 (24%), Positives = 57/102 (55%)
 Frame = +1

Query: 1435 TLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKD 1614
            TL+++K+ +IEA+NE  +  +K  E+++ +K +LE++ KD    + + K+    L   K 
Sbjct: 325  TLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESD-KD-AALEFIAKEKQLTLLRSKL 382

Query: 1615 YLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
               +L + + ++A   DK++  KN    E ++   +  ++++
Sbjct: 383  TQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQ 424

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 37.4 bits (85), Expect = 0.16
 Identities = 51/227 (22%), Positives = 97/227 (42%), Gaps = 23/227 (10%)
 Frame = +1

Query: 1078 DEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKY-- 1251
            +EK  T + E    L EL K+L++                +  E ++  N +  QS+   
Sbjct: 1276 EEKLKTSEVENSHNL-ELLKELEE----------------DKRELEIRTNEVKNQSEKIA 1318

Query: 1252 NVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENL 1431
            N+DK +   E EL +L+K +  E    ++  +            A   E  + N     +
Sbjct: 1319 NLDKLREKTEAELCRLKKTSTDEKSNLEE-QLGKLRNEIKIKSQAFEKERKLLNEGSSTI 1377

Query: 1432 T-------TLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLE---------NEIKDHEE 1563
            T        +L++++ K+E  NE+  R+  D    +++K  L          NEIK  ++
Sbjct: 1378 TQEYSEKINMLEDQLNKLENENESKTRLI-DTSKNELEKATLSHDEILEEKRNEIKSMKD 1436

Query: 1564 -----KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNE 1689
                 K+K+N+   + L+ E+D+  R N + EQ+ A  +  A ++ +
Sbjct: 1437 EILSYKEKINEANTKLLSTERDHESRSNSLKEQLEAVQESKAEVERK 1483

 Score = 31.6 bits (70), Expect = 9.2
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 1/100 (1%)
 Frame = +1

Query: 1447 EKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL-P 1623
            E  +K EAI +      + I V + +KL L +++KD E   + N++  Q    + D L  
Sbjct: 1577 ESNSKTEAIQQELTSAHEKIRVNEEEKLLLNSKLKDLECNLRDNQEEAQSTKEKNDSLNS 1636

Query: 1624 RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
             L E+++++     K      ++  E  QL   T + +E+
Sbjct: 1637 HLKELEQKLTDAQQKAKECDEKSKMEIEQLQAETSQSQEK 1676

>KAFR0H02460 Chr8 (470593..471933) [1341 bp, 446 aa] {ON} Anc_8.659
            YPL146C
          Length = 446

 Score = 37.0 bits (84), Expect = 0.16
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMRIQKDIEVLQVKKLNLE-NEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            +E I   E   ++ M++  +  V   KK   + N+ K HEEK KL ++ L KL  +   L
Sbjct: 285  EEDIEGDEIDTDSIMKLSVNEPVKNKKKTKYQRNKAKKHEEKVKLQQE-LNKLKEQVREL 343

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNETISENNQL----SILTKKLE 1737
             ++ E +E+IA K       K +     N+L     IL ++LE
Sbjct: 344  EKVEEFEEEIAQKSQPTKTSKKQRKLNRNKLGTKYGILDERLE 386

>ZYRO0C06732g Chr3 (505681..506337) [657 bp, 218 aa] {ON} similar to
            uniprot|Q03322 Saccharomyces cerevisiae YDR468C TLG1
            member of the syntaxin family of t-SNAREs tSNARE that
            affects a Late Golgi compartment
          Length = 218

 Score = 36.2 bits (82), Expect = 0.16
 Identities = 29/104 (27%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1447 EKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR 1626
            ++I ++    +NN   + D EV +V + ++E  I+D E+    + +V+++    K  L R
Sbjct: 15   DQIQRLSVFLQNNSHNEVDNEVNEVMQ-DIEETIEDLEK----SLEVIERSG--KSTLGR 67

Query: 1627 LNEIDEQIAAKFDKLAI-IKNETISENNQLSILTKKLEEERIAH 1755
             NE+D  + + ++KL + + N T S +N  +++ ++ EEER A+
Sbjct: 68   KNEVD-SLKSAYEKLKLGVTNSTSSASNTDNVVWQQEEEEREAN 110

>Suva_8.324 Chr8 complement(578609..580591) [1983 bp, 660 aa] {ON}
            YOR275C (REAL)
          Length = 660

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 12/188 (6%)
 Frame = +1

Query: 1228 VLDVQSKYNVDKGKVIKETELMKLQKINA--KEDLLAKQL--DVXXXXXXXXXXXXAITN 1395
            V+D  + YN  + K +++  +  L  +N   KE +   Q+  ++            A  N
Sbjct: 341  VMDYCTAYNERQDKYVEQRVINPLTSLNKLLKESMTTFQIPQELKTISDTELKQYQASLN 400

Query: 1396 EYNIWNGN----LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
               + N N    L+N+T +L+E     EA+++N +R++       +             E
Sbjct: 401  NLQVNNENIQSELDNITHILNE-----EALSDNELRLKHGTLHWTLP------------E 443

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF---DKLAIIKNETISENNQ-LSILTKK 1731
               +N    +KLN  K+Y+ + + ID+Q    F   DK  I     + E+N  L+   K+
Sbjct: 444  SSTINAKYYEKLNKLKEYIDQGSAIDKQTNELFQTIDKTLITSEIKLPESNDPLTNKIKQ 503

Query: 1732 LEEERIAH 1755
            + +ER  H
Sbjct: 504  VIQERSEH 511

>TPHA0F03370 Chr6 complement(726379..729012) [2634 bp, 877 aa] {ON}
            Anc_1.487 YEL043W
          Length = 877

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 6/118 (5%)
 Frame = +1

Query: 1408 WNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN-LENEIKDHEEKDK-LNK 1581
            W  +  NL  L        +  +E N+ I+ DIE   +KK+N LENEI D+E  +K LNK
Sbjct: 319  WENDASNLDDLN-------KTYSEKNLVIKNDIE-QTIKKINLLENEIADYELINKNLNK 370

Query: 1582 DVLQKLNVEKDYLPRLNEIDEQIAAKFDKLA----IIKNETISENNQLSILTKKLEEE 1743
               + LN +K+    L E+D  I+ +   L+    II ++  + ++  +++T +L  +
Sbjct: 371  SNNKMLN-KKELKEILKELDASISDETGLLSSDGQIILSKLTNSSSFYNLITDQLNTD 427

>TPHA0C01770 Chr3 complement(403223..405871) [2649 bp, 882 aa] {ON}
            Anc_8.484 YDR251W
          Length = 882

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 17/54 (31%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +1

Query: 1576 NKDVLQKLNVEKDYLPR-LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKL 1734
            NK+ +QKL++E+D L   + +++E +A+K  +L I KN  +   N++++L +++
Sbjct: 363  NKEKIQKLSIERDDLRNDITKLNEILASKDRELGIAKNMELQNKNEVTVLQREV 416

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 40/160 (25%), Positives = 70/160 (43%), Gaps = 43/160 (26%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVL---QVKKLNLE------ 1539
            + +E     GN ++L   LD K AKI  + + + +++K +E L   Q KK  +E      
Sbjct: 211  VLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRKSVESLRDFQNKKGEIELHSQLL 270

Query: 1540 --NEIKDHEEKDKLNKDVLQK---------------LNVEKDYLPRLNEIDEQIAAK--- 1659
               ++KDH+EK  + K+  ++                N +K    ++ E+ E+ + K   
Sbjct: 271  PYVKVKDHKEKLNIYKEEYERAKANLRAILKDKKPFANTKKTLENQVEELTEKCSLKTDE 330

Query: 1660 -----------FDKLAIIKNETISENNQLSIL---TKKLE 1737
                       F+KL  I++E I + NQ       TKKL+
Sbjct: 331  FLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYRGRTKKLQ 370

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 58/289 (20%), Positives = 117/289 (40%), Gaps = 41/289 (14%)
 Frame = +1

Query: 1003 KAVYDQMNYEQKLHSEWLK----NFNAAEDE--KYNTKKQEYEDKLVELQKQLDDXXXXX 1164
            +A   Q+N E +  ++ L     N++AAE +  +  T  QE + K  EL++Q+ +     
Sbjct: 664  EAQLSQINNENETLTQQLAVSEANYHAAESKLNELTTDLQESQTKNAELKEQITNLNSMT 723

Query: 1165 XXXXXXXXXXXEIMEYQLVKNVLDVQSKY---------NVDK-----GKVI-----KETE 1287
                       + ++ +  ++++DV SK          N+ K     G+ I     K+ E
Sbjct: 724  ASLQSQLNEKQQHVKQE--RSMIDVNSKQLELNQITVVNLQKEIDGLGEKIGVYLTKQKE 781

Query: 1288 LMKLQKI---------NAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 1440
            L   QK          +  +DL  K  D+             I  + N+++ ++  L  +
Sbjct: 782  LNDYQKTVEEQHAQLQSKYQDLSNKDNDLADREKQLEERNKQIEEQENLYHQHVSKLQAM 841

Query: 1441 LDEKIAKI-------EAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
             D+   +        + + E N+    ++  L  +++NL       + K+ ++K V    
Sbjct: 842  FDDLSQRKATFDKADQELKERNIEYANNVRELSERQMNLAMGQLPDDTKEIISKHVSDND 901

Query: 1600 NVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
               K+ +PR N  ++ I+   D        T  EN+ L++   K +EE+
Sbjct: 902  TATKEVVPRENAHEDTISKFVD--------TTVENSNLNVNRIKEDEEK 942

>TBLA0E02420 Chr5 (600043..604803) [4761 bp, 1586 aa] {ON} Anc_7.68
            YAL029C
          Length = 1586

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 36/124 (29%), Positives = 64/124 (51%), Gaps = 14/124 (11%)
 Frame = +1

Query: 1426 NLTTLLDE-----KIAKIEAI----NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLN 1578
            N TTLL E     KI + EA+    +EN++ +++  + L + K  +EN+ K   E+ K+ 
Sbjct: 988  NDTTLLKEQLDNAKIQREEALLKQKDENDVELKEIEDKLALAKQEIENK-KQEIEEIKIK 1046

Query: 1579 KDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENN-----QLSILTKKLEEE 1743
             D L++ ++++  L  LNE  +Q+A    +   ++NE +S        Q S+ T  L   
Sbjct: 1047 HDELKQESIKQ--LAELNEARQQLADSRTENNDLQNEVLSLKEEITRLQASMTTATLSAA 1104

Query: 1744 RIAH 1755
             +AH
Sbjct: 1105 ALAH 1108

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 16/148 (10%)
 Frame = +1

Query: 1321 DLLAKQLDVXXXXXXXXXXXXAITNEYNIW----------NGNLENLTTLLDEKIAKIEA 1470
            D L KQL V             +  EY+IW          N +L     LL  K+ ++E 
Sbjct: 99   DALKKQLHVSHEAMREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMEN 158

Query: 1471 I------NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLN 1632
            I      N  +++++ D  V Q K+L L+++    E+    +K  L +   +  ++  L 
Sbjct: 159  ILQRCKSNAISLQLKYDTSV-QEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLE 217

Query: 1633 EIDEQIAAKFDKLAIIKNETISENNQLS 1716
            E   Q+ + ++ +       +++N QLS
Sbjct: 218  EKLYQMQSNYESVFTYNKFLLNQNKQLS 245

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQ---------VKKLNLENEIKDH----EE 1563
            E   T  +E     + +NE   R +++I+ L+         ++++N E  +K+     + 
Sbjct: 71   EQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQS 130

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAI---IKNETISENNQLSILTKKL 1734
            +D+ N  +   LN E   L R     E I  +    AI   +K +T  +  +L + +KKL
Sbjct: 131  RDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKL 190

Query: 1735 EEERIA 1752
             EE+++
Sbjct: 191  IEEKLS 196

>NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON}
            Anc_2.215 YIL138C
          Length = 217

 Score = 35.8 bits (81), Expect = 0.22
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 13/96 (13%)
 Frame = +1

Query: 1459 KIEAINENNMRIQKDIEVLQ----------VKKLNLENEIKDHEEKDKLNKDVLQKLNVE 1608
            +I+A+   N +++  ++ L+            KL+LEN++K    K++  +D ++KL  E
Sbjct: 60   EIKALTVKNQQLESQVDKLEDDVDGGKHMEQDKLDLENQVKSLTVKNQQLEDEVEKLESE 119

Query: 1609 KDYLPRLNEIDEQIAA---KFDKLAIIKNETISENN 1707
             +   RLNE D  + +    F K      E + E+N
Sbjct: 120  LEECKRLNEEDSNLKSNNENFTKKIDQLEEELEESN 155

>KAFR0A04140 Chr1 complement(832546..834540) [1995 bp, 664 aa] {ON}
            Anc_8.726 YOR275C
          Length = 664

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = +1

Query: 1417 NLENLTTLLDEKIAKIEAINE--NNMR--IQKDIEVLQVKKLNLENEIKDHEEKDKLNKD 1584
            +L+N   LLD        I    NN+   +Q+D+E     + N        E+ + +NK 
Sbjct: 401  DLDNCKQLLDNLKTNSNNIGSQLNNLESILQEDLETDGKFRSNYGEAASILEQSENVNKP 460

Query: 1585 VLQKLNVEKDYLPRLNEIDEQIAAKF---DKLAIIKNETISENN 1707
             + KLN+ K YL +   +D +    +   DK+ II    + E+N
Sbjct: 461  FVSKLNILKGYLEKGISVDSETVGLYDTIDKVLIISPNNLPESN 504

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 36.6 bits (83), Expect = 0.26
 Identities = 26/114 (22%), Positives = 57/114 (50%), Gaps = 5/114 (4%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI---KDHEEKDKLNKDVL 1590
            LE+    L + +  + AI E+ ++ Q  I   Q +   L+ +I   K   E+ +   D +
Sbjct: 358  LESSKDALSKTVENLNAIRESIVKKQSQISYYQSRTKKLQQQILSTKSELERQQSLFDSM 417

Query: 1591 Q--KLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
               ++++  ++  +  E+  +     D+L  IKN+    N+++ +LTKK+E ++
Sbjct: 418  TPPEISLFDEFDKKREELINEDLKINDQLIAIKNKGSQNNHEIGMLTKKIENKK 471

>Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa] {ON}
            YPR049C (REAL)
          Length = 1180

 Score = 36.6 bits (83), Expect = 0.26
 Identities = 26/103 (25%), Positives = 52/103 (50%), Gaps = 1/103 (0%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP 1623
            +EK+AKI+ +  +   I K  E LQ   L L+   K+HEE++   K +++++N +   L 
Sbjct: 792  NEKLAKIDKLTNDYCDISKSRERLQ---LELDEARKEHEEENNSLKAIIERMNGQFTTLK 848

Query: 1624 RL-NEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
               +EI      K +K+    +    + N L   + ++ +++I
Sbjct: 849  NNDSEIKSSSIEKIEKIETTPSSGGPDRNDLVSFSTQVLQDKI 891

>ZYRO0F10824g Chr6 complement(883483..884865) [1383 bp, 460 aa] {ON}
            similar to uniprot|P38934 Saccharomyces cerevisiae
            YOR198C BFR1 Component of mRNP complexes associated with
            polyribosomes implicated in secretion and nuclear
            segregation multicopy suppressor of BFA (Brefeldin A)
            sensitivity
          Length = 460

 Score = 36.2 bits (82), Expect = 0.28
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1087 YNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNV--D 1260
            YNT+ ++ + ++  L+KQ+D                 +  E  ++K   D++S+ N   +
Sbjct: 21   YNTQLKKIDGEIAVLRKQIDQNQISDVTQNERKKLQEQTRE--IIKTQADLKSRRNAIHE 78

Query: 1261 KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 1440
            + K +      K  +IN K    AK                AI+      +G+L    TL
Sbjct: 79   RVKQLDANIKRKTGEINEKLGRKAKYSTTAEVKQRINEIEEAIS------SGDL----TL 128

Query: 1441 LDEK--IAKIEAINENNMRIQKDIEVLQVKKLNLENEIKD----HEEKDKLN-KDVLQKL 1599
            +DEK  + +++A+N    ++ KD+  ++  K ++EN+ +      EE  +LN ++V  K 
Sbjct: 129  VDEKRLVKEMQALN----KLNKDLVAVEPVKKSIENDKQQIASLKEELSQLNPREVSDKF 184

Query: 1600 NVEKDYLPRLNEIDEQIAAKFDKLAIIKNE 1689
               ++   +LN +  +    +DK   + N+
Sbjct: 185  EQTQE---KLNSLQSKTQGVYDKRQTLFNK 211

>KNAG0M02260 Chr13 complement(417569..420112) [2544 bp, 847 aa] {ON}
            Anc_2.590 YKL050C
          Length = 847

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 57/255 (22%), Positives = 107/255 (41%), Gaps = 13/255 (5%)
 Frame = +1

Query: 1024 NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEI 1203
            N E+K  ++ L   NAAE EK+N   +  E +L E  K LDD                E+
Sbjct: 435  NAEKKYANDKLNAKNAAE-EKFNEMVKRMEARLKERNKDLDDTKQAYEDLKEEISMKLEM 493

Query: 1204 MEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXX 1383
             + +  K V    +KY      V ++ +   L+    ++DL A + +             
Sbjct: 494  EQERADKEVAS-WAKYREKDIDVARDEQENLLKPY--RDDLAAAETEQEALITNYDAINE 550

Query: 1384 AITNEYNI----------WNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN 1533
             I    ++          + G LE+  T    ++  I+ ++ N   ++ D++   + + N
Sbjct: 551  EIVRLNSVVKHHKSKIEEYTGTLESQGTREQRELTLIDDLDGNRGELETDMDEQLIIRAN 610

Query: 1534 LENEIKDHEEKDKLNKDV-LQKLNVEKDYLPRLNEIDE-QIAAKFDKLAIIK-NETISEN 1704
                 K  EE +   K+  L++L VE     R  E+++  I  + +KL +++  + ++E 
Sbjct: 611  -----KAREEAELATKEARLKQLEVEAAINERRTELNQTDIDLQKEKLNLLEAMQLVAEA 665

Query: 1705 NQLSILTKKLEEERI 1749
                   +KL+EERI
Sbjct: 666  RG----DEKLDEERI 676

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 36.2 bits (82), Expect = 0.33
 Identities = 66/315 (20%), Positives = 128/315 (40%), Gaps = 23/315 (7%)
 Frame = +1

Query: 856  ISGAKGSNKTAKAGASNMTLGV------AVPETHAVASPENPEYLVRTNEYNIVSKAVYD 1017
            ++GAK S  T+    S            A   +  V S E+  +  +++     + A+  
Sbjct: 292  MAGAKVSTPTSNLSKSKKKKNKKNRAKKASDPSEEVHSEESQAFQEKSSSPGDAALAIEA 351

Query: 1018 QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXX 1197
            ++ YEQ L     ++FN                KL ELQK+ +D                
Sbjct: 352  KVRYEQLL-----EDFN----------------KLKELQKESEDWKIKYESLVLQTKDLE 390

Query: 1198 --EIMEYQLVKNVLDVQSKYNVDK--GKVIKETELMKLQKINAKEDLLAKQLDVXXXXXX 1365
              E    QL + +  +QS+Y   +   K ++ +   K+++++  +D+L +          
Sbjct: 391  GVEARAKQLSEQLAGLQSEYEDLQVAHKDLQSSLKSKIEELDNVKDMLKE------VGNE 444

Query: 1366 XXXXXXAITNEYNIWNGNLENLT----TLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN 1533
                   I N   + N  +E+L     +L +     I+   +N   + K +  +  KK+ 
Sbjct: 445  LVEAKDQIKNANGVKNHEVEDLKMQLESLRNNNSDVIKNYEKNLNELNKKVADVNEKKVK 504

Query: 1534 LENEIK--------DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAII-KN 1686
            LENE K         H+EKD+L K+    L+  K+++ ++ +    +A +  +   + KN
Sbjct: 505  LENETKTLQTALAKSHQEKDELKKN----LSESKEFISKIRKESNTLADQLREYNFLKKN 560

Query: 1687 ETISENNQLSILTKK 1731
            E++    +LSI  K+
Sbjct: 561  ESVM---KLSITQKE 572

>KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.215
            YNL079C
          Length = 161

 Score = 34.7 bits (78), Expect = 0.34
 Identities = 35/147 (23%), Positives = 64/147 (43%), Gaps = 1/147 (0%)
 Frame = +1

Query: 1207 EYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXA 1386
            +Y+ +K+      + N +K   IK   + K +++  + + L  QL              +
Sbjct: 21   KYEELKDQYKELEQGNTEKENQIKSLTV-KNEQLETEVENLESQLAESKQLGEDSTNLQS 79

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAK-IEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
                 N  N  LEN     D K+ + IE + + ++R+++    L+ + + LENE    EE
Sbjct: 80   TNENLNKKNETLENDLEETDSKLKETIEKLRDADLRVEQ----LEKRLVALENEKDQLEE 135

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDE 1644
            K++          +E  YL   NE+DE
Sbjct: 136  KNQ---------ELESQYLQAKNELDE 153

>NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1389

 Score = 36.2 bits (82), Expect = 0.34
 Identities = 71/308 (23%), Positives = 117/308 (37%), Gaps = 4/308 (1%)
 Frame = +1

Query: 832  ATFSIKSLISGAKGSNKTAKAGA----SNMTLGVAVPETHAVASPENPEYLVRTNEYNIV 999
            ++  + S+ S     NK+A AG+    SN     A  E  A  S    +    +N+ N +
Sbjct: 537  SSLGMPSVQSPLNNMNKSATAGSGFGFSNNNDLFADGEASAQLSTATTDLANLSNQVNSL 596

Query: 1000 SKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXX 1179
            SK         Q   +   K+    E ++ N  K   E KL  L+K  D           
Sbjct: 597  SK---------QASITNDKKSRAVQELKRVNDMKASIESKLSTLRKTHDSNVKET----- 642

Query: 1180 XXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXX 1359
                  E +E QLV++     +K      + +  TE      I +K + L +QL      
Sbjct: 643  ------ESLESQLVQS-----NKQTESLKQQLAVTEA-NYHAIESKLNELTEQLSTSQET 690

Query: 1360 XXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLE 1539
                     ITN     N  +  L + L+EK   ++          K +E+ Q+   NL+
Sbjct: 691  NNTLKEQ--ITN----LNSMMATLQSQLNEKQTHVKQERSMVDVNSKQLELNQITVGNLQ 744

Query: 1540 NEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSI 1719
             EI   +EK K+    L K N   +Y   + +   Q+ +K+  L    N+      QL+ 
Sbjct: 745  KEINGLDEKLKI---YLTKQNELNEYQKTIEDQHAQLQSKYTSLDEKNNDLNERELQLND 801

Query: 1720 LTKKLEEE 1743
               ++EE+
Sbjct: 802  RNNQIEEQ 809

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 15/125 (12%)
 Frame = +1

Query: 1405 IWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLE-------NEIKDHEE 1563
            I N  +E+L+  +D  +AK++ +     +   D+   Q +  N+E       NE+K  EE
Sbjct: 976  IQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVERDIELSSNELKVIEE 1035

Query: 1564 KD--------KLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSI 1719
            K         K + DV   LN++ D   +  ++ E++A    K+   K+  +   N+L  
Sbjct: 1036 KSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEK 1095

Query: 1720 LTKKL 1734
            L   L
Sbjct: 1096 LNSLL 1100

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
            complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 41/177 (23%), Positives = 81/177 (45%), Gaps = 17/177 (9%)
 Frame = +1

Query: 1261 KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 1440
            KG +I++   MKL K+N+ + L+ K   V                  N W      L  L
Sbjct: 808  KGNLIRQLTQMKLSKLNSSK-LIGKNFVVYEQEMAN-----------NPWFRLYIKLLPL 855

Query: 1441 LD--EKIAKIEAINENNMRIQKDIEVLQVKKLNL--ENEIKDHEEKD--KLNKDVLQKLN 1602
            L+  + I + +  +EN  R++  I+ L+  K  L   NE+K++E +   +L K   +KL 
Sbjct: 856  LNSSQDIVRQKKYSENVKRLEHKIDDLEKNKTELINTNELKNNELEQIRELLKVETKKLE 915

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAI-----------IKNETISENNQLSILTKKLEE 1740
             +   L      + +++ K +KL +           I++E    N+++ I+++++E+
Sbjct: 916  GKNQLLQTSKNAELELSEKLEKLKLINDKLEISKIAIEDENSRINDKIKIISEEIEK 972

>NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {ON}
            Anc_8.636 YOR216C
          Length = 487

 Score = 35.8 bits (81), Expect = 0.37
 Identities = 60/347 (17%), Positives = 132/347 (38%), Gaps = 18/347 (5%)
 Frame = +1

Query: 757  IDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPET 936
            I  ++ P V  P +  +     K     ++K  ++      +  K+ ASN         T
Sbjct: 55   ISEAVAPEVLEPKVNENTELQKKDAEIEALKKELAHLTKEFEETKSRASNEVPAQVKITT 114

Query: 937  HAVASPENPEYLVRTNE--------YNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYN 1092
             + A+ +  E   +  E        YN++   +    N  QK+        +  E E   
Sbjct: 115  ESEATSDQTEEFTKVKEERDHFESQYNMLLSRISSMKNVFQKMKE------SQRELELVQ 168

Query: 1093 TKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKV 1272
             +  EYE + ++L+ +++                      +L   V+ +  +++      
Sbjct: 169  EQLNEYESQNIKLKSKVESVTKENK---------------ELSSTVITLNKEFST----- 208

Query: 1273 IKETELMKLQKINAKEDLLAKQLD--VXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLD 1446
              E+E   L+  +++ +   K L+  +            A   E    +  L+ L  +LD
Sbjct: 209  -LESEYEALENTSSEYEKKIKSLEHQLDNSSSTHSHALEASQKEKEQLDSQLQELIVILD 267

Query: 1447 EKIAKIEAINENNMRIQKDIEVLQVKKLNLEN-----EIKDHEEKDKLNKDVLQK---LN 1602
                 I  + +    ++++++  + +K NLEN      +K  EE ++  +++ +K   +N
Sbjct: 268  NNKQDIADLKDEKEELKQNLQTYENEKKNLENLVEQVSMKLEEETNRSKENIQEKEKEIN 327

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
              +  L    E ++++A +   L    N+ I +  + +    KLEEE
Sbjct: 328  ALRVQLDTKLETNKELAQEMQNL----NDEIEKLKEGTAAKAKLEEE 370

 Score = 35.4 bits (80), Expect = 0.49
 Identities = 62/270 (22%), Positives = 102/270 (37%), Gaps = 14/270 (5%)
 Frame = +1

Query: 982  NEY---NIVSKAVYDQMNYEQKLHSEWLKNFNA------AEDEKYNTKKQEYEDKLVELQ 1134
            NEY   NI  K+  + +  E K  S  +   N       +E E       EYE K+  L+
Sbjct: 172  NEYESQNIKLKSKVESVTKENKELSSTVITLNKEFSTLESEYEALENTSSEYEKKIKSLE 231

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             QLD+                E ++ QL + +             VI +     +  +  
Sbjct: 232  HQLDNSSSTHSHALEASQKEKEQLDSQLQELI-------------VILDNNKQDIADLKD 278

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKI-AKIEAINENNMR 1491
            +++ L + L                   Y     NLENL   +  K+  +     EN   
Sbjct: 279  EKEELKQNLQT-----------------YENEKKNLENLVEQVSMKLEEETNRSKENIQE 321

Query: 1492 IQKDIEVLQVK-KLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDK 1668
             +K+I  L+V+    LE   +  +E   LN D ++KL        +L E  +  A +  K
Sbjct: 322  KEKEINALRVQLDTKLETNKELAQEMQNLN-DEIEKLKEGTAAKAKLEEESKNQAVQIAK 380

Query: 1669 L---AIIKNETISENNQLSILTKKLEEERI 1749
            L   AII NE +++   L++L K  + E +
Sbjct: 381  LRHEAIILNEHLTK--ALAMLKKSSDSESV 408

>KNAG0F03060 Chr6 (582233..583105) [873 bp, 290 aa] {ON} Anc_6.77
            YLR283W
          Length = 290

 Score = 35.4 bits (80), Expect = 0.38
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 6/86 (6%)
 Frame = +1

Query: 1474 NENNMRIQKDIEVLQVKKL--NLENEIK---DHEEKDKLNKDVLQKLNVEKDYLPRLNEI 1638
            N+ N +  +D E+ +   L  +LE+EI    D     +LN++ LQ + +++D    ++EI
Sbjct: 125  NDYNDKFLRDFEIDKQLHLYHSLESEIHYIIDKSRSTELNRNHLQLMRLQRDLGTTVDEI 184

Query: 1639 DEQIAAKFDKLAIIK-NETISENNQL 1713
            +E I   FDK A ++ N+  S+N  L
Sbjct: 185  NELIIDSFDKDAKLELNQQKSDNTLL 210

>TPHA0E00390 Chr5 complement(64714..67113) [2400 bp, 799 aa] {ON}
            Anc_7.488 YBL047C
          Length = 799

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 32/129 (24%), Positives = 64/129 (49%), Gaps = 6/129 (4%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK 1566
            I NE N  N   + + T L++    +   ++ N+   K+ E L++  +  +NE+K  ++ 
Sbjct: 300  INNELNRINATKKQIETKLED----LHVTHDKNV---KETEQLELNLIQRQNELKALQKH 352

Query: 1567 -DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISEN-----NQLSILTK 1728
             D+L  D   +L        ++N+++E +     K+AI K    ++N     +    LTK
Sbjct: 353  LDQLELDNTSELT-------KINQLNENL-----KIAIKKKNDFTKNITTLKSSSETLTK 400

Query: 1729 KLEEERIAH 1755
            K+EE++I +
Sbjct: 401  KIEEDQIKY 409

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
            YEL061C
          Length = 963

 Score = 35.8 bits (81), Expect = 0.43
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 11/155 (7%)
 Frame = +1

Query: 1219 VKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNE 1398
            ++N+L+   + N  K  +I     +  + ++ + D L  +L              A+ NE
Sbjct: 753  IQNLLNEHLRAN--KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNE 810

Query: 1399 YNIWNGNLENLTTLLDEKIAKI-EAINENNMRIQKDIEVLQVKKLN---------LENEI 1548
            +N    N+E+  T + +KI +  ++IN N  +I +  +   +   N         ++N  
Sbjct: 811  FN---DNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNF 867

Query: 1549 KDHEEKD-KLNKDVLQKLNVEKDYLPRLNEIDEQI 1650
            K  EEK+ +L++ V +   V  + + +LNE+D  I
Sbjct: 868  KSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSI 902

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score = 35.8 bits (81), Expect = 0.45
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 15/115 (13%)
 Frame = +1

Query: 1447 EKIAKIEAINENNMRI---QKDIEVLQVKKLNLENEIKD-HEEKDKLNKDV------LQK 1596
            E++A I+ I+    RI   +KD+E  Q      EN++K   + K    K++      L K
Sbjct: 336  ERLATIKRIHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNK 395

Query: 1597 LNVEKDYLPRLNEIDEQIAAKF-----DKLAIIKNETISENNQLSILTKKLEEER 1746
             N+ ++ L +   + E+  +       +KLAI+KN+    N +  ++ K+L+  R
Sbjct: 396  FNLSEEDLKQYELLKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTR 450

>Smik_15.78 Chr15 (135387..144617) [9231 bp, 3076 aa] {ON} YOL081W
            (REAL)
          Length = 3076

 Score = 35.8 bits (81), Expect = 0.48
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 9/105 (8%)
 Frame = +1

Query: 829  NATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKA 1008
            ++TF++ S+I+    +N+    G+S+       P T + +SP  P  L   N  N+++K+
Sbjct: 380  HSTFNVNSMIT----TNQNVYQGSSS-------PSTSSPSSP--PSSLSSDNNQNVIAKS 426

Query: 1009 VYDQMNY---------EQKLHSEWLKNFNAAEDEKYNTKKQEYED 1116
            +  Q+++         E+KLHS W  N  ++     +T      D
Sbjct: 427  LNRQLSHHQSYIQQQPERKLHSSWTTNSQSSTSLSSSTSSSTTTD 471

>TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score = 35.4 bits (80), Expect = 0.48
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 10/146 (6%)
 Frame = +1

Query: 1237 VQSKYNVDKGKVIKETE-LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWN 1413
            +Q K N+ K +++ E E L + +++  +  +L++Q++             A ++  N  N
Sbjct: 302  LQIKLNIVKEQLVSENERLSRAKRLKEQNLILSEQINSISEYKNQLSRNFAPSSTINN-N 360

Query: 1414 GNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK---------DHEEK 1566
             +L N+        A+IEA   N   + + +E +  ++LNLEN+ +         D ++ 
Sbjct: 361  LDLNNIPIK-----AQIEAYKRNQKLLDQHLENVIEERLNLENKFRRVLALCLKVDEDKV 415

Query: 1567 DKLNKDVLQKLNVEKDYLPRLNEIDE 1644
            D +   +LQ +  E    P   E+ E
Sbjct: 416  DGMLDGLLQAIEAENGDEPSTGEMQE 441

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 35.4 bits (80), Expect = 0.58
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 13/117 (11%)
 Frame = +1

Query: 1417 NLENLTTLLDEKIAKIEAINENNMRIQKDI--EVLQVKKLNLENEIKD--------HEEK 1566
            + +   T L+E    + A + + ++ QK++  E L  K    EN+IKD         EE 
Sbjct: 219  DFQETQTDLEETDRVVNAYDYHRLKSQKELFKETLSSK----ENKIKDLNSQISKLAEEL 274

Query: 1567 DKLNKD---VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
            + LN+D   + +K N E D    L++++E+           +NE I+E ++L++L K
Sbjct: 275  ESLNEDFEEIRKKKNAEMDKNSNLSKLEEE-----------ENEIINETSKLNVLLK 320

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 35.4 bits (80), Expect = 0.58
 Identities = 49/236 (20%), Positives = 93/236 (39%), Gaps = 11/236 (4%)
 Frame = +1

Query: 1081 EKYN---TKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKY 1251
            +KYN    K  E E KL+E+QK+L +                   E  L  + L++  + 
Sbjct: 681  QKYNHAVAKVNELELKLIEMQKKLKEQEETSQKTKSLQN------ELNLADHKLNIAQRR 734

Query: 1252 NVDK--GKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLE 1425
             V+    ++IK  + +  +    +E +L ++ +                      N  L 
Sbjct: 735  LVENSAAQIIKRNKELHEELQGCEEQILVEKKNASALEIEIETTKKDAEEFSKDKNSKLS 794

Query: 1426 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNV 1605
             L   +++    IE +   +  +    + LQ++   L NEIK ++E  +  K  + KL  
Sbjct: 795  KLKNEIEKLNKAIEDVENKSESLYDLYQNLQLETEQLANEIKSNKEMMEQTKANVGKLEE 854

Query: 1606 EK----DYLPRLNE--IDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            EK     +L  LN   I+ Q   K ++  ++  +   E  +L  L K  ++ +  H
Sbjct: 855  EKVSVDSHLQELNTSLIEVQTRVKEERARLLGID--EELKELESLVKSKQDTKSQH 908

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 50/196 (25%), Positives = 93/196 (47%), Gaps = 21/196 (10%)
 Frame = +1

Query: 1228 VLDVQSKYNVDKGKVIK-ETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYN 1404
            ++D+Q KYN    KV + E +L+++QK   +++  +++               ++ NE N
Sbjct: 677  LVDIQ-KYNHAVAKVNELELKLIEMQKKLKEQEETSQKTK-------------SLQNELN 722

Query: 1405 IWNGNLENLTTLLDEKIAK--IEAINENNMRIQKDIEVLQVKKLN---LENEIKD-HEEK 1566
            + +  L      L E  A   I+   E +  +Q   E + V+K N   LE EI+   ++ 
Sbjct: 723  LADHKLNIAQRRLVENSAAQIIKRNKELHEELQGCEEQILVEKKNASALEIEIETTKKDA 782

Query: 1567 DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAK----FDKLAIIKNET------ISENNQLS 1716
            ++ +KD   KL+  K+ + +LN+  E +  K    +D    ++ ET      I  N ++ 
Sbjct: 783  EEFSKDKNSKLSKLKNEIEKLNKAIEDVENKSESLYDLYQNLQLETEQLANEIKSNKEMM 842

Query: 1717 ILTK----KLEEERIA 1752
              TK    KLEEE+++
Sbjct: 843  EQTKANVGKLEEEKVS 858

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score = 35.4 bits (80), Expect = 0.60
 Identities = 55/272 (20%), Positives = 97/272 (35%), Gaps = 36/272 (13%)
 Frame = +1

Query: 1033 QKLHSEWLKNFNAAEDEKYNTKK------QEYEDKLVELQKQLDDXXXXXXXXXXXXXXX 1194
            +KL    LK  ++ EDE  N  K      QEY  KL    K+L D               
Sbjct: 502  EKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQKKEKT----- 556

Query: 1195 XEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAK----EDLLAKQLDVXXXXX 1362
             E      +  + D  S + +D GK +          I+A     E+L     DV     
Sbjct: 557  -EKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLD 615

Query: 1363 XXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQK-------DIEVLQV 1521
                      + YN+   N+  L +  +E   ++  + +N +  +K       D    + 
Sbjct: 616  KEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCKS 675

Query: 1522 KKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL-----------PRLNEIDEQIAAKF-- 1662
            K    E EI     +++L+ +    L  +K+ L            ++N ++ ++      
Sbjct: 676  KLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKE 735

Query: 1663 ------DKLAIIKNETISENNQLSILTKKLEE 1740
                  DKL I   +    NNQL ++ +++ E
Sbjct: 736  TKSGYDDKLKISALKCTQTNNQLQLVQQRMSE 767

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 35.4 bits (80), Expect = 0.60
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN-----------LENEIKDHEEK 1566
            L+ L    DEKIA +E   ++  + Q+    L+++K             L++E  +H+E 
Sbjct: 1085 LQELKKSSDEKIASLEKSRKDLEKFQQKFRDLELEKSKTQDALTDLQKALQDEKNNHQES 1144

Query: 1567 DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
             +L KD +++L +EK+      E  E + ++  KL     +T+ + N+   L  +  E++
Sbjct: 1145 LQLQKDKIKQLALEKE---NSAESTEALKSEVSKL----RQTVEDLNKSHKLVHEDYEKK 1197

Query: 1747 IA 1752
            ++
Sbjct: 1198 VS 1199

>Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR023W
            (REAL)
          Length = 1929

 Score = 35.4 bits (80), Expect = 0.61
 Identities = 55/265 (20%), Positives = 106/265 (40%), Gaps = 4/265 (1%)
 Frame = +1

Query: 964  EYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLK---NFNAAEDEKYNTKKQEYEDKLVELQ 1134
            +YL R  + +I ++A YD  N    LH ++ K     + +  + Y  K +  E+++  L+
Sbjct: 1326 DYLKR--QLDIEARAHYDAENVITALHDKFRKIQGEGSLSSSDIYKLKFEASEERVKSLE 1383

Query: 1135 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 1314
             +L                             + ++ + N+  G +IK            
Sbjct: 1384 DKL---------------------------KTMPLRDRTNLPVGDIIKN----------- 1405

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 1494
              D ++K  +              I NE N   G L  LT  L +  +K   ++E   R+
Sbjct: 1406 -RDSISKYEEEIRYYKLENYKLQEILNESN---GKLSKLTHDLRQSNSKEAMLSEQLDRL 1461

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-KDYLPRLNEIDEQIAAKFDKL 1671
            QKD+E  + +K  L + +K  +++ +   D LQ   ++ ++++  L +  E I +    +
Sbjct: 1462 QKDLESTERQKELLSSTMKQQKQQFENCMDDLQGNELQLREHVHALKQAQEDIKS----M 1517

Query: 1672 AIIKNETISENNQLSILTKKLEEER 1746
            A I     ++N Q   L  + E ER
Sbjct: 1518 ATIIERLKTQNKQKEKLIWEREMER 1542

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 23/94 (24%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = +1

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLE-------NEIKDHEEKDKLNKDVLQKLNVEK 1611
            +++ +  NE   +++ +++ ++ KK  LE       NE+K+ +E  KL ++ L+K   ++
Sbjct: 861  MSRTKKFNEQINKLKDNLQEMESKKKFLEDRNQSTINELKETQELLKLEQENLKK---KE 917

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQL 1713
              L R+    E + ++FD +   KNE   +  Q+
Sbjct: 918  SLLSRVKTNSETLQSQFDGIVTEKNEINKQKLQI 951

 Score = 33.1 bits (74), Expect = 3.1
 Identities = 35/168 (20%), Positives = 77/168 (45%)
 Frame = +1

Query: 1240 QSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGN 1419
            +S+  +++ ++  ETE+ KL+++ + +D      +              +T E N  N  
Sbjct: 1002 KSQSLINESRLKLETEIRKLKEVISSKDSEINSFNEKLSSSEEDLDIKLVTLEKNC-NIA 1060

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            +  L +L+ E  + + + NEN   +QK+  VL  +  N ENE++   EK   ++  L   
Sbjct: 1061 MSRLQSLVAEN-SDLRSKNEN---LQKEKAVLSNQLKNKENELQKMREKIDNHQKELAIF 1116

Query: 1600 NVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            + ++D             ++  K+++   ET ++  +     +K+E+E
Sbjct: 1117 SKQRD----------DAVSEHGKISVELKETRNQLTEYKSNCQKIEDE 1154

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 35.4 bits (80), Expect = 0.61
 Identities = 23/108 (21%), Positives = 53/108 (49%), Gaps = 1/108 (0%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            + L   LD++I ++     N   +  +    + K L LENE +D +  D   +  L++L+
Sbjct: 142  QELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLS 201

Query: 1603 VEKDYLPRLN-EIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
             E + + +    ++E++  K ++    + ++I+EN  L +    ++ E
Sbjct: 202  QELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNE 249

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 15/122 (12%)
 Frame = +1

Query: 1429 LTTLLDEK---IAKIEAINENNMRIQKDIEVLQVKKLNLENEIKD-HEEKDKLNKDV--- 1587
            LT  L EK   I K +A +++  +++ +I  LQ +   L+NE+ + + + +   KD+   
Sbjct: 886  LTKQLKEKTELIEKYKAASDDEGKLE-EISSLQKELQVLKNELTESYSQTESYRKDIELL 944

Query: 1588 --------LQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
                     Q LN E  +  R+ E++       D   ++K +    NN+L +  K  E+E
Sbjct: 945  NQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDE 1004

Query: 1744 RI 1749
            +I
Sbjct: 1005 KI 1006

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 35.4 bits (80), Expect = 0.61
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 2/109 (1%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL- 1599
            + L   L++  AKI+A +E        +   + K L LE +IKD E+   + KD    L 
Sbjct: 1322 KELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSLK 1381

Query: 1600 -NVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
              +EK  L  +NE    + +  D +  +KNE    N++L    K+ EE+
Sbjct: 1382 SELEKTAL-EMNE----LRSDNDNIIKLKNELQRTNDKLIEENKRTEEK 1425

>SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 aa]
            {ON} similar to uniprot|Q750B4 Ashbya gossypii AGR043W
            AGR043Wp and weakly similar to YDR150W uniprot|Q00402
            Saccharomyces cerevisiae YDR150W NUM1 Protein required
            for nuclear migration localizes to the mother cell cortex
            and the bud tip may mediate interactions of dynein and
            cytoplasmic microtubules with the cell cortex
          Length = 3729

 Score = 35.4 bits (80), Expect = 0.63
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 5/102 (4%)
 Frame = +1

Query: 1411 NGNLEN-LTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLE----NEIKDHEEKDKL 1575
            N  LE  L TL  E     E+ N+N   +QK I++    K  LE      I   EE    
Sbjct: 144  NWELETKLQTLSQEFKDLTESFNKNQREVQKQIDLSNHIKTELEEVSLERIGLREELSSK 203

Query: 1576 NKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISE 1701
             +  L +++  K ++  LNE ++Q+ +K + L I   E  +E
Sbjct: 204  QQQHLLEISELKKHIQELNEENDQLNSKVEDLTIEVQELSAE 245

>NDAI0H01240 Chr8 complement(298365..299039) [675 bp, 224 aa] {ON}
            Anc_7.122 YIR017C
          Length = 224

 Score = 34.3 bits (77), Expect = 0.71
 Identities = 25/107 (23%), Positives = 56/107 (52%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1447 EKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV-------LQKLNV 1605
            +KI+  +  NE+N  + K+ E   ++ L  + E++   + +K  K+        ++K   
Sbjct: 109  KKISDNDKKNESNSDLIKEKEN-SIEPLQQQRELQSQTQLEKKRKNTEASTRFRIRKKQK 167

Query: 1606 EKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
            EKD + +LNE++ +I+  + K+    ++ +SEN       +K+ E++
Sbjct: 168  EKDNINKLNELNIKISKLYCKI----DKLLSENKSWKEKLQKINEQK 210

>TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {ON}
            Anc_3.106 YOL091W
          Length = 837

 Score = 35.0 bits (79), Expect = 0.73
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 15/133 (11%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK 1566
            +  E    +G+LE+  + L   +++ +A   NN+ +QK ++        ++  +K H   
Sbjct: 393  LREENKALSGDLESSKSELANLLSEFKAKEANNLELQKQLD-------EVKENVKAHRAD 445

Query: 1567 DKLNKDVLQKLNVEKDYLPR---------------LNEIDEQIAAKFDKLAIIKNETISE 1701
               +KD  QK   EK  L R               L+E  EQ   K  K   ++    + 
Sbjct: 446  LIYSKDECQKKIAEKQELERSLKETSEILKSLKLELSEFKEQCLKKDAKKVELEKALDNS 505

Query: 1702 NNQLSILTKKLEE 1740
            N ++  + K LEE
Sbjct: 506  NEKIYKMDKDLEE 518

>ZYRO0F01188g Chr6 (94085..96631) [2547 bp, 848 aa] {ON} similar to
            uniprot|Q05050 Saccharomyces cerevisiae YMR031C Protein
            of unknown function green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm in a
            punctate pattern
          Length = 848

 Score = 35.0 bits (79), Expect = 0.73
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            LE +    +  + +  AINE   R+ + I+  Q +    E EIK HEE++   ++ L+KL
Sbjct: 548  LEEVNREHESLVQERTAINEEIARLHESIKEHQYQISKYEREIKSHEEQNASAEEELKKL 607

Query: 1600 NVEKD 1614
              +++
Sbjct: 608  ETDRE 612

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 35.0 bits (79), Expect = 0.75
 Identities = 54/241 (22%), Positives = 99/241 (41%), Gaps = 10/241 (4%)
 Frame = +1

Query: 955  ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKN-FNAAEDEKYNTKKQEYEDKLVEL 1131
            E    L  TNE +  ++ +    N     + E  KN FN A    Y   K+ +E+K  E+
Sbjct: 607  EGERKLKETNEKH--NEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEEKSKEV 664

Query: 1132 QKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIK-ETELMKLQK- 1305
            + + +D                +  + +L  NV  ++ +    K  + K E ++  L   
Sbjct: 665  E-EANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNA 723

Query: 1306 -INAKEDLLAKQLDVXXXXXXXXXXXXAIT----NEYNIWNG--NLENLTTLLDEKIAKI 1464
             + A++ L  + L               I     NE N+     NLE   + L +KI  I
Sbjct: 724  LVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKNLEENESTLKDKIKMI 783

Query: 1465 EAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDE 1644
            E  NE+++     I VLQ  ++ L++++ D   K   N +++    ++KD+    + I E
Sbjct: 784  EG-NEDDL--MGKISVLQSNEILLKDKLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIE 840

Query: 1645 Q 1647
            +
Sbjct: 841  K 841

>Kpol_1060.43 s1060 (105250..105720) [471 bp, 156 aa] {ON}
            (105250..105720) [471 nt, 157 aa]
          Length = 156

 Score = 33.5 bits (75), Expect = 0.79
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 3/95 (3%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+ K   IE  N+ N R           K + +N   +H E + + K+ L  L+++K+YL
Sbjct: 23   LERKHNWIEDTNDENNR-----------KKHKKNHRYNHPELEFITKNTLSYLSIDKNYL 71

Query: 1621 PRLNEIDEQ--IAAKFDKLAIIKNETISE-NNQLS 1716
            P+  E +EQ   A K   L  + +E  +E  NQL+
Sbjct: 72   PQEEEQEEQDKDALKTSPLNRMNDERFTELVNQLN 106

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 35.0 bits (79), Expect = 0.80
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 33/187 (17%)
 Frame = +1

Query: 1276 KETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGN------------ 1419
            +E E ++ +  N K++L+  +LD             +++ EY   +GN            
Sbjct: 712  EEFEELQGRCANLKKELVQLELDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLE 771

Query: 1420 ---------LENLTTLLDEKIAKIEAINENNMRI-------QKDIEVLQVKKLNLENEIK 1551
                     LEN++T L E     E +   N +I       +K IE  + K   LE++++
Sbjct: 772  GKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYESKINTLESKLR 831

Query: 1552 DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDK-----LAIIKNETISENNQLS 1716
            D   K +  ++ + K++ E   L +  E  E    K +K     L  +KNE    +N L+
Sbjct: 832  DITSKKEQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKELENMKNENKKLDNTLA 891

Query: 1717 ILTKKLE 1737
               K+L+
Sbjct: 892  KKEKELQ 898

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 53/242 (21%), Positives = 91/242 (37%)
 Frame = +1

Query: 1018 QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXX 1197
            Q+N ++K+    +K+F   ++     K QE E+ L E +K + D                
Sbjct: 1626 QLNEKEKV----IKDFEVTKE-----KLQETENALSEKEKAMQD---------------- 1660

Query: 1198 EIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXX 1377
                ++  K  L        +K K  ++ E+ K + +  ++ L  K   V          
Sbjct: 1661 ----FEATKEKLQETENALSEKEKAAQDFEITKKKLVETEKALSEKGKAV---------- 1706

Query: 1378 XXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDH 1557
                  +  I    L+     L EK  K+E   E +   +K+++     K +LE      
Sbjct: 1707 -----EDLEITTNKLKESEIELTEKGKKLEHFKETSATFEKELQEAIAGKKSLE------ 1755

Query: 1558 EEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
            E+   L  ++L   N        L E D  I  K   ++  + +  SE  +L  L KKLE
Sbjct: 1756 EKASLLESELLDLKN-------SLEEKDSVIQKKEQLISQSQQKNNSELMELRDLLKKLE 1808

Query: 1738 EE 1743
            EE
Sbjct: 1809 EE 1810

>Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 34.7 bits (78), Expect = 0.85
 Identities = 48/233 (20%), Positives = 99/233 (42%), Gaps = 19/233 (8%)
 Frame = +1

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQL----VKNVLDVQSKYNVDKGKVI-- 1275
            +K+ E QKQL++                ++ EY+     +K  L+     N +    I  
Sbjct: 153  NKMKEAQKQLEEVQE-------------QLTEYESQNLKLKKKLEATKTENSELQSAIVT 199

Query: 1276 --KETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDE 1449
              KE E ++ ++ NA++  L  +  V            A   E N +    + L+  + E
Sbjct: 200  LNKEIEHLENEQENAEDVFLEYESSVEALQGEKHDIIEAHNKELNTYRKEKDQLSVQIQE 259

Query: 1450 KIAKIEAINEN--NMRIQKD-----IEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE 1608
             +  +E   ++  ++R ++D     +E  + +K  L+N + D E K +      Q+   E
Sbjct: 260  LMIILENNKQDISDLRTERDELKQALESHESEKAVLQNSVNDLELKIEETDSKRQEEGRE 319

Query: 1609 KDYLPRL--NEIDEQIAAKFDKLAIIKN--ETISENNQLSILTKKLEEERIAH 1755
            KD   +   +++D ++ A  + + I++N  + I +  +   + +K EEE   H
Sbjct: 320  KDLEVKALRSQLDTELEAHNNDIQILENLKKQIEDMREDVSMKEKYEEESKQH 372

>Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)
            [1788 nt, 596 aa]
          Length = 595

 Score = 34.7 bits (78), Expect = 0.90
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 4/122 (3%)
 Frame = +1

Query: 1396 EYNIWNGNLENLTTLLDEKIAKIEAIN----ENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
            E  + N +   L   +++K  K E ++    E+    +KD+  ++ +KL  E E+K  E 
Sbjct: 69   ETELKNDSTVKLNDSVEQKDNKQEVVDSDKDEDTKLSKKDLAAIRREKLKEEKELKRLER 128

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            + +  K   Q+L   ++   R ++++E+   + +K A +K    +   Q     +K EEE
Sbjct: 129  EKEKQKKEAQRL---EEKSKRESKLEEEKRKREEKAAEVKRRREALKLQKEEEKRKKEEE 185

Query: 1744 RI 1749
            R+
Sbjct: 186  RL 187

>NCAS0D00140 Chr4 complement(9836..11644) [1809 bp, 602 aa] {ON}
            Anc_2.16 YDL239C
          Length = 602

 Score = 34.7 bits (78), Expect = 0.90
 Identities = 51/225 (22%), Positives = 96/225 (42%), Gaps = 10/225 (4%)
 Frame = +1

Query: 1099 KQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIK 1278
            KQ YE+++  L+ +LD+                 ++E Q  K +  ++        K IK
Sbjct: 179  KQLYEEQVANLRNELDNLNSSHKANI-------SLLEQQQQKQLASMRDDLKEQYEKRIK 231

Query: 1279 ETEL-MKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITN-EYNIWNGNLENLTTLLDEK 1452
            +  L MK +K    + L  K  ++            ++T  + NI +  L+ + T + + 
Sbjct: 232  QLSLEMKTEKT---KQLQEKHQEIVKRNQNLETQIRSLTLFDKNIGDIVLQGMKTKVFDL 288

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLE-NEIKDHEEKDKLNKDVLQKLNVEK----DY 1617
             +  + I +       +++ +  K L+ E N++K   E   L K + Q  N EK    D+
Sbjct: 289  SSSFKKIYDIPQFYTAELDEM-AKSLSAESNQLKT--ENTNLKKQIEQFQNQEKFLKKDF 345

Query: 1618 LPRLNEID---EQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            +  +   D   +++      L   KN  I+ENN+LSI   +L E+
Sbjct: 346  VDNIQSKDLKIQELELANKNLVEEKNRFIAENNKLSIENNELREK 390

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 11/117 (9%)
 Frame = +1

Query: 1417 NLENLTTLLDE----KIAKIEAINENNMRIQKDI-------EVLQVKKLNLENEIKDHEE 1563
            +L    T L+E    K+ +I  +NE+ + ++K I       + L +   NL+ ++ D  E
Sbjct: 415  SLSQQKTYLEESNLKKVREISRLNESLVGMEKTIKELKENTQFLNITNKNLKKKMGDATE 474

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKL 1734
                +     +L++ KD   RL   D +     +   IIKN  +     L+ LTK+L
Sbjct: 475  MITFSNTCKVRLDITKDMYERLMVDDVEKMNLVELQNIIKNLILLFEIPLNKLTKRL 531

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
            hypothetical protein
          Length = 645

 Score = 34.7 bits (78), Expect = 0.92
 Identities = 53/277 (19%), Positives = 116/277 (41%), Gaps = 16/277 (5%)
 Frame = +1

Query: 955  ENPEYLVRTNEYNIVSKAVYDQM---NYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 1125
            +N +  ++  + ++ ++ ++      N + +L +E LK      + K +TK +EY   L 
Sbjct: 288  DNEQLTLKVKQLSLENQQLFQNSKPDNLKDEL-AEKLKGKIMQLEGKISTKDKEYHKVLT 346

Query: 1126 ELQKQLDDXXXXXXXXXXXXXXXXE-IMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 1302
            +L    ++                E   E ++++  L  Q+   V+    ++  +L + +
Sbjct: 347  QLNSLKNNSHDDSSQQSIVLKQLAEKTREAEILRRRLTEQNDRIVNNSNELENLKL-EYR 405

Query: 1303 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 1482
            ++ ++ DLLAK+ +                     W    E   T+  E + K+E   + 
Sbjct: 406  EVKSQYDLLAKEKE---------RTDFKCKEFQESWYEATERTKTIQAE-LLKLEKEKDQ 455

Query: 1483 NMRIQKDIEVLQVKKLNLENEI--KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAA 1656
             +   K  E   +K+   + ++     E  D L+K V +++        ++N + ++I  
Sbjct: 456  ILTESKKTEKELIKEHQNDQKLFLSSKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVK 515

Query: 1657 KFDKLAIIK------NETIS----ENNQLSILTKKLE 1737
              ++L  +K      NE++S    ENN+   LT+KLE
Sbjct: 516  LSEELNKVKEERTALNESLSSVTEENNKSKALTEKLE 552

>CAGL0G04917g Chr7 complement(470710..472650) [1941 bp, 646 aa] {ON}
            highly similar to uniprot|Q05931 Saccharomyces cerevisiae
            YLR369w SSQ1
          Length = 646

 Score = 34.7 bits (78), Expect = 0.92
 Identities = 22/102 (21%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = +1

Query: 1441 LDEKI-AKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            LD KI  KIE +N+ ++ +     V +  +  LE  +K+H  +  L  D++Q++N  K  
Sbjct: 546  LDNKIRTKIELLNKCDIMLSDTASVFEQYRDTLERNVKEHNREQDL-VDIVQEVNDLKGI 604

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            +  + ++D     + D  ++ K+    +   L +  + + ++
Sbjct: 605  VDEIKKMDSDKILEVDVDSLKKDVDALQGRSLKVFQELMAKK 646

>Kpol_1030.11 s1030 complement(22483..24027,24077..24085,24670..25203)
            [2088 bp, 695 aa] {ON}
            complement(22483..24027,24077..24085,24670..25203) [2088
            nt, 696 aa]
          Length = 695

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 48/215 (22%), Positives = 82/215 (38%), Gaps = 14/215 (6%)
 Frame = +1

Query: 1012 YDQMNYEQKLHSEWLKNFNAAEDEKYNT------KKQEYEDKLVELQKQLDDXXXXXXXX 1173
            +++++    + S  L     + D   NT      +K   +  L+ELQKQLD+        
Sbjct: 16   HERLSTPSSILSSVLNTLELSYDTSTNTLTGTSVEKIPEKKTLIELQKQLDNL------- 68

Query: 1174 XXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXX 1353
                        Y +++NV +V ++Y + + K I E    +  +   +ED   K      
Sbjct: 69   ------------YDVLENVSNVDNRY-IQRFKNIDERRNKETLENQEEEDKENKGKQEEE 115

Query: 1354 XXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKK-- 1527
                       I NE    N   E+L    DE   + E I+ +N  +    EV   +   
Sbjct: 116  SVKSEEPVGELIENESKE-NEKQESLENSADEVEPEKEKIDSDNAPVTPIQEVENGRSGK 174

Query: 1528 ------LNLENEIKDHEEKDKLNKDVLQKLNVEKD 1614
                   N+E + K  EE+D+ NK  +    +E D
Sbjct: 175  RSRRXXXNIEEDEKPKEEEDEKNKGDIDVYRMEND 209

>Suva_13.367 Chr13 (612556..614682) [2127 bp, 708 aa] {ON} YMR186W
            (REAL)
          Length = 708

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE--KDKLNKDVLQKLNVEKD 1614
            L+EK  K E I  ++  +   I++L  K++  E  I + EE  KD+  KD       E D
Sbjct: 185  LEEKKIK-EVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEEEKKDEEKKD-------EDD 236

Query: 1615 YLPRLNEIDEQIAAKFDKLAIIKNE 1689
              P+L E+DE+   K  K   +K E
Sbjct: 237  KKPKLEEVDEEEEEKKPKTKKVKEE 261

>YPL240C Chr16 complement(96496..98625) [2130 bp, 709 aa] {ON}
            HSP82Hsp90 chaperone required for pheromone signaling and
            negative regulation of Hsf1p; docks with Tom70p for
            mitochondrial preprotein delivery; promotes telomerase
            DNA binding and nucleotide addition; interacts with
            Cns1p, Cpr6p, Cpr7p, Sti1p
          Length = 709

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 23/69 (33%), Positives = 39/69 (56%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E I  ++  +   I+++  K++  E  I + E+KD+  KD  +K   E D  
Sbjct: 185  LEEKRIK-EVIKRHSEFVAYPIQLVVTKEVEKEVPIPEEEKKDEEKKDEEKK--DEDDKK 241

Query: 1621 PRLNEIDEQ 1647
            P+L E+DE+
Sbjct: 242  PKLEEVDEE 250

>NDAI0D04300 Chr4 complement(1008897..1011128) [2232 bp, 743 aa] {ON}
            Anc_4.268 YDL074C
          Length = 743

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 28/128 (21%), Positives = 58/128 (45%), Gaps = 12/128 (9%)
 Frame = +1

Query: 1396 EYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNL---ENEIKDHEEK 1566
            +Y +   +LEN   +L++ +  +E I   N    +++     +K+N+   ++        
Sbjct: 289  QYEVKISDLENQIVILNDTLKSLEEIKLENENKIRELNTQVSQKINISISKDRFNSSISV 348

Query: 1567 DKLNKDVLQ-KLNVEKDYLPRLNEIDEQIAAKFDKLAI--------IKNETISENNQLSI 1719
            D  ++D+L  K++        L E +EQ  +KF KL+         IK +  + N  L  
Sbjct: 349  DNSDRDMLMIKIDQLTKENKELTETNEQFLSKFQKLSSDQEFITNNIKEQFKASNGNLFK 408

Query: 1720 LTKKLEEE 1743
            + + LE++
Sbjct: 409  MNQSLEKD 416

>TDEL0B06830 Chr2 complement(1208432..1211107) [2676 bp, 891 aa] {ON}
            Anc_2.590 YKL050C
          Length = 891

 Score = 34.7 bits (78), Expect = 0.97
 Identities = 24/77 (31%), Positives = 38/77 (49%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            LL EK +    I E   +++  IE  + +    E +IK HEEK+   +  L +L  EKD 
Sbjct: 531  LLKEKTS----IEEEIEKLRTSIETHKEQLTKYEEDIKAHEEKETSERQRLTELGTEKDE 586

Query: 1618 LPRLNEIDEQIAAKFDK 1668
            L    ++DE +    +K
Sbjct: 587  L--RTDLDENVIVTANK 601

>Kpol_1065.43 s1065 (113142..115970) [2829 bp, 942 aa] {ON}
            (113142..115970) [2829 nt, 943 aa]
          Length = 942

 Score = 34.7 bits (78), Expect = 0.98
 Identities = 31/138 (22%), Positives = 54/138 (39%), Gaps = 10/138 (7%)
 Frame = +1

Query: 1276 KETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXX-AITNEYNIWNGNLENLTTLLDEK 1452
            KE E +K   +N   D+ +K +D               +   YN +    + LTT ++EK
Sbjct: 742  KEAESLKETDMNKFNDMKSKIVDTARAEFDAKMEDHNRLVGVYNDYVSLKDRLTTTVEEK 801

Query: 1453 IAKIEAINENNMRIQKDIEVLQVKKLNLEN---------EIKDHEEKDKLNKDVLQKLNV 1605
               I A N       K   + +V+K   E          E ++ EE+ K  ++  +K   
Sbjct: 802  FKLIRAENAAKFEAAKKARIEEVRKQRYEELVAERKAEIEAEEREERAKKQEETARKQKE 861

Query: 1606 EKDYLPRLNEIDEQIAAK 1659
             ++   R ++     AAK
Sbjct: 862  MEEAAERKSKASSAAAAK 879

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQ-KDIEVLQVKKLNLENEI------------- 1548
            N   E  T  +   +   E+ +   MR Q K+++ LQ + LN+EN++             
Sbjct: 778  NEIFEEFTNRVGFTVKDYESHSGEIMRQQSKELQQLQRQILNVENKLQFEKDRLSTTERR 837

Query: 1549 --KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSIL 1722
              K HE+  K+  ++ Q    EK+   R+N+ID+++A +  +L   + +  +++  +   
Sbjct: 838  FGKAHEDMAKIEFELTQLERQEKETESRINQIDQELADQKKELEQFQKKLDAKHGDIDST 897

Query: 1723 TKKLEE 1740
               L E
Sbjct: 898  EDALHE 903

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_8.425
          Length = 1350

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 8/101 (7%)
 Frame = +1

Query: 1390 TNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIE------VLQVKKLNLE--NE 1545
            TN  N +N N    T+  DE+ + +E I+E N   Q DI+      V+  + LNL   + 
Sbjct: 327  TNWVNDYNNNNIPSTSASDERTSPLEKIHEENEEAQPDIQQHTQQLVVPYQPLNLRTTSS 386

Query: 1546 IKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDK 1668
            +   +  DK+    L   N  KD +  +N+   ++  K D+
Sbjct: 387  LTLEDNNDKIEVKSLFSNNT-KDIIDEINQRANKLNNKLDE 426

>KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5.267
            YHR023W
          Length = 1891

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 4/107 (3%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL- 1599
            EN+   L EK  KI+ ++ ++   +   E  + K  +LEN+IK    KD+ N     ++ 
Sbjct: 1305 ENVAAALHEKFTKIQRVDSSSDIYKLKFEASEQKVKSLENKIKHMPLKDRTNLQSSGEIF 1364

Query: 1600 NVEKDYLPRLNEIDEQIAA-KFD--KLAIIKNETISENNQLSILTKK 1731
               K+Y    ++IDE++ A KF+  KL    +E+ +  N+L+   K+
Sbjct: 1365 RNRKEY----SKIDEELKAYKFENYKLQEHVDESYNLINKLNFEMKQ 1407

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 30/114 (26%), Positives = 53/114 (46%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            N  L+ +    D  + K E++NE N  + KD++ +  K    E EI    E  K +   +
Sbjct: 919  NDELDKIKLESDATLKKWESLNETNNTLTKDLKSMTDKMETREKEI----ETLKNDTTKI 974

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
             ++N +      L E  E+I  K  ++  +KN+T S  ++L    K L+   I+
Sbjct: 975  DEINTQ------LKEAKEKILQKDKEIITLKNDT-SAADKLESQLKDLQANLIS 1021

>TPHA0C01930 Chr3 (438203..439906) [1704 bp, 567 aa] {ON} Anc_8.460
            YDL207W
          Length = 567

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAIN-ENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV 1587
            N NLE +  +   K  + + I  E   R +K  E  + KK   E + K+ EE+ +L K+ 
Sbjct: 168  NSNLEQVKDIKKRKKEEEQRIRKEREDRERKIEEERRRKKAEEELKRKEEEERLRLEKEA 227

Query: 1588 LQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIK 1683
            L K   E +   +  + +E +  + +KLA +K
Sbjct: 228  LDKQKKELELKEKARKEEEALKTQQEKLAELK 259

>TDEL0E03150 Chr5 (592206..594128) [1923 bp, 640 aa] {ON} Anc_5.311
            YDR295C
          Length = 640

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 53/271 (19%), Positives = 115/271 (42%), Gaps = 8/271 (2%)
 Frame = +1

Query: 949  SPENPEYLV---RTNEYNI-VSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYED 1116
            SP + E L+   + +E+++ V KAVYD  +Y+ +L    ++     ++E  +  +   +D
Sbjct: 353  SPSSYEPLMTPLKFSEHHLTVDKAVYDMKSYQSELTKRVVERLLDVQNESQHMIEFLAKD 412

Query: 1117 KLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMK 1296
            KL E ++Q                      ++  +K  +  + K   +  K + ++E  +
Sbjct: 413  KLRETERQ---------------------NKFDEMKADIAAKFKKFQEVEKTVNDSE-KR 450

Query: 1297 LQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAIN 1476
            L++   + D L ++L              ++ NE ++        TT + E         
Sbjct: 451  LERCQTEADKLDQRLQTLNNDQDELKSLTSLENEVDV--------TTTIRE-------YT 495

Query: 1477 ENNMRIQKDIEVLQ---VKKLNLENEIK-DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDE 1644
            E + R+Q ++E L+    +K N   +++ D++ K  L  +  Q+L   K    +L + D 
Sbjct: 496  ERSNRLQSELEQLEKSNQEKSNQNEQLRSDYQHKSSLAAEQAQRLTTLKSSQEQLIK-DA 554

Query: 1645 QIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
               A      +++N+      +L+IL K+ +
Sbjct: 555  TGPAPSIPTEMLRNQESRLKEELNILKKQAQ 585

>Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] {ON}
            complement(173760..175733) [1974 nt, 658 aa]
          Length = 657

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 54/276 (19%), Positives = 114/276 (41%), Gaps = 21/276 (7%)
 Frame = +1

Query: 985  EYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXX 1164
            E ++V   +   + YE        +  N     +YN  +++Y+  L  L+K L+D     
Sbjct: 22   EDDVVRDELIKSLEYELNTVQNEFEIQNMRLQRQYNHLEKQYKSNLDTLEKTLND----- 76

Query: 1165 XXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLD 1344
                        +    L +N+ +++ +Y+    +VI+E E+ + + +N+  D++ ++ +
Sbjct: 77   -------MQELHVRNESLNRNLSELKKEYS----EVIEEKEI-QFKTLNSDYDVVKEECE 124

Query: 1345 VXXXXXXXXXXXXAITNEY-NIWNGNLENLTTLLDEKIAK--IEAINENNMRIQKDIEVL 1515
                             EY  +     +NL  + + +++K   + I+   +  +KD E  
Sbjct: 125  FLRNQYQTMASRVGDQEEYKKLETEASQNLIKMYENELSKQNKQIISLKKLVTEKDGE-- 182

Query: 1516 QVKKLNLENEIKDHEEKDKLNKDVLQKLNV-------EKDYLPRLNEIDEQIAAKFDKLA 1674
             ++ L     IK H+     N + LQ+L V       ++ Y+  L E + Q A +  K+ 
Sbjct: 183  -LEDLKANGVIKTHQ---NYNTEELQELTVVNKLLKDQQVYVKELEEANMQQANELKKIR 238

Query: 1675 IIKNET-----------ISENNQLSILTKKLEEERI 1749
             ++NE+             EN+  +   + LE E I
Sbjct: 239  -LQNESHHYWKNAFENLQKENSNFNATVQDLELENI 273

>NCAS0C01160 Chr3 (214545..217124) [2580 bp, 859 aa] {ON} Anc_8.704
            YPL174C
          Length = 859

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 36/160 (22%), Positives = 71/160 (44%), Gaps = 17/160 (10%)
 Frame = +1

Query: 1315 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLE---------NLTTLLDEKIAKIE 1467
            +EDL ++ +++             +  E ++   NL          N   +    + KI+
Sbjct: 149  EEDLTSQNMELEGLKTQLEGEKNKLLQEVSLLKENLSCREATDAEINQKIIAGTNVDKID 208

Query: 1468 AINENNMRIQKDIEVLQVKKLN-------LENEIKDHEEKDKLNKDVLQKLNVE-KDYLP 1623
             + EN  R+QK I+ L+    +       L +E  D  E + + +D +Q LN + ++   
Sbjct: 209  LLRENT-RLQKAIDDLERSLTDTIHDYEVLMSEYSDLIETNAVLEDSIQVLNTDLENSAI 267

Query: 1624 RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
             +  +  ++ A  D   I++  T +ENN+LS+   KLE +
Sbjct: 268  DIRNLQREVDAIKDDKKIVERVT-TENNELSLKLAKLESK 306

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
            YLR309C (REAL)
          Length = 916

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 49/253 (19%), Positives = 100/253 (39%), Gaps = 16/253 (6%)
 Frame = +1

Query: 1036 KLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQ 1215
            KL  + L++ NA   E Y TK  E  +KL  L K+++                  +++ +
Sbjct: 433  KLELDDLRHKNATMIEAYETKNSELRNKLDSLNKEVE----CLKTSSTEKEKEQALLQNK 488

Query: 1216 LVKNVLDVQSKYNVDKGKVIKETELMKL----------------QKINAKEDLLAKQLDV 1347
            LVK   D+ S+  ++K  + KE   +K+                ++ N ++D   K  + 
Sbjct: 489  LVKLNEDI-SQLALEKSIITKELTSLKISYKQKEKTVGYLEEQVKQFNEQKDAAEKSTE- 546

Query: 1348 XXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKK 1527
                         I+N  ++     E L   + +     E   + N ++ + + +LQ K 
Sbjct: 547  -----QLKKENSKISNRLDLLKKENETLHNDIKKNGNSYETYLKENGKLSERLNILQEKY 601

Query: 1528 LNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENN 1707
              L+N   +  E     K   ++LNV      +L E +++I +  D+L    N    +  
Sbjct: 602  NTLQNVKSNSNEHMDSIKRQCEELNV------KLKESNKKILSLEDELNEYANIVQDKTR 655

Query: 1708 QLSILTKKLEEER 1746
            + + L + + + +
Sbjct: 656  EANTLRRLVSDSQ 668

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
            Anc_4.46 YLR309C
          Length = 960

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 12/132 (9%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKI----------EAINENNMRIQKDIEVLQVKKLNL 1536
            I  ++ I+N  ++ LT   +E   ++          +  N     +Q++I+  + ++ N+
Sbjct: 125  INTKHTIYNDEIKRLTKENNESRERLSDRTEIEELEKKFNSERENLQREIDEAKEQRQNV 184

Query: 1537 ENEIKDHEEKDKLNKDVLQKLNVEKD--YLPRLNEIDEQIAAKFDKLAIIKNETISENNQ 1710
            E + KD    D++++  L+ L  EK+  YL  +  ++       DKLA  + E   + N+
Sbjct: 185  ERQ-KDTSSADEVDR--LKTLLEEKETMYLSEIKILE-------DKLAAAQKEKDDKQNK 234

Query: 1711 LSILTKKLEEER 1746
            L  + K+ +EE+
Sbjct: 235  LEKVEKQYDEEQ 246

>TPHA0I01350 Chr9 complement(306732..307271) [540 bp, 179 aa] {ON}
           Anc_2.134 YNL133C
          Length = 179

 Score = 33.1 bits (74), Expect = 1.3
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 4/91 (4%)
 Frame = +1

Query: 70  LTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSL 249
           L  H +RKS  T+     RN     +  Y   +KEK          FN+M   E+ Y + 
Sbjct: 48  LKSHKNRKSLRTQ----LRNNAIKRQKKYNNLVKEKDI--------FNRMSTSEIEYYNK 95

Query: 250 AKNDKRAK----DIQFPKYLLDNEKRQAQLL 330
            KNDK +K    D Q  K  L  E+++ +LL
Sbjct: 96  LKNDKASKEKELDEQVSKEALGYERKKLRLL 126

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 56/259 (21%), Positives = 98/259 (37%), Gaps = 30/259 (11%)
 Frame = +1

Query: 1066 NAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLD--- 1236
            N   D++YN K +  ++K+ E  K  ++                E ++ ++ K + D   
Sbjct: 755  NTLLDQQYNPKLKSLKEKVDEFDKSWNELKSNK-----------EKLQNEIFKELTDKVG 803

Query: 1237 -VQSKYNVDKGKVIKET--ELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNI 1407
                +Y    G+++++   EL +LQK                           I N+   
Sbjct: 804  FTIEEYERHSGELLRKQSKELQQLQK-----------------------EILNIENKLQF 840

Query: 1408 WNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKD-HEEKDKLNK- 1581
                LEN    L    + +E  +E    +QKD   L  +   +E+EI     E D +NK 
Sbjct: 841  EIERLENTQKRLTSAESNLEKAHETLKSLQKDENELAEQVKQIESEINSARNELDSVNKV 900

Query: 1582 ------------DVLQKLNVEKDYLPR-LNEIDEQIAAK-FDKLAIIKN--------ETI 1695
                        + L +LN     L R  +EI E IA    +++ I+KN          I
Sbjct: 901  FTAQQLDINRMEESLGELNDNSQTLKRNRDEIKEDIAKNDLERIGILKNAKVTNIDIPVI 960

Query: 1696 SENNQLSILTKKLEEERIA 1752
            SE N   +   +++E+ I+
Sbjct: 961  SETNLSDLPIDRIDEDTIS 979

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 36/191 (18%), Positives = 81/191 (42%), Gaps = 9/191 (4%)
 Frame = +1

Query: 1198 EIMEYQLVKNVLD---VQSKYNVDKGKVIKETELMKLQKINAKEDLLA------KQLDVX 1350
            +I+   L KN+LD   +Q + ++ + ++ K T++   +K  AK+          + ++  
Sbjct: 742  KILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDS 801

Query: 1351 XXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKL 1530
                        + N++      L+ +   LD K      +     +++ D++    K  
Sbjct: 802  DISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLA 861

Query: 1531 NLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQ 1710
            ++   ++  ++   L   V Q    EK+    LNE+  ++  K +KL + +NE   + N 
Sbjct: 862  SVYTTLE--QKNSFLANSVSQLQGKEKE----LNELKSKLVEKTEKLQMAENENSEKINN 915

Query: 1711 LSILTKKLEEE 1743
              +L + + EE
Sbjct: 916  AIVLLQTMVEE 926

>KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa]
            {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1848

 Score = 34.3 bits (77), Expect = 1.4
 Identities = 54/260 (20%), Positives = 111/260 (42%), Gaps = 28/260 (10%)
 Frame = +1

Query: 979  TNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAA--EDEKYNTKKQEYEDKLVELQKQLDDX 1152
            T   +  +K + ++  + +    E   NF+ +  E EKY+   Q  E+ L  LQKQ    
Sbjct: 1599 TQSLSAENKQLQEERTFLRSKLDEANGNFSQSLKEKEKYSHDVQFLEESLA-LQKQ---- 1653

Query: 1153 XXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLA 1332
                              + +  + ++D Q +  +D  K    +E  K   +  +   LA
Sbjct: 1654 ------------------QAERNEELID-QLQTELDTIKTTFSSEKDKNANLFQENASLA 1694

Query: 1333 KQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLL-DEKIAKIEAINENNMRIQKDIE 1509
            K  ++            A T+E + W   ++ LTT L +E+ +K E I ++  ++++ IE
Sbjct: 1695 KANEILRNDLLDAKNKLADTSENDAWFNKVQTLTTTLEEERTSKFEEIKKSK-KLERIIE 1753

Query: 1510 VLQVKK------LNLENEIKDHEEKDKLNKD----VLQKLNVEKD------------YLP 1623
             L+ K       + + N+ K   E+   N D     ++ +N  KD            Y  
Sbjct: 1754 ELERKNEEQANVIEIANDAKSQYEETIGNLDEKLGEIEAINATKDATLNKMHRDNTYYQE 1813

Query: 1624 RLNEIDEQIAA---KFDKLA 1674
            +++E++++I++   +++KL+
Sbjct: 1814 QISELEKEISSWKQRYEKLS 1833

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
            Anc_5.528 YDR423C
          Length = 506

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L EK+ K+E INE N   + +   L+ + L+L NE+K              K  ++K+  
Sbjct: 44   LQEKVRKLENINEKN---EIETVFLRTQLLSLVNELK--------------KYRIDKNDD 86

Query: 1621 PRLNEIDEQIAAKFDKLAIIK-NETISENNQLSILTKKLEEERI 1749
             RL +I  Q+  K +KL + K  ++ S +++LS L + L   +I
Sbjct: 87   FRLKKIGSQL--KHEKLNLNKLTKSSSSSSRLSSLMEDLNSNKI 128

>KAFR0E01370 Chr5 (272717..274522) [1806 bp, 601 aa] {ON} Anc_5.311
            YDR295C
          Length = 601

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP 1623
            +E   K+E I     ++++ +  L+ KK NLE  +   E+K    + + ++L   +  L 
Sbjct: 427  NEAEKKLERITTEQTKLEEKLTKLREKKANLEELLSSPEDKSTAFELLQKEL---QGQLS 483

Query: 1624 RLNEIDEQIAAKFD---KLAIIKNETISENNQLSILTKKLEEE 1743
            RL+EI+EQ + + +    L  +K+ + +  +     TKKL EE
Sbjct: 484  RLHEINEQRSKECEGLRNLYQMKSTSAATKSAELDATKKLLEE 526

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
            some similarities with uniprot|P31376 Saccharomyces
            cerevisiae YAL011W SWC3 Protein of unknown function
            component of the Swr1p complex that incorporates Htz1p
            into chromatin required for formation of nuclear-
            associated array of smooth endoplasmic reticulum known as
            karmellae
          Length = 657

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 964  EYLVRTN-EYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKK-QEYEDK 1119
            EYL   N  YN+   A+++Q+  E+     W+   N  + EKY  KK +E E K
Sbjct: 478  EYLENPNIRYNLPKDAIFEQLEDEESYLMSWIVIHNKKDIEKYENKKLKELEGK 531

>TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26
            YNL218W
          Length = 662

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1444 DEKIAKIEAINENNMRIQKDIEVLQV----KKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
            DEK   IE  N++N +   D ++ +     +K   E+E+K  EE ++ NKD+++   V+ 
Sbjct: 372  DEKF--IENFNKDNNKEVTDSKIKEETKSEEKAKSEDEVKSDEETNEENKDIIKVEEVDH 429

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNET 1692
            + +      D +I  +  K  I +N T
Sbjct: 430  EKIAPKMFTDNEITIEMIKNIIKRNNT 456

>Skud_15.440 Chr15 complement(777845..779860) [2016 bp, 671 aa] {ON}
            YOR275C (REAL)
          Length = 671

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 19/130 (14%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINEN----NMRIQKDI---------EVLQVKKLNLENEIKDHE- 1560
            + L T+ + ++ + EA+ +N    N  IQ ++         E L  K+L L++       
Sbjct: 392  QELITISEAELVQYEALLDNLHVNNKNIQSELGKAEQVLKEEALSDKQLRLKHGTLHWTL 451

Query: 1561 -EKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF---DKLAIIKNETISE-NNQLSILT 1725
             E   +N    +KL   K+YL + + ID+Q    F   DK  I     + E N+ L+ + 
Sbjct: 452  PESSTVNATYYEKLKKLKEYLDQGSAIDKQTDELFQSIDKKLITSEIKLPEPNDSLTNMI 511

Query: 1726 KKLEEERIAH 1755
            KK+ +ER A+
Sbjct: 512  KKVIQERNAY 521

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
            YOR195W
          Length = 781

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 25/110 (22%), Positives = 53/110 (48%), Gaps = 11/110 (10%)
 Frame = +1

Query: 1456 AKIEAINENNMRIQKDIEVLQVKKLNLENEIK-------DHEEKDKLNKDV----LQKLN 1602
            A+I+ + E+ + +++    L+     LE+ ++       + EEKDK++ ++    L+  N
Sbjct: 556  AEIKELQEDKLELERTNACLESSIAELEDSVRNWQAKYHEQEEKDKISLELESIQLKNNN 615

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
            +E ++L  L ++   +++  D L     E       L  L +KL E+  A
Sbjct: 616  IEAEHLAELEQLHSNLSSLQDAL----KENSDVITDLKNLNEKLREDNKA 661

>ZYRO0E03542g Chr5 complement(275553..275912) [360 bp, 119 aa] {ON} no
            similarity
          Length = 119

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +1

Query: 928  PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 1107
            P+  AVA+   P Y   T++YN V    Y  M +  KL S   +       E+++ + +E
Sbjct: 22   PQYCAVAATIQPRYTCDTHDYNTVQ---YGTMPFFSKLRSNKPEEKKYISVEEFHKRNKE 78

Query: 1108 YED 1116
            YE+
Sbjct: 79   YEE 81

>TPHA0N01410 Chr14 complement(310293..312917) [2625 bp, 874 aa] {ON}
            Anc_2.590 YKL050C
          Length = 874

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 29/106 (27%), Positives = 55/106 (51%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            LL+EK      INE+  ++ + IE  + K ++L+ ++K+ EE+       + +L+ +K  
Sbjct: 576  LLNEK----NIINESIQKLHESIESHKSKIIDLDADLKEKEERQIEEDKRILELSTDKQN 631

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 1755
            L  L  IDE +    +K   +K ET     Q ++  ++LE + I +
Sbjct: 632  L--LQHIDETLIVTANK---VKEETKLSTEQTTL--RQLEIDAIVN 670

>KAFR0L02090 Chr12 complement(396831..399515) [2685 bp, 894 aa] {ON}
            Anc_8.872 YML093W
          Length = 894

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 48/258 (18%), Positives = 111/258 (43%), Gaps = 11/258 (4%)
 Frame = +1

Query: 958  NPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKY-----NTKKQEYEDKL 1122
            NP   +  +E ++    +  ++  +   HS+ L N+   E+ ++     +T     +  L
Sbjct: 186  NPFDEISEDEEDVELNTITSKLLKDTSNHSKKLDNYGTGEENEFMLPSASTTGGAQKLSL 245

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVL---DVQSKYNVDKGKVIKETELM 1293
             ++   +DD                  +   L + +    D ++ Y + K +V K  +++
Sbjct: 246  SDMMNAIDDKEIIAKASLIDDKKASSTVNIPLPQRIQQRHDRKAAYEISKDEVNKWNDIV 305

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
            K    N + + L+  L+             A  NE + +  N+E   T L+EKI K+  +
Sbjct: 306  KQ---NRRAEHLSFPLNAA-----------ADRNESSAFTRNIEEPRTELEEKIGKV--L 349

Query: 1474 NENNM-RIQKD--IEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDE 1644
             E+N+  +QK+   E L   K+  E E++    + +L ++++ +   E+    R+ +I  
Sbjct: 350  KESNLVDLQKESTFEELATAKMTPE-EMRKRTAEMRLMRELMFR---EERKAKRIKKIKS 405

Query: 1645 QIAAKFDKLAIIKNETIS 1698
            +   +  K  +++N+ ++
Sbjct: 406  KAYHRIKKKEMLRNKELA 423

>TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {ON}
            Anc_8.560 YPL084W
          Length = 901

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 29/111 (26%), Positives = 59/111 (53%), Gaps = 5/111 (4%)
 Frame = +1

Query: 1423 ENLTTLL----DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            ENL+  L    D+K  +I     N  ++ +D+++L+ ++  +  E+KD   KD + + ++
Sbjct: 547  ENLSPSLIDMDDDKQNQILNDLSNVKQMAEDLKLLKDERERIILELKDEVAKDDITRTLI 606

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAI-IKNETISENNQLSILTKKLEE 1740
              +N+EK+    LNE+ E    KF  L   I+     +N+ ++ +  KL++
Sbjct: 607  --VNLEKNE-SELNELFENELEKFTPLTTRIETTIFKQNSNINDIKLKLDQ 654

>TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {ON}
            Anc_2.16 YNL225C
          Length = 936

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 53/228 (23%), Positives = 96/228 (42%), Gaps = 15/228 (6%)
 Frame = +1

Query: 976  RTNEYNIVSKAVYD--QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY---EDKLVELQKQ 1140
            +  E  +  +A YD  +  YE K+         +   E++N K +E    E  + +L K+
Sbjct: 302  KIEEKEVKLRASYDADKSQYEHKI---------SMLQEEFNNKLREINALEKTIKDLSKE 352

Query: 1141 LDDXXXXXXXXXXXXXXXX---------EIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            LDD                         + ME Q  +   D+QS  +       + T +M
Sbjct: 353  LDDQFQALEKAKRTNDELESQCNVTKKLQDMEEQNQQLKRDLQSSKSSRNELQTENTGIM 412

Query: 1294 -KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEA 1470
             KLQ  N     L K L++             + N+Y +    +E  + L +++ +++ A
Sbjct: 413  TKLQVANDHIRELEKSLELAKSSQT------TLRNDYELTMKQVEEASKLNEQRKSELGA 466

Query: 1471 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKD 1614
            + E+N R + +   L+ +KLN     +  +  D+L KDVL K+ +EK+
Sbjct: 467  LKESNERTRVENNDLK-EKLN-----EASKTNDELKKDVL-KVQMEKE 507

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
            Component of the condensin complex essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 35/177 (19%), Positives = 79/177 (44%), Gaps = 1/177 (0%)
 Frame = +1

Query: 1222 KNVLDVQSKYNVDKGKVIKETEL-MKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNE 1398
            K V+D+++K     G++ + +E+ +K + +  + +L   +L +             +   
Sbjct: 688  KKVIDLENKLADVIGRIKQYSEISVKTKSVQNELNLATHKLHLANRSLENNPSAQLLARN 747

Query: 1399 YNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLN 1578
              I    +EN T  +      +  +     RI+KDIE     K +  +E+K+  E   ++
Sbjct: 748  KEIQE-EIENCTESMKNGREDVRRLEGEVSRIEKDIEEFSKDKGSKLDELKN--EVTSIS 804

Query: 1579 KDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
            K + QK    K  L +  ++++ +  K D+L    +       +   ++K+L+E+R+
Sbjct: 805  KQIEQK----KIVLEKKEDVNQTLQLKMDQLKSDISSARDGIKESLEVSKELDEKRV 857

>NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {ON}
            Anc_8.442 YDR227W
          Length = 1657

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 23/90 (25%), Positives = 46/90 (51%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            L +L++ L  K A+IEAI  +N + +++++  + K   +  +I     K++LNK    K+
Sbjct: 1450 LTSLSSSLHSKEAEIEAIKSSNEKYKEELKKREKKLKQMAGKIHKSSSKNRLNK----KM 1505

Query: 1600 NVEKDYLPRLNEIDEQIAAKFDKLAIIKNE 1689
            +    YL +     E +  K +K  + K +
Sbjct: 1506 SKSVKYLLKELAKKESLIEKLEKKHLKKKK 1535

>TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1915

 Score = 33.9 bits (76), Expect = 1.8
 Identities = 41/183 (22%), Positives = 82/183 (44%), Gaps = 5/183 (2%)
 Frame = +1

Query: 1216 LVKNVLDVQSKYNVDKGKVIKETELMKL-QKINAKEDLLAKQLDVXXXXXXXXXXXXAIT 1392
            +VKN    ++  N+++   I E++ + L +K+  KE  L     +             + 
Sbjct: 859  IVKNRKIQENVKNMEEAIKITESQCVDLTRKLCDKESELTNVQALLQEESKKLKEHEMLA 918

Query: 1393 NEYNIWNGNLENLTTLLDEKIAKIEAIN---ENNMRIQKDIEVLQVKKL-NLENEIKDHE 1560
             E  +  G       +L EK+ ++  IN   E+N  I        ++K+ +LE  I + E
Sbjct: 919  EEAKVQEG-------ILTEKLDELRTINKEIESNQAILASENKDYIEKIESLEKSINEQE 971

Query: 1561 EKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
            ++    K + +K   E+ Y+  ++E++  + AK + L  +        ++LS LTK   E
Sbjct: 972  QE---TKTLYEKR--EQKYIIEISELEADLKAKKETLHSLTLNNNELTDKLSKLTKVESE 1026

Query: 1741 ERI 1749
            +R+
Sbjct: 1027 QRL 1029

>YOL069W Chr15 (198942..200297) [1356 bp, 451 aa] {ON}  NUF2Component
            of the evolutionarily conserved kinetochore-associated
            Ndc80 complex (Ndc80p-Nuf2p-Spc24p-Spc25p); involved in
            chromosome segregation, spindle checkpoint activity and
            kinetochore clustering
          Length = 451

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 47/246 (19%), Positives = 98/246 (39%), Gaps = 25/246 (10%)
 Frame = +1

Query: 1081 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVK------NVLDVQ 1242
            E+ N + +    KL ++Q+ L                  E + +Q+V+       ++ + 
Sbjct: 189  EEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESNRDKLIKIS 248

Query: 1243 SKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNL 1422
            +    +  + IKE   + +Q+    +DL A+Q ++             + +   I +  +
Sbjct: 249  NTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFETIISELYDVLRIISSEV 308

Query: 1423 ENLTTLLDEKIA--------KIEAINENNMRIQKDIEVLQ----VKKLNLENEIKDHEEK 1566
            +       E +         K++ +N     I   +E+LQ    ++  NLE   +D +E+
Sbjct: 309  QESNRTETELVGLKQNLINNKLKLMNVLETGIMYKLEILQEQLDLQLKNLEKLSQDTKEE 368

Query: 1567 DKLNKDVLQKLNV--EKDYLPRLNEID-----EQIAAKFDKLAIIKNETISENNQLSILT 1725
             +LN   L  L +  E +  P++++ D     E I+ K +KL          N+++  L 
Sbjct: 369  SRLNDTKLMDLQIKYENEIKPKIDKTDIFIQEELISGKINKL----------NDEIKQLQ 418

Query: 1726 KKLEEE 1743
            K  E E
Sbjct: 419  KDFEVE 424

>NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.167
            YDL025C
          Length = 647

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 2/114 (1%)
 Frame = +1

Query: 1393 NEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDK 1572
            N  N+ N N  ++TT    + + +  I+ +N+     +E+LQ K   LENE     +  +
Sbjct: 174  NPINLQNANSNSMTTPASSRASPVSVISSSNISHLHPVEILQTK---LENEQNQLNKSQR 230

Query: 1573 LNKDVL--QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
             ++++L   + N   +  P+  +   ++   F      + ET S ++  S  TK
Sbjct: 231  NHENILNHNQYNNSSNNTPKKKKKSLKLKRFFKN---FQTETKSSHSSSSTSTK 281

>ZYRO0E07986g Chr5 (623313..625451) [2139 bp, 712 aa] {ON} highly
            similar to uniprot|P15108 Saccharomyces cerevisiae
            YMR186W HSC82 Cytoplasmic chaperone of the Hsp90 family
          Length = 712

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 24/83 (28%), Positives = 43/83 (51%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            L+EK  K E +  ++  +   I+++  K++  E ++   EE+ K  K   +K   E D  
Sbjct: 185  LEEKRIK-EVVKRHSEFVSYPIQLMVTKEV--EKDVPLTEEEKKEEKKDEEKKEGEDDKK 241

Query: 1621 PRLNEIDEQIAAKFDKLAIIKNE 1689
            P+L E+DE+   K ++   IK E
Sbjct: 242  PKLEEVDEEEEKKQEETKKIKEE 264

>KLLA0D12958g Chr4 complement(1107587..1109728) [2142 bp, 713 aa] {ON}
            highly similar to uniprot|P15108 Saccharomyces cerevisiae
            YMR186W HSC82 Cytoplasmic chaperone of the Hsp90 family
          Length = 713

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
 Frame = +1

Query: 1423 ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN 1602
            E+    L+EK  K + + +++  +   I++L  K++  E ++   EE++++ ++  +   
Sbjct: 180  EDQLEYLEEKRIK-DVVKKHSEFVAYPIQLLVTKEV--EKDVPVAEEEEEVKEEKKEGEE 236

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIK-NETISENNQLS 1716
             E D  P+L EIDE    K D+    K  ET+ E  +L+
Sbjct: 237  EEDDKKPKLEEIDEDEEKKDDEQKTKKVKETVKELEELN 275

>TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {ON}
            Anc_5.414 YDR356W
          Length = 761

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVL---QVKKLNLENEI----KDHEEKDKLNKDVLQK 1596
            ++DEK  KI  ++E+N+++ ++I  L   Q K+ N  N +    KD E + K   D  QK
Sbjct: 332  IIDEKNDKITRLSESNLKLNQEIVHLKNDQDKQRNASNVLKAIEKDLEGQKKELADTRQK 391

Query: 1597 LNVEKDYLPRL-NEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
            L    +    L N+I E      +K +    E  +E  +L    K L+E
Sbjct: 392  LKEANELSKSLENQIIENTTKASEKNSTRVREKEAEIQKLKDQLKTLKE 440

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 21/95 (22%), Positives = 48/95 (50%), Gaps = 1/95 (1%)
 Frame = +1

Query: 1459 KIEAINENNMRIQKDIEVLQVKKLNLENEIKD-HEEKDKLNKDVLQKLNVEKDYLPRLNE 1635
            +I+   EN   +++ +++L+ +   L N I     E + LN D+ +  +  +DYL    +
Sbjct: 451  QIKEYAENQEPVKQAMDLLKRENKQLSNRIDLLKNENESLNNDLKKNSSTYEDYLKENGK 510

Query: 1636 IDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
            + E+I    +K   ++N   + ++ +  + K+ EE
Sbjct: 511  LTERIDILQEKYDTLQNLKNNSSDHMDSIKKQCEE 545

 Score = 32.0 bits (71), Expect = 6.5
 Identities = 44/189 (23%), Positives = 86/189 (45%), Gaps = 9/189 (4%)
 Frame = +1

Query: 1207 EYQLVKNVLD-VQSKYNVDKGKVI-KETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXX 1380
            E +  KN  D + S+ N  K K+I KE  ++ L+K    ++    Q  V           
Sbjct: 416  EVKTSKNETDKLSSQLNQVKNKLIQKEKTVIYLEK--QIKEYAENQEPVKQAMDLLKREN 473

Query: 1381 XAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVK---KLNLENEIK 1551
              ++N  ++     E+L   L +  +  E   + N ++ + I++LQ K     NL+N   
Sbjct: 474  KQLSNRIDLLKNENESLNNDLKKNSSTYEDYLKENGKLTERIDILQEKYDTLQNLKNNSS 533

Query: 1552 DHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKL----AIIKNETISENNQLSI 1719
            DH   D + K   ++LNV      +L E +++I +  D+L    +II+++    +    +
Sbjct: 534  DH--MDSIKKQ-CEELNV------KLREANKKIISLEDELSDYTSIIQDKAREADTMRRL 584

Query: 1720 LTKKLEEER 1746
            L++   +E+
Sbjct: 585  LSESNNDEK 593

>TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.296
            YDR285W
          Length = 855

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 47/223 (21%), Positives = 90/223 (40%), Gaps = 6/223 (2%)
 Frame = +1

Query: 1096 KKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYN-VDKGKV 1272
            K QEYE KL + + ++                   + + Q + ++   +++Y  + K   
Sbjct: 506  KCQEYESKLHDFESEISTL---------------NLQKGQALSSLGVKEAQYEELSKKAG 550

Query: 1273 IKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIW-NGNLENLTTLLDE 1449
            +++ E+ K ++I  +   L  ++D                NE NI    N EN   +  E
Sbjct: 551  LQDAEMRKYKEIELE---LRAKVDTSIQEINALKNKWIKLNEDNITLKANSENKIIVQGE 607

Query: 1450 KIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE----KDY 1617
             +  +++ NE    +++  E L   +   E+    H +K +   + LQKLNVE    K +
Sbjct: 608  ILKTLQSENET---LKQKCEQLDGMRQQFESRNSSHNDKVQRINEQLQKLNVEMVQLKAH 664

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
               L E + ++ ++ D       E   E  +L      LE E+
Sbjct: 665  ELELEEENRKLKSQIDDSRSNYEEATDEFKRLRQKVIVLEAEK 707

>TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5.296
            YDR285W
          Length = 950

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 53/230 (23%), Positives = 86/230 (37%)
 Frame = +1

Query: 1057 KNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLD 1236
            KNF  +   K+N  +  Y   L E  K L +                   ++   K  ++
Sbjct: 519  KNFEESLKSKFNEIENNYTSILSEKTKILAEDLNSIAN------------DFNSYKEKMN 566

Query: 1237 VQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNG 1416
             + +Y+     + KE   +  QK+N    L  K+ +              IT++ N    
Sbjct: 567  QKEEYSEIIKNLEKEIHELATQKMNCLTSLGTKEAEFEE-----------ITSQLNELKN 615

Query: 1417 NLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQK 1596
               NL TL  +       +NE            Q+  LNL  E K+ E    +NK   + 
Sbjct: 616  KETNLLTLEKQ-------LNE------------QIADLNLNVEQKNFE----INKLTNEN 652

Query: 1597 LNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
            L++  ++       D +I+A+      I    I+EN+ L   T KLEEER
Sbjct: 653  LSISSNF-------DNKISAQES----IMKALITENDLLKQTTSKLEEER 691

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 33/130 (25%), Positives = 63/130 (48%), Gaps = 18/130 (13%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINEN--------NMRIQK-DIEVLQVKKLNLENE------ 1545
            N  L+  T+ L+E+ +K E   EN        N +I K +++++Q+K  +LE E      
Sbjct: 677  NDLLKQTTSKLEEERSKEENEKENTKAMVQKLNEQINKINVDLIQLKASSLEQEEENKNL 736

Query: 1546 ---IKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
               IK+ ++  K+  D  + L V+      L   + ++  +  +L  IKN  + E + L 
Sbjct: 737  HKIIKEKDDIIKMQTDNSKSLEVKVKENQSLEIENIRLQERNKELNDIKNSIMDEVSNLK 796

Query: 1717 ILTKKLEEER 1746
             + +K EE++
Sbjct: 797  DIIQKKEEDQ 806

>TPHA0A01140 Chr1 complement(220669..223593) [2925 bp, 974 aa] {ON}
            Anc_8.605 YPL115C
          Length = 974

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 8/87 (9%)
 Frame = +1

Query: 1480 NNMRIQKDIEVLQVKKLNLE-NEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAA 1656
            N+ R+QKD  +  ++   +E ++   ++   + NK++ +KL  +K+ + RLN+  E +  
Sbjct: 18   NDHRLQKDKVIEYIEDNVIEPDQTPSYDALVEENKELKKKLKDQKNDIDRLNQYIEDLED 77

Query: 1657 KFDK---LAIIKNET----ISENNQLS 1716
            K  K   + +I N+T    ++ +NQLS
Sbjct: 78   KLQKNNAVTLIHNDTDTVLLNTSNQLS 104

>SAKL0B06380g Chr2 complement(545026..548034) [3009 bp, 1002 aa] {ON}
            similar to uniprot|P38249 Saccharomyces cerevisiae
            YBR079C RPG1 Subunit of the core complex of translation
            initiation factor 3(eIF3) essential for translation part
            of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates
            binding of mRNA and tRNA(i)Met to ribosomes
          Length = 1002

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 35/187 (18%), Positives = 77/187 (41%), Gaps = 5/187 (2%)
 Frame = +1

Query: 1114 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 1293
            ++L + +K LD+                  +E  L++   D+Q + +++    +K+  + 
Sbjct: 689  EQLSKDKKDLDERMRVAFKRLDHTERAFRKVELPLLEKDADLQEERDLENYNDLKQRLVG 748

Query: 1294 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 1473
              +K + +E  L ++L                T E  +     +NL      K A+I+ I
Sbjct: 749  AGKKEHEEELKLHERLIKISSDYKAFKAKILATKEAKLTEARTKNLAKFEAAKKARIDEI 808

Query: 1474 NENNM-----RIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEI 1638
             +        R Q++++  Q      E E ++ EEK +   +   +L  E+D   R+N+ 
Sbjct: 809  RQQRYEELVARRQEELKQQQ----EFEREAREEEEKSRAESEKAARLAKERDERARVNKE 864

Query: 1639 DEQIAAK 1659
             +++A +
Sbjct: 865  KDELARR 871

>TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {ON}
            Anc_2.257 YIL112W
          Length = 1078

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 2/99 (2%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            +D+KI +     E+ +R++K+ + L+ +KL      ++  EK++L K+ L+K  +EK+ L
Sbjct: 34   IDQKIKE----EEDQVRMEKEQQRLEREKLE-----RERLEKERLEKEKLEKERLEKEDL 84

Query: 1621 PRLNEIDEQIAAKFDKL--AIIKNETISENNQLSILTKK 1731
               NE  E+ + ++DK    I   E  S+    + +TK+
Sbjct: 85   K--NEPLEKESREYDKQEHKIYTQEATSDEKLNANITKE 121

>NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1305

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 9/110 (8%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKD---KLNKDVLQKLNVEK 1611
            L+ +I K+ +  +NN   ++D+E+ + K  +   +++D E+ D   +LN  + QK +   
Sbjct: 446  LNTEIEKLTSEFKNNEYTKEDLEMERKKLEDYHEKVRDWEKTDVITELNSKLKQKNDQMI 505

Query: 1612 DYLPRLNEIDEQI------AAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
                 L +I E+I      A  F KL I+K     +   L+ L +K  ++
Sbjct: 506  ISENELEQIQEKIMKTNQQADLFAKLGIMKKSLYEKTEALNELIEKFNDD 555

>Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250W
            (REAL)
          Length = 1312

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 17/111 (15%)
 Frame = +1

Query: 1456 AKIEAINENNMRIQKDIEVLQ------VKKLN-LENEIKDHEEKDK----------LNKD 1584
            +K++ +  N+ +++ + E  +      ++K N LE EIKD E   K            +D
Sbjct: 769  SKLDELETNSKKLKNEKEFAESEIRPLIEKFNYLEREIKDLENSSKTISEELSIYHTGED 828

Query: 1585 VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
             +Q ++  +D    +N+   ++      L + K+E + EN ++  L K+ E
Sbjct: 829  AIQTVDELRDQQKHMNDSLRELRKSIADLQMDKDEKVRENARMISLIKEKE 879

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 23/103 (22%), Positives = 56/103 (54%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY 1617
            L+D+K  +IEA+N+  +  +   +++  +K +LE+E       + L+K+  Q +   K  
Sbjct: 329  LIDKKFIEIEALNDICIERENRFDIIDREKESLESE--KESALEYLSKEKEQVIVKSKLI 386

Query: 1618 LPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
              ++ + + +++   +K+  +++E   E N+ + L  K++E R
Sbjct: 387  QYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELR 429

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 74/322 (22%), Positives = 128/322 (39%), Gaps = 26/322 (8%)
 Frame = +1

Query: 856  ISGA-KGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYE 1032
            ISG   G    A  GA  M L  +  +  +  S E  E +    E +I  K   +  N  
Sbjct: 807  ISGTMSGGGNQASKGA--MQLSNSTSKEKSTYSSE--EVMEIEKELSIREKNYQNAYNTV 862

Query: 1033 QKLHSEWLKNFNAAEDE------KYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXX 1194
            Q++  E L+N   +E +      K N +    E++    +KQL++               
Sbjct: 863  QEMEIE-LRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADI 921

Query: 1195 XEIMEYQLVKN----VLDVQSKYNVDKGKVIKETEL----MKLQKINAKEDLLAKQLDVX 1350
             E+       N    +++ Q K   D+ K +++  +    +KLQ  N+K D L +Q  + 
Sbjct: 922  TEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKIL 981

Query: 1351 XXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKL 1530
                                   +E+    L +K+ + E+ N            L  KK+
Sbjct: 982  IKKQKSEKAGIM----------KIESDVRKLSKKLKESESDNTK----------LNEKKI 1021

Query: 1531 NLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEID-------EQIAAKFDKLAI---I 1680
             LENE+K+ EE    N++ +  +  +K  L   +EI        E + ++F  L +   I
Sbjct: 1022 ALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKI 1081

Query: 1681 KNETI-SENNQLSILTKKLEEE 1743
            K+E + S  NQ+  + K LEE+
Sbjct: 1082 KSEKLASLLNQIKKILKALEED 1103

>YMR219W Chr13 (707133..712109) [4977 bp, 1658 aa] {ON}  ESC1Protein
            localized to the nuclear periphery, involved in telomeric
            silencing; interacts with PAD4-domain of Sir4p
          Length = 1658

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 23/94 (24%), Positives = 43/94 (45%)
 Frame = +1

Query: 868  KGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHS 1047
            +GSN+    G    TLG+  PE   V      E L   N  + V+  V ++  +   ++ 
Sbjct: 954  EGSNENIVKGTKKDTLGIVEPENEKVNKVHEEETLFEANVSSSVN--VQNKDMHTDVINQ 1011

Query: 1048 EWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDD 1149
            E   N+ A E  KY  +  + E+  + + +++D+
Sbjct: 1012 EAQANYEAGE-RKYYIQNTDTEEAHISIIERIDE 1044

>Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR023W
            (MYO1) - Class II Myosin [contig 11] FULL
          Length = 1907

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 21/83 (25%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query: 1468 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE-KDYLPRLNEIDE 1644
            A+NE+ +R++KD+EV + +   L    ++H+ + +   D LQ    + KD +  L + +E
Sbjct: 1432 AMNESMVRLKKDLEVAERQNELLSTSARNHKVQYESCVDDLQATEEQLKDMIHTLRQSEE 1491

Query: 1645 QIAAKFDKLAIIKNETISENNQL 1713
             I      +  +K++   ++ QL
Sbjct: 1492 DIKTMTSIIERLKSQNRQKDRQL 1514

>KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_8.331
            YDR150W
          Length = 2560

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 36/158 (22%), Positives = 63/158 (39%), Gaps = 44/158 (27%)
 Frame = +1

Query: 1399 YNIWNGNLENLTTLLDEKIAKIEAINENNMR-------IQKDIEVLQVKKLNLENEIKDH 1557
            + I N N EN+  L   K+ K+ ++  N  +       +Q ++   +++K  +E+E K +
Sbjct: 133  WEIENTNKENIQELKSLKL-KLSSVESNQSKQLSLLQEVQNELRTAKLEKTKMEDEFKAY 191

Query: 1558 -------------------EEKDKLNKDV-------LQKLN-----------VEKDYLPR 1626
                               +E D LN  +       LQ L            +EKDY   
Sbjct: 192  KLEKNDELNDLQNHVFELNDENDSLNSKLKLSEIPTLQSLKDKAATFDSVIILEKDYKEL 251

Query: 1627 LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEE 1740
            L+++ E       + + I N  I  NN+ S L  K+E+
Sbjct: 252  LDKLTEPNVEYLTEKSSILNMKIIHNNEYSELLDKIEK 289

>YOL081W Chr15 (171070..180309) [9240 bp, 3079 aa] {ON}
            IRA2GTPase-activating protein that negatively regulates
            RAS by converting it from the GTP- to the GDP-bound
            inactive form, required for reducing cAMP levels under
            nutrient limiting conditions, has similarity to Ira1p and
            human neurofibromin
          Length = 3079

 Score = 33.5 bits (75), Expect = 2.4
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 9/105 (8%)
 Frame = +1

Query: 829  NATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKA 1008
            ++TF++ S+I+    +N+ A  G+S+       P + + +SP +       N+ NI++K+
Sbjct: 380  HSTFNVNSMIT----TNQNAHQGSSS-------PSSSSPSSPPSSSSSDNNNQ-NIIAKS 427

Query: 1009 V---------YDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYED 1116
            +         Y Q   E+KLHS W  N  ++     +T      D
Sbjct: 428  LSRQLSHHQSYIQQQSERKLHSSWTTNSQSSTSLSSSTSNSTTTD 472

>TBLA0H00180 Chr8 (18713..20887) [2175 bp, 724 aa] {ON} Anc_3.15
            YOL141W
          Length = 724

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 11/60 (18%)
 Frame = +1

Query: 1486 MRIQKDIEVL-----------QVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLN 1632
            M+ +KD+E+L           Q+ K +   + KD   +D  N  +  K +VEK YLP+L+
Sbjct: 1    MKTEKDLEILKKASITAAQRRQILKQDRRKKFKDLAIQDTNNSSIASKRSVEKLYLPKLD 60

>KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {ON}
            weakly similar to uniprot|P39723 Saccharomyces cerevisiae
            YAL047C SPC72 Component of the cytoplasmic Tub4p
            (gamma-tubulin) complex binds spindle pole bodies and
            links them to microtubules has roles in astral
            microtubule formation and stabilization
          Length = 776

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 55/276 (19%), Positives = 106/276 (38%), Gaps = 6/276 (2%)
 Frame = +1

Query: 802  TDLLSAPKTNATFSIKSLISGAK--GSNKTAKAGASNMTLGVAVP-ETHAVASPENPEYL 972
            TD+L          +K+L    K    N   K  A+  T  +    E+HA  + E  E  
Sbjct: 176  TDVLKRQLVQYRVKVKALTEILKQVNFNNDQKLQATQNTENITNDFESHANTNIEEVEDS 235

Query: 973  VRTNEYNIVSKAVYDQMNYEQ-KLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDD 1149
                E N+      +  N E  +L  E ++N      ++Y T  +E  D L   +   +D
Sbjct: 236  PLLREQNVKLVITLEDKNKELIRLKEELVRN-----KDEYETMLEEVNDYLQHNENISND 290

Query: 1150 XXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL-MKLQKINAKEDL 1326
                             I+++ L    L  + + N+ K    + T + +K++ ++   D 
Sbjct: 291  VS--------------NILKFLLDNMDLTAEERDNLIKAAGFESTFIDIKIKALSVNVDK 336

Query: 1327 LAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIA-KIEAINENNMRIQKD 1503
            + ++L              A     +  N +  + + +LD K+   IE ++E      + 
Sbjct: 337  IVRELRTIKNSDQSSGNLLADQGTISPLNDSRLDNSEVLDSKLELAIETMHEKYHDFLQS 396

Query: 1504 IEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
            I++   K  NLE  +KD  ++ KL  + +  +  E+
Sbjct: 397  IQLKLEKNDNLEKALKDKFQQQKLLLESMSNIEHER 432

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
            similar to uniprot|P33420 Saccharomyces cerevisiae
            YPL174C NIP100 Large subunit of the dynactin complex
            which is involved in partitioning the mitotic spindle
            between mother and daughter cells putative ortholog of
            mammalian p150(glued)
          Length = 869

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +1

Query: 1480 NNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAK 1659
            +++R+++ I+ LQ K   L NE K       L   +  K ++E     R+ E++  +   
Sbjct: 94   DDVRLKRIIDKLQEKLYKLHNECKS------LQLQLASKKSLED----RITELEHSV--- 140

Query: 1660 FDKLAIIKNETISENNQL---SILTKKLEEERI 1749
              +LA I+NET+ E+N+L    +L+ K   E +
Sbjct: 141  --ELATIENETLEEHNELLGHDLLSLKKRHEAV 171

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_6.16
            YEL061C
          Length = 1097

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 28/127 (22%), Positives = 61/127 (48%), Gaps = 18/127 (14%)
 Frame = +1

Query: 1411 NGNL-ENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE-------- 1563
            NGN+ +NL + +    + IEAI+ +N   QK+I++++   L +  ++++  +        
Sbjct: 669  NGNIIDNLKSSIISNNSSIEAIDSSN--FQKNIDIIENTTLKILKQVQEKSQHIYSSCIE 726

Query: 1564 ------KDKLNKDVLQKLNVEKDYLPRLNEIDE---QIAAKFDKLAIIKNETISENNQLS 1716
                   + LNK  ++  +++  Y  + N+I E    ++ +++      N +  +NN   
Sbjct: 727  RILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYEL 786

Query: 1717 ILTKKLE 1737
            IL   LE
Sbjct: 787  ILKNHLE 793

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 44/184 (23%), Positives = 83/184 (45%), Gaps = 17/184 (9%)
 Frame = +1

Query: 1213 QLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQL-DVXXXXXXXXXXXXAI 1389
            +L     D   K  +D  K +K     + ++I  + D + ++L ++            A 
Sbjct: 668  ELTGGYYDQHQKMKLDALKDLKNANA-QFKQITLELDTIHQKLNEMDSSIDQQNSLIKAE 726

Query: 1390 TNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKK------LNLENEIK 1551
            TN+      N++NL   L+ K  + +AI E ++R  KD ++  ++K       NLE  +K
Sbjct: 727  TNKQETMLTNIDNLNLKLNNKRGE-KAIAEESIRKLKD-KINNIEKHLDSSGKNLETFLK 784

Query: 1552 DHEEKDKLNKDVLQKLNVE------KDYLPRLNEIDEQ---IAAKFDKL-AIIKNETISE 1701
            D E+        ++K+++E       +   +LNEI E+   ++   DKL A +  + I +
Sbjct: 785  DREQPFDSELSEVEKVDLENITISISERSEKLNEITEELDDVSGSLDKLRAQLDAKLIPQ 844

Query: 1702 NNQL 1713
             N L
Sbjct: 845  YNNL 848

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 32/156 (20%), Positives = 67/156 (42%), Gaps = 6/156 (3%)
 Frame = +1

Query: 1204 MEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXX 1383
            +E +L+    D++ K  +D    I E  L+  +++  +      QL +            
Sbjct: 840  LESKLIPQQNDIKQKL-LDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQ------ 892

Query: 1384 AITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
            +I  E       + N   +L++   +   + +     QKD++   +KK  L    K+ E+
Sbjct: 893  SIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQ 952

Query: 1564 KDK----LNKDVLQKLNV--EKDYLPRLNEIDEQIA 1653
            K +    +++D L K      +D L +LNE +++I+
Sbjct: 953  KIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEIS 988

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 26/114 (22%), Positives = 51/114 (44%), Gaps = 1/114 (0%)
 Frame = +1

Query: 1399 YNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLN 1578
            YN+   +  +  T LD++   +E IN+N   ++  I++ +        E+     K    
Sbjct: 252  YNVTLHSSHDYITELDKREDMVEQINKNLQNLESSIKIKETA------ELSQARSKHNEL 305

Query: 1579 KDVLQKLNVE-KDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLE 1737
             + +  LNV+ +D   ++   DEQ       LAII     ++  QL+ ++ + E
Sbjct: 306  SNAIANLNVKIRDLQRQVVSYDEQSDLNRKNLAIINEAIEAKQAQLAKISPRFE 359

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 20/84 (23%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 1498 KDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP-RLNEIDEQIAAKFDKLA 1674
            K++++LQ + LNLEN+++    +    KD LQ +   K+ +   LNE+ +Q  +    + 
Sbjct: 814  KELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQHELNELVDQEKSIKLSIE 873

Query: 1675 IIKNETISENNQLSILTKKLEEER 1746
             ++ E   +N +L  +    + ++
Sbjct: 874  TLEGELDGKNEELKSIKAAFDSKQ 897

>YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Subunit
            of MRX complex, with Mre11p and Xrs2p, involved in
            processing double-strand DNA breaks in vegetative cells,
            initiation of meiotic DSBs, telomere maintenance, and
            nonhomologous end joining
          Length = 1312

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 10/109 (9%)
 Frame = +1

Query: 1441 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            LDE       + +     + +I  L  K   LE E+KD E   K   + L   N  +D +
Sbjct: 771  LDELEVDSTKLKDEKELAESEIRPLIEKFTYLEKELKDLENSSKTISEELSIYNTSEDGI 830

Query: 1621 PRLNEIDEQ----------IAAKFDKLAIIKNETISENNQLSILTKKLE 1737
              ++E+ +Q          +      L + K+E + EN+++  L K+ E
Sbjct: 831  QTVDELRDQQRKMNDSLRELRKTISDLQMEKDEKVRENSRMINLIKEKE 879

>Suva_3.133 Chr3 complement(205980..207068) [1089 bp, 362 aa] {ON}
            YCR095C (REAL)
          Length = 362

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +1

Query: 1384 AITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
            +I NEY +++G   N      E   +I +I+    +  K       K+L+LEN  K H  
Sbjct: 176  SIINEYRLFSGKNRNYFA---ETFLEIISISIEQEKCNKTNTNKNTKRLSLENNNKTHSI 232

Query: 1564 KDKLNKDVLQK-----LNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENN 1707
            + K N   L K     L  E +   RL  +  QI  K      +KN  +S+ N
Sbjct: 233  EYKANSGKLIKVYESDLCKEPEVPQRLLTLINQIETK------VKNNKVSQIN 279

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 9/130 (6%)
 Frame = +1

Query: 1384 AITNEYNIWNGNLENLTTLLDEKIAKIEAINEN-------NMRIQKDIEVLQVKKLNLEN 1542
            ++T+  +   G +E   TL D    K+  INE+        M ++ ++E L     +L+ 
Sbjct: 1039 SVTSVQHTKEGLIEESRTLED----KLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKK 1094

Query: 1543 EIKDHEEK--DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
            EIK +EEK  D   +DV Q L+  KD     ++  E   +  ++      E   EN  L 
Sbjct: 1095 EIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLD 1154

Query: 1717 ILTKKLEEER 1746
               +  + E+
Sbjct: 1155 AQDQVQDAEK 1164

>YMR294W Chr13 (856966..858087) [1122 bp, 373 aa] {ON}  JNM1Component
            of the yeast dynactin complex, consisting of Nip100p,
            Jnm1p, and Arp1p; required for proper nuclear migration
            and spindle partitioning during mitotic anaphase B
          Length = 373

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 29/152 (19%), Positives = 67/152 (44%), Gaps = 1/152 (0%)
 Frame = +1

Query: 1078 DEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKN-VLDVQSKYN 1254
            D+K   K Q++ D+LVEL ++ ++                 + +  + +N V ++ S Y+
Sbjct: 222  DDKAEGKLQKFRDRLVELNEEFENSLLGKKIQQDLRLKDDTVSKLVMPENKVKEINSMYS 281

Query: 1255 VDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLT 1434
            +   K  +++  +  +++ +   +  + ++V            +I  +  +W   L  L 
Sbjct: 282  M--FKQYQDSLPLLAERMKSLNKMNNRVIEVYETTKGLDSQITSIQEQGKVWLKALNELD 339

Query: 1435 TLLDEKIAKIEAINENNMRIQKDIEVLQVKKL 1530
               DE+  K   I EN  +I++ I+ L+ + L
Sbjct: 340  KKFDEQEVK---IRENMEQIRRKIDTLEDEAL 368

>KNAG0K00940 Chr11 complement(184711..186111) [1401 bp, 466 aa] {ON} 
          Length = 466

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 5/93 (5%)
 Frame = +1

Query: 1465 EAINENNMRIQKDIEVLQVKKLNLENEIKD----HEEKDKLNKDVLQKLNVEK-DYLPRL 1629
            + + ENN R   D+E  Q     L+N++K+     E ++K+   V+Q++ ++    L R 
Sbjct: 255  QQLEENNKRSTSDLEESQKIISKLQNDLKELELSIESENKMFYTVVQEVEMKSAQELSRH 314

Query: 1630 NEIDEQIAAKFDKLAIIKNETISENNQLSILTK 1728
             E  EQ A   +K+ ++++E  +   QL + TK
Sbjct: 315  KESIEQKA--IEKIKLLQDENKNIKGQLELHTK 345

>TPHA0B01020 Chr2 complement(232252..233757) [1506 bp, 501 aa] {ON}
            Anc_4.199 YLR360W
          Length = 501

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 28/114 (24%), Positives = 56/114 (49%)
 Frame = +1

Query: 805  DLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTN 984
            +L+S    + T++ KS + G   +N   +   + +T+ +   + H  A   + E L++T 
Sbjct: 217  NLISEKLHDRTYNKKSALIG---NNNLIQKYINQLTVSIDRKQRHLEAIGLSFESLIKT- 272

Query: 985  EYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLD 1146
            E+N   K      NYE K H++  + FN  E+   +   + Y+  L+++  +LD
Sbjct: 273  EHNEEDK------NYELKFHADSGQYFNEVEENDNSYGNKSYQ--LIKINNKLD 318

>CAGL0K03047g Chr11 (284084..284689) [606 bp, 201 aa] {ON} weakly
            similar to uniprot|Q02486 Saccharomyces cerevisiae
            YMR072w
          Length = 201

 Score = 32.0 bits (71), Expect = 3.6
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 14/101 (13%)
 Frame = +1

Query: 862  GAKGSNKTAKAGASNMTL----GVAVP---------ETHAVASPENPEYLVRTNEYNIVS 1002
            GAKG +K AK+G S   L    G   P         +  A A+ ENP   + T E + V 
Sbjct: 32   GAKGKDKDAKSGVSRKDLIKQFGPKRPAAAFILYTVQERANATAENPG--LSTKEISAVL 89

Query: 1003 KAVYDQMN-YEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
               + Q++ YE++ + +  K   A E+  Y TKKQE+E  L
Sbjct: 90   GEKWRQLSEYEKEPYFQ--KTQQALEE--YKTKKQEFEAML 126

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 7/112 (6%)
 Frame = +1

Query: 1435 TLLDEKIAKIEAIN-ENNMRIQKDIEVLQVKKLNLEN------EIKDHEEKDKLNKDVLQ 1593
            TL +EKI   + +N +NN  I    E L  K+   E       ++    +KD    +   
Sbjct: 142  TLREEKIKIEQQLNLKNNELISIKEEFLSKKQFMNEGHEIHLKQLAASNKKDLKKMENEY 201

Query: 1594 KLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
            K  +EK    ++ + + + AA  DK+  I+N+ I   + L  +  + E++++
Sbjct: 202  KTKIEKLKFMKIKQFENERAALLDKIEEIRNKIIMNPSTLQEMLNESEQKQV 253

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 53/251 (21%), Positives = 95/251 (37%), Gaps = 10/251 (3%)
 Frame = +1

Query: 973  VRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ----KQ 1140
            ++ NE   + +    +  +  + H   LK   A+  +     + EY+ K+ +L+    KQ
Sbjct: 156  LKNNELISIKEEFLSKKQFMNEGHEIHLKQLAASNKKDLKKMENEYKTKIEKLKFMKIKQ 215

Query: 1141 LDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM----KLQKI 1308
             ++                E +  +++ N   +Q   N  + K + E EL     + Q  
Sbjct: 216  FENERAALLDKI-------EEIRNKIIMNPSTLQEMLNESEQKQVLEKELWLTEYQTQWK 268

Query: 1309 NAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNM 1488
            N  E       D+                EY +    L     LL EK  + E +N    
Sbjct: 269  NNMELNNKHMKDIENVKKEI---------EYTL-KPKLTEKKKLLTEKCNEYETLN---- 314

Query: 1489 RIQKDIEVLQVKK--LNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 1662
                 +EV + KK    L NE+     K+K N++ L K+N  ++Y+      D +I  K 
Sbjct: 315  -----VEVEEKKKETAKLRNEVAS---KEKANRETLDKINELEEYIK-----DTEIGMKE 361

Query: 1663 DKLAIIKNETI 1695
                ++K ET+
Sbjct: 362  LNEILVKEETV 372

>Skud_12.510 Chr12 (908374..910566) [2193 bp, 730 aa] {ON} YLR424W
            (REAL)
          Length = 730

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 25/95 (26%), Positives = 44/95 (46%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK 1566
            IT E N+ N   ++      + + K+ AI       QK +EV++ + L LE +++ H+E+
Sbjct: 198  ITKEMNLLNKVSKSKKDAFMKTLQKLLAI-------QKSLEVIRERTLPLELQLRQHDEQ 250

Query: 1567 DKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKL 1671
              L  D+   L  E   L   ++I   +    D L
Sbjct: 251  KALLSDLEASLKDESKDLSLFDKISTILKLSDDDL 285

>TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.322
            YHR056C
          Length = 852

 Score = 32.7 bits (73), Expect = 3.8
 Identities = 14/38 (36%), Positives = 27/38 (71%)
 Frame = +1

Query: 1498 KDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 1611
            K++E L+ K + + +  K++EE DKLN+D+ ++ N +K
Sbjct: 171  KEMEFLEEKLVEVSDLYKENEELDKLNEDIKRQRNKKK 208

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 32.7 bits (73), Expect = 3.8
 Identities = 33/118 (27%), Positives = 63/118 (53%), Gaps = 8/118 (6%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            + +L   L EK+  I  + EN   ++K+ +V  +K  N EN   D++ KD +++  +++L
Sbjct: 310  ISDLQAQLTEKLTTINNLEEN---LKKNNDV--IKNFNTENYKHDNQVKDFISQ--IEEL 362

Query: 1600 NVEKDYLPRLNEIDEQIAAKF-----DKLAIIK--NETISENNQLSI-LTKKLEEERI 1749
            + +K  L R  +I ++   K+      K+  +K  NE  +EN+   +   KKL E+R+
Sbjct: 363  HDDKKSLTRDLQISKEKFNKYRGEMERKVFELKTSNERTTENDAEQLDQIKKLYEDRV 420

>TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON}
            Anc_2.16 YNL225C
          Length = 1016

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 26/130 (20%), Positives = 60/130 (46%), Gaps = 23/130 (17%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE------------E 1563
            +ENL    D    +I +  +    I+K+ EV + K++N ++++   E            +
Sbjct: 748  IENLAASTDIFNTEISSTKKLLTDIKKENEVSETKRINFQDKLLKTETQNEINLKSLLLK 807

Query: 1564 KDKLNKDVLQKLNVEKDYLP-----------RLNEIDEQIAAKFDKLAIIKNETISENNQ 1710
            KD  N+++ ++L+    Y+            R+  +   +  K  ++  + N+  +++  
Sbjct: 808  KDNCNEELTEQLSSCLKYMSDMEHTMQNEISRIGILQSILVVKETEVEALNNKLNAQSEN 867

Query: 1711 LSILTKKLEE 1740
            ++ LTKKLE+
Sbjct: 868  INELTKKLEK 877

>NCAS0G04180 Chr7 complement(777741..781058) [3318 bp, 1105 aa] {ON}
            Anc_1.487 YEL043W
          Length = 1105

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 7/112 (6%)
 Frame = +1

Query: 1417 NLENLTTLLDEKIAK----IEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKD 1584
            +LEN   L D K  K    I  +NE  +++QKD+ +  + +LN            +LN +
Sbjct: 365  SLENSKVLSDLKFEKLTKKIAKLNEKILKMQKDMNLWALSELN------------ELNTN 412

Query: 1585 VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETIS---ENNQLSILTKK 1731
             L KL  EK  +    + +  I    D++ I++N+  S   EN +L+IL K+
Sbjct: 413  NL-KLKYEKIIM----DTNANIKLLGDQILILQNQVSSQDEENKKLNILKKE 459

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
            Anc_5.88 YGR238C
          Length = 1167

 Score = 32.7 bits (73), Expect = 3.9
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 1599
            ++ L+  LD+ IAK + ++E+  ++ K+ + L++K   L  E+   E +       L+K 
Sbjct: 997  VDKLSNRLDDLIAKSQEMSESKDKLSKEYQSLELKHSTLSQELLSKENE-------LEK- 1048

Query: 1600 NVEKDYLPRLNEI-DEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERI 1749
              EK+Y   L+ +     A K  +  + K + +++  QL     +LE E+I
Sbjct: 1049 -TEKNYKDSLDAVATASKALKISQQEVEKYKLLNKKLQL-----ELEREQI 1093

>AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL250W (RAD50)
          Length = 1296

 Score = 32.7 bits (73), Expect = 4.0
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 21/142 (14%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEA-INENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
            +TN+      N E+    ++  I K E  I++  ++ QK++   Q +    +NE+   E+
Sbjct: 367  LTNQLASEGINTEDSLGCIESMIQKAETKISDLRLKHQKELNEAQERLSGKQNELIREEQ 426

Query: 1564 KDKLNKDVLQKLNVE----KDYLPRLNEIDEQIAAKFDKLAIIK---------------N 1686
            K    KD   KLN +    K  L R++E + ++      L   K               N
Sbjct: 427  KLSYTKDDRAKLNDQLMTLKQKLARISETESELEISKQDLEKYKPRVEMWQKENAVDRFN 486

Query: 1687 ETI-SENNQLSILTKKLEEERI 1749
            E I S+N+++ +L   +E+ +I
Sbjct: 487  EEIKSKNDEMLLLENDVEKVQI 508

>TPHA0M01490 Chr13 complement(316012..317295) [1284 bp, 427 aa] {ON}
            Anc_3.336 YBR095C
          Length = 427

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 41/185 (22%), Positives = 78/185 (42%), Gaps = 14/185 (7%)
 Frame = +1

Query: 1219 VKNVLDVQSKYNVD---KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAI 1389
            + ++ D+ +K ++    K K++KE  L  +  +  ++D + K   +             +
Sbjct: 154  ISSLSDISTKDSISHVYKSKILKELALQTILMVEKEQDSVNKYTKLLEVLLGN------L 207

Query: 1390 TNEYNIWNGNLENLTTLLDEKIAKIEAINEN--------NMRIQKDIEVLQVKKLNLENE 1545
             +  +  N NL++     D K+   E+ NEN        N  I +D E     K N   +
Sbjct: 208  VDPLHQSNLNLKDY----DHKLLLEESDNENDPENSTANNTTINEDEEDSNDNKNNNPVD 263

Query: 1546 IKDHEEKDKLNKD---VLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLS 1716
             K+  ++D  ++D    + K++V       L + DE++  K  K     N  I  +  LS
Sbjct: 264  FKEGRQEDHEDEDPFFAIPKVDV-------LTKFDEELDPKNSKKDAQNNTDIISSYSLS 316

Query: 1717 ILTKK 1731
             LTK+
Sbjct: 317  YLTKE 321

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7.157
           YIR004W
          Length = 446

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 8/123 (6%)
 Frame = +1

Query: 31  LEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPT---TSAT 201
           +++HP + P     T      SE  + +S        +RSNY K  KEK  P+     A 
Sbjct: 31  IKEHPDKNPNDPSATERFQAISEAYQVLS-----DKQLRSNYDKYGKEKAIPSGGFEDAA 85

Query: 202 SNFNKMVPGE-----MGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHE 366
             F+ +  G+     +G  +L KN ++ +++       +++KR+ +       +E K +E
Sbjct: 86  EQFSVIFGGDAFKPYIGELTLLKNLQKTEELSAQDE--EDKKREEE-------EERKKNE 136

Query: 367 LQK 375
           L+K
Sbjct: 137 LEK 139

>TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {ON}
            Anc_8.636 YOR216C
          Length = 478

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query: 1459 KIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDK-LNKDVLQKLNVEKDYLPRLNE 1635
            K+E I      +++ I +L  +  +LENE++D + + K L  D+    +     +  + +
Sbjct: 179  KVETIEGEKKEMKETIAILNREFSSLENELEDAQSRIKELESDIKISSSSSLHEISSIKK 238

Query: 1636 IDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
              E++  + D+L +     + +NN+  I    LEEER
Sbjct: 239  DKERLLTQIDELTL-----LLDNNKKDI--NDLEEER 268

>TBLA0B02840 Chr2 (655241..657064) [1824 bp, 607 aa] {ON} Anc_8.786
            YOR308C
          Length = 607

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 22/60 (36%), Positives = 32/60 (53%)
 Frame = +1

Query: 1507 EVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKN 1686
            E   ++   LEN+   HEE D LNK  L+KLN ++     LN     IA + D  +++KN
Sbjct: 187  EADDIQDAMLENQDLIHEE-DHLNKLKLRKLNQQRKRRFNLNVSSIDIAKEDDDKSVVKN 245

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
            complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEID---EQIAAKFD 1665
            +KD +    + LN  N IK  +      KD+L+ +N   +YL R N+ D   E++    +
Sbjct: 434  RKDAQFKSKEILNDINSIKSFQ-----GKDILKFINSSLEYLERDNKSDNITEELLKIKN 488

Query: 1666 KLAIIKNETISENNQLSILTKKLEEE 1743
             +AI+K + ++E   L+   +KL+ E
Sbjct: 489  DMAIVKTQKMNEYRDLA---QKLQNE 511

>CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} similar to
            uniprot|P40957 Saccharomyces cerevisiae YGL086w MAD1
            spindle assembly checkpoint protein
          Length = 657

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 22/117 (18%), Positives = 51/117 (43%), Gaps = 19/117 (16%)
 Frame = +1

Query: 1459 KIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLN------------ 1602
            ++  + +NN+ ++KD E L++    LE ++ D  +    N  +LQ+ +            
Sbjct: 444  RLNELQQNNLSLEKDNEKLRLVVEKLEGKLDDLRKTKPKNIRILQQRDSPLLKLQFVRRK 503

Query: 1603 -------VEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
                     ++ L  +  I E     FDK+ +    ++    ++S+ T K +E++ +
Sbjct: 504  ENELLREENQNLLTMIENITENRNESFDKIPLTSYNSLKYQYEISMDTNKKQEKKFS 560

>TPHA0B02130 Chr2 complement(489226..491211) [1986 bp, 661 aa] {ON}
            Anc_4.268 YDL074C
          Length = 661

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 33/189 (17%), Positives = 72/189 (38%), Gaps = 1/189 (0%)
 Frame = +1

Query: 943  VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 1122
            +++  N +Y    N  N++SK   ++   +QK  +      +   + K  +K  +   +L
Sbjct: 420  ISNTINIKYTEYLNTENVISKLTVEKTKADQKYFAVMRSKDSILIENKNLSKSLQKSYEL 479

Query: 1123 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL-MKL 1299
            +   K+ D                 +  E  L+ N+ D   K N    ++ ++ ++ + L
Sbjct: 480  ISQLKEADKLYQQKIENLNKQLELSQNNEKSLLNNMKDEVMKQNNLSSEISQQKKINLNL 539

Query: 1300 QKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINE 1479
            Q+ N+K   L                       Y    G L+   T  +   +KI+ + +
Sbjct: 540  QEENSKHISL-----------------------YTTLQGELDAEVTAKNNLASKIKHLED 576

Query: 1480 NNMRIQKDI 1506
             N+++QK +
Sbjct: 577  QNLKLQKSL 585

>NCAS0F03030 Chr6 complement(603553..605709) [2157 bp, 718 aa] {ON}
            Anc_5.380 YDR333C
          Length = 718

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query: 1426 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI-KDHEEKDKLNKDVLQKLN 1602
            NL  L+++    +E+ + +N      ++ +Q +K+ L  +  K  ++K K NK   +K+N
Sbjct: 44   NLFALMNDDSDTVES-DASNSEDNNSVKEVQAEKVILPTKTQKKKKQKQKKNKKTNKKIN 102

Query: 1603 VEKDYLPRLNEIDEQIAAKFDKLAIIK 1683
               + +   NE  ++I  KF K  +IK
Sbjct: 103  NLSEDVDNNNEEFDKILQKFQKENVIK 129

>Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}
            similar to Ashbya gossypii AAL085C
          Length = 839

 Score = 32.3 bits (72), Expect = 5.0
 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE-EKDKLNKDVLQK 1596
            +E L  L D   AK++  N+ +  ++  IE L+   L+ + EIK  + E D L  ++   
Sbjct: 227  IEQLKQLYDSMTAKVKQYNKQSSELKTTIENLRSSYLSQQTEIKGRDIEIDYLKNELNNC 286

Query: 1597 LNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQ 1710
                 +   + +++ +Q+    D+  +I  + + ++ Q
Sbjct: 287  AGQLSEEKIKNSDLIQQLGYLKDEFRVISTDLLQKHGQ 324

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
            (REAL)
          Length = 877

 Score = 32.3 bits (72), Expect = 5.0
 Identities = 44/168 (26%), Positives = 70/168 (41%), Gaps = 11/168 (6%)
 Frame = +1

Query: 1279 ETELMKLQKINAKED-LLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKI 1455
            E + +++ +I  KE  L+ K   +             ITN       N EN  +  +E +
Sbjct: 540  EAKNIEISQIFGKEQSLIEKNESLSNELKKAQDQLDKITNLNTTTKSNYENKISSQNEIV 599

Query: 1456 AKIEAINEN-NMRIQKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVE----K 1611
              + + N+    RIQ+ +E         EN  KDH  K +    N + LQKLNVE    K
Sbjct: 600  KALTSENDTLKQRIQQLVEFK-------ENAQKDHSTKLEAFQKNNEQLQKLNVEVVQLK 652

Query: 1612 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQL--SILTKKLEEERI 1749
             +   L E    +    DK  I   E++S+   L   ++  K E++ I
Sbjct: 653  AHELELEEQCRYLKGCLDKKEIGVEESLSDVKILKQQVIVLKSEKQDI 700

>Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {ON}
            YLR309C (REAL)
          Length = 910

 Score = 32.3 bits (72), Expect = 5.0
 Identities = 56/257 (21%), Positives = 104/257 (40%), Gaps = 31/257 (12%)
 Frame = +1

Query: 1066 NAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKN--VLDV 1239
            N  ++EK  T+KQE E  L +L+++L                    +E +LV N  +++ 
Sbjct: 191  NMLKEEK-ETEKQEVEISLAKLKEEL----IANNLTLEDYKTKVTKLEQELVSNNTIVEE 245

Query: 1240 QSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGN 1419
            +S    +   ++KE E    QK++  E  L +                 + +  N+ N N
Sbjct: 246  KSSKLAELDVILKEKE----QKLSELEKKLKEA-------------PKTVISNQNVGNNN 288

Query: 1420 LENLTTLLDEKI---AKIEAINENNM-----------RIQKDIEVLQVKKLN-------- 1533
                     +K    A ++ +NE              ++++D++VLQ K  N        
Sbjct: 289  RRRKNRNKSKKNKGNATVDDLNEEESFDNLINTAEYEKLKEDLQVLQEKHENCEDWRLKY 348

Query: 1534 --LENEIKDHEEK--DKLNK--DVLQKLNVE-KDYLPRLNEIDEQIAAKFDKLAIIKNET 1692
              +E E+K+ +E    +L K  + L+ LN E  D    L E + ++    D L  + NE 
Sbjct: 349  EEMEAELKNTKESGASQLAKSAEELKTLNTELSDTKKSLKEKNSELEEVRDMLRTVGNEL 408

Query: 1693 ISENNQLSILTKKLEEE 1743
            +   +++   + K  EE
Sbjct: 409  VDAKDEIKGFSSKQTEE 425

>SAKL0E12716g Chr5 (1049450..1052215) [2766 bp, 921 aa] {ON} some
            similarities with uniprot|P38845 Saccharomyces cerevisiae
            YHR146W CRP1 Protein that binds to cruciform DNA
            structures
          Length = 921

 Score = 32.3 bits (72), Expect = 5.0
 Identities = 34/159 (21%), Positives = 65/159 (40%)
 Frame = +1

Query: 1267 KVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLD 1446
            K + + E +K Q+  A E+L +K+                + ++  I       L  L  
Sbjct: 544  KQVADAEKIKEQQAAATEELESKKAATLALEQKQAAAAKELEDKNTI-------LLNLEQ 596

Query: 1447 EKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR 1626
            +++A  + I E      K++E  +   LNLE +     ++ +  +    K  +EK     
Sbjct: 597  KQVAAAKEIEEQQAAAAKELESKKAIVLNLEQKQAATAKEIEKQQTAAAK-EIEKQQTAA 655

Query: 1627 LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
              EI+EQ AA   +L   K   +    + +   ++LEE+
Sbjct: 656  AKEIEEQQAAAAKELESKKAVALDLEQKQAATVRELEEK 694

 Score = 31.6 bits (70), Expect = 8.7
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 4/112 (3%)
 Frame = +1

Query: 1429 LTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENE----IKDHEEKDKLNKDVLQK 1596
            +  L  +++A  E I E      +++E  +   L LE +     K+ E+K+ +       
Sbjct: 538  ILNLEQKQVADAEKIKEQQAAATEELESKKAATLALEQKQAAAAKELEDKNTI------L 591

Query: 1597 LNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIA 1752
            LN+E+  +    EI+EQ AA   +L   K   ++   + +   K++E+++ A
Sbjct: 592  LNLEQKQVAAAKEIEEQQAAAAKELESKKAIVLNLEQKQAATAKEIEKQQTA 643

>Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}
            similar to Ashbya gossypii AGL058C
          Length = 980

 Score = 32.3 bits (72), Expect = 5.1
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 40/145 (27%)
 Frame = +1

Query: 1423 ENLTTLLDEK---IAKIEAINENNMRI-------QKDIEVLQVKKLNLENEIKDHEEKDK 1572
            + L  +++EK   I+++  + EN   +       QK++ VL+    +LE +I   EE  K
Sbjct: 550  QRLVAVMEEKNETISQLTQLKENYRELLVKKAAMQKELGVLRKHTEDLERQINTMEESHK 609

Query: 1573 LNKDVLQKLNV-----------EKDYLPRLNEID--------------EQIAAKFDKLAI 1677
                 L KL+V           EK Y   ++ ++              E+I    DK+A+
Sbjct: 610  KQLKELSKLSVKQRRKSLGFFDEKLYQEEIHSLEIQLEEARDKLLLSVEEITELHDKIAL 669

Query: 1678 IKNETISENNQL-----SILTKKLE 1737
            ++ E    NN+      S++T K E
Sbjct: 670  VEMEKNEINNEKKDIVESLMTAKAE 694

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
            Anc_5.414 YDR356W
          Length = 1040

 Score = 32.3 bits (72), Expect = 5.1
 Identities = 19/82 (23%), Positives = 44/82 (53%)
 Frame = +1

Query: 1495 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLA 1674
            Q ++  LQ K   LEN  +   E ++LN  ++     EK Y  +++++D ++    D   
Sbjct: 243  QTELTKLQDKLTALENSTESSSELNRLNNTIVDLQANEKKYQIQISQLDIKLK---DSTR 299

Query: 1675 IIKNETISENNQLSILTKKLEE 1740
            +++ +  S   +++ L++K++E
Sbjct: 300  LLETKEGSYQREVTSLSEKVKE 321

>NCAS0B02720 Chr2 complement(456271..459615) [3345 bp, 1114 aa] {ON}
            Anc_8.443 YDL197C
          Length = 1114

 Score = 32.3 bits (72), Expect = 5.1
 Identities = 45/186 (24%), Positives = 79/186 (42%), Gaps = 17/186 (9%)
 Frame = +1

Query: 1237 VQSKYNVDKGKVIKETELMKLQK----INAKEDLLAKQLDVXXXXXXXXXXXXAITNEYN 1404
            ++ KY+V    +  E + +K  K    I  + +L A + ++            A+ NE N
Sbjct: 743  MEEKYDVTIDLLKTEIKELKQSKDRASIEVRAELNALENNILLRIKEYERCQEALENEQN 802

Query: 1405 IWNGNLENLTTLLDEKIAKIEAINE-NNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
            I               IA +E+I + N +     +  L+ K +N  NE+K+      +  
Sbjct: 803  I---------------IANVESIEDINTIEESPFVRALKEKLINTHNELKEVRNLTTIQL 847

Query: 1582 DVLQ-KLNVEKDYLPRLNE--IDEQIA-------AKFDKLAII--KNETISENNQLSILT 1725
              L+  L +EK  L   N+    ++IA        K  K  II  +NE   ++NQ++ L 
Sbjct: 848  GELKIALEMEKRSLKTANDELTAKRIALAKSTAYVKQSKEMIITARNEVAVKDNQITELK 907

Query: 1726 KKLEEE 1743
            K +EE+
Sbjct: 908  KLIEEK 913

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 28/127 (22%), Positives = 54/127 (42%), Gaps = 10/127 (7%)
 Frame = +1

Query: 1387 ITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEK 1566
            I  E +     L ++ T +D+    I  ++ +   +  +IEV +      +NE    EE 
Sbjct: 701  ILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEES 760

Query: 1567 DKLNKDVLQKLNVEKDYL-PRLNEIDEQIAAKFD---------KLAIIKNETISENNQLS 1716
                   L+KLN  + +   +LN  +  +  +FD         +L  +  E  + +N+L+
Sbjct: 761  LNAIILKLEKLNTNRTFAQEKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLN 820

Query: 1717 ILTKKLE 1737
            I +  LE
Sbjct: 821  ITSDALE 827

>Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa] {ON}
            complement(167435..171169) [3735 nt, 1245 aa]
          Length = 1244

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 27/120 (22%), Positives = 50/120 (41%)
 Frame = +1

Query: 1384 AITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEE 1563
            A+  E    N     + T L++K  ++           KD+ +       LENEIK   +
Sbjct: 696  ALREEITSVNSKSALIQTQLNQKQEEVRQTRSTIDETSKDMALSVFTASFLENEIKSLTD 755

Query: 1564 KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            K  +    L K N   DY  ++++  EQ+  K+  L     +    + QL+    +++E+
Sbjct: 756  KLSV---YLTKHNELDDYQKKIDQQQEQLQTKYSDLENRSGDLKIRSEQLNQRNMEIQEQ 812

>TBLA0C04390 Chr3 (1057279..1061097) [3819 bp, 1272 aa] {ON} Anc_4.56
            YGL049C
          Length = 1272

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 38/192 (19%), Positives = 75/192 (39%), Gaps = 20/192 (10%)
 Frame = +1

Query: 805  DLLSAPKTNAT------FSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASP---- 954
            D  +  KTN          +++ IS +K S +     + +     A  +T   A+     
Sbjct: 372  DSTTLSKTNTNNDNANDLKLQTTISNSKPSTENESIDSKHQPSSDAKIDTKEDATELVED 431

Query: 955  ---ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 1125
               EN E +        + +A   +   E+K  ++  K+ +  E +K N +K +  D  V
Sbjct: 432  IMKENKEDIATRTRKTFLEQARLRKAELERKRKNDMPKSSSVEETKKENGRKSD--DTTV 489

Query: 1126 ELQKQLDDXXXXXXXXXXXXXXXXE--IMEYQLVKNVLDVQSKYNVDKGKVIKETELMK- 1296
             +     +                E  IM+ +   + +D+Q + NVD+ K+ K  ++ K 
Sbjct: 490  AMTNDAPETISSSANNEVTATSNTEGKIMQQETTNDKIDIQEESNVDEDKIDKSKDIEKK 549

Query: 1297 ----LQKINAKE 1320
                ++KI  K+
Sbjct: 550  TLSFMEKIKLKK 561

>Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL250W
            (RAD50) - Contains a purine-binding domain, two heptad
            repeats and a hydrophobic tail. [contig 116] FULL
          Length = 1298

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 21/112 (18%), Positives = 55/112 (49%), Gaps = 3/112 (2%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLN---LENEIKDHEEKDKLNKDVL 1590
            L+NL T+  +    I+ + ++   ++ D +  +  K+N   LE  +++++ + K   + L
Sbjct: 187  LDNLKTIKKDMAVDIKLLKQSVEHLKLDRDRSRATKINISTLEKRVEEYKAQAKQVDEQL 246

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEER 1746
             ++  + D L + N+  +Q+ +K + L   +N    +  ++    + L+  R
Sbjct: 247  DEITEQSDRLFKSNQEFQQVLSKMEGLQHSQNSLKEQITRIESTIEPLDLSR 298

>Suva_16.302 Chr16 (524191..528189) [3999 bp, 1332 aa] {ON} YPL016W
           (REAL)
          Length = 1332

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 16/48 (33%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 247 LAKNDKRAKDIQFPKY-LLDNEKRQAQLLMELQIKEHKLHELQKSSRV 387
           L +  K  ++ Q  +  LL+N++RQ +LL+E ++++   HEL+K  +V
Sbjct: 623 LEQERKEREEFQIKQQKLLENQQRQQKLLLETKLRQQYEHELKKLPKV 670

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 32.3 bits (72), Expect = 5.3
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 5/60 (8%)
 Frame = +1

Query: 1456 AKIEAINENNMRIQKDIE-----VLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 1620
            A+IE++ E  +++QKD+E     V  + K +  N +K+ +E DK  KD   KLN  K  L
Sbjct: 608  AEIESLKEELLKLQKDLEDNEKDVTDLNK-SKRNLVKEKQEGDKECKDAGVKLNEMKAIL 666

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 32.3 bits (72), Expect = 5.3
 Identities = 54/241 (22%), Positives = 92/241 (38%), Gaps = 23/241 (9%)
 Frame = +1

Query: 1081 EKYNTKKQEYEDKLVELQKQLDD---XXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKY 1251
            E+ NTK +E E +   LQKQ+D                      +E QL K  L+++S  
Sbjct: 909  EQSNTKIKELEREKSNLQKQIDSMKRQVDSSTKQAMAMKADKSDLESQLRKLKLELKS-- 966

Query: 1252 NVDKGKVIKETELMKLQKI-NAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLEN 1428
               K K +KE E    QK+ N+ EDL  K   V             +T+E  +    +E 
Sbjct: 967  ---KEKRVKELE----QKVDNSGEDLKLKLQQVERAAATNNKRLEQLTSENKLMKDQMEK 1019

Query: 1429 LTTLLDEKIAKIEAINENNMRIQKDIEV--LQVKKLNLE--NEIKDHEE----------- 1563
                  E   ++ +     +R+ + IE    QV  L  E  N + +HE+           
Sbjct: 1020 SKKEQHESQRQLSSRGSELIRLNERIEAEREQVSDLTRERDNLVAEHEQVVNQLAIARSE 1079

Query: 1564 ----KDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKK 1731
                K K+     +  N++++Y          +A   +++  +++E   E      L +K
Sbjct: 1080 IAEYKKKIEALKAEAENMKENYAESSPASQALVATVENRMRGLEDELTKERAMNRFLNEK 1139

Query: 1732 L 1734
            L
Sbjct: 1140 L 1140

>NCAS0F00770 Chr6 complement(155203..155721) [519 bp, 172 aa] {ON}
            Anc_7.122 YIR017C
          Length = 172

 Score = 31.2 bits (69), Expect = 5.4
 Identities = 22/111 (19%), Positives = 53/111 (47%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            NG+L+++  L  EK++      + N  ++ +    ++K   LE + K+ E   +     +
Sbjct: 51   NGDLQSVQNLNLEKLSSTVKNAKENTEVKVEATSDELKLRQLEKKKKNTEASARFR---I 107

Query: 1591 QKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEE 1743
            +K   E++ L +L E+  QI   + ++  + +E      +L  + +K  ++
Sbjct: 108  RKKQREQEKLEKLTELKSQIETLYTRIDTLVDENKYWKKRLQEVNEKKSKD 158

>Kpol_380.15 s380 complement(26295..27449) [1155 bp, 384 aa] {ON}
            complement(26295..27449) [1155 nt, 385 aa]
          Length = 384

 Score = 32.0 bits (71), Expect = 5.4
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 8/86 (9%)
 Frame = +1

Query: 1411 NGNLENLTTLLDEKIAKIEAINENNMRIQ-KDIEVLQVKKLNLENEIKDHEEKDK----- 1572
            N +  +L+T  +E   K++ IN +++ +     E LQ++K  L N+I D+E   K     
Sbjct: 177  NEDQTSLSTTYNENDIKLDIINSDDLNLNLTHNERLQLQKGILHNDINDNEVSSKEQLKT 236

Query: 1573 --LNKDVLQKLNVEKDYLPRLNEIDE 1644
              L   +   LN     L  LNE+++
Sbjct: 237  TQLKSKISHLLNEVNILLDELNELEK 262

>TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8.331
            YDR150W
          Length = 2382

 Score = 32.3 bits (72), Expect = 5.4
 Identities = 23/76 (30%), Positives = 46/76 (60%), Gaps = 7/76 (9%)
 Frame = +1

Query: 1477 ENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV------LQKLNVEKDYLPRLN-E 1635
            E+  +++ D+EV ++++ NLEN+++   +K +L  +V      +  LN E D L   N E
Sbjct: 178  ESARKLKADLEVAELQRTNLENQLE--SKKKQLASEVADLKRHVSDLNDENDALHLKNHE 235

Query: 1636 IDEQIAAKFDKLAIIK 1683
            +++QI  +F KL +++
Sbjct: 236  LNDQI-GEFKKLKVMQ 250

>TBLA0D04480 Chr4 (1109816..1110973) [1158 bp, 385 aa] {ON} Anc_7.167
            YER016W
          Length = 385

 Score = 32.0 bits (71), Expect = 5.4
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 3/106 (2%)
 Frame = +1

Query: 1408 WNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV 1587
            +N N  NL +      A     N N     + I  LQ +    ++EIKD +  ++  K+ 
Sbjct: 183  YNNNTNNLRSSSGYNSASNNNTNNNRNYSTEQITKLQTQLSTAQSEIKDLKNDNEKWKET 242

Query: 1588 LQKLNVEKD-YLPRLNEIDEQIAAKFD--KLAIIKNETISENNQLS 1716
            ++    E+D Y  +L +I+    A  D  K     +ETI   N L+
Sbjct: 243  VEVAQRERDFYFGKLRDIEIFTLATLDLIKEGTQPSETIDLTNALT 288

>Skud_15.72 Chr15 (130194..139436) [9243 bp, 3080 aa] {ON} YOL081W
            (REAL)
          Length = 3080

 Score = 32.3 bits (72), Expect = 5.5
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
 Frame = +1

Query: 829  NATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKA 1008
            ++TF++ S+I+ ++ +++           G + P T + +SP  P      N  NI++K+
Sbjct: 380  HSTFNVNSMITTSQSNHQ-----------GSSSPSTSSSSSP--PSSSSSDNNQNIIAKS 426

Query: 1009 VYDQMNY-----------EQKLHSEWLKN 1062
            +  Q+++           E+KLHS W  N
Sbjct: 427  LSRQLSHHQSYTQQQQQPERKLHSSWATN 455

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {ON}
           similar to gnl|GLV|CAGL0J01936g Candida glabrata
           CAGL0J01936g and some similarites with uniprot|P40564
           YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
           J-domain- containing protein, required for peroxisomal
           protein import
          Length = 418

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 17/143 (11%)
 Frame = +1

Query: 37  DHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPT---TSATSN 207
           +HP +       T      SE  + +S        +R+NY KS KEK  P      A   
Sbjct: 33  EHPDKNRDDPAATERFQSISEAYQVLS-----NKDLRANYDKSGKEKAIPKGGFEDAAEQ 87

Query: 208 FNKMVPGE-----MGYSSLAKN---------DKRAKDIQFPKYLLDNEKRQAQLLMELQI 345
           F+ +  GE     +G  +L KN         ++ A+  +  +   D +K+Q +   E++ 
Sbjct: 88  FSVIFGGEAFAAYIGELTLLKNLQKQEELHAEEEAEKEKEKEKKEDEKKKQKEKEEEIKQ 147

Query: 346 KEHKLHELQKSSRVLVLDEDKNE 414
           K   + +L K    L + +++N+
Sbjct: 148 KGDNIDQLNKDMSHLTVYDEQNQ 170

>KLLA0A03938g Chr1 (351240..352502) [1263 bp, 420 aa] {ON} some
            similarities with uniprot|P39734 Saccharomyces cerevisiae
            YAL028W FRT2 Tail-anchored endoplasmic reticulum membrane
            protein
          Length = 420

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +1

Query: 1420 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIK 1551
            +  LTTL+D  +++++A+    +  Q ++E  +++   LEN IK
Sbjct: 328  VSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLENLIK 371

>KLLA0D02750g Chr4 (233381..234652) [1272 bp, 423 aa] {ON} similar to
            uniprot|Q06410 Saccharomyces cerevisiae YLR423C ATG17
            Protein that interacts with and is required for
            activation of Apg1p protein kinase involved in autophagy
            but not in the Cvt (cytoplasm to vacuole targeting)
            pathway
          Length = 423

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 16/102 (15%)
 Frame = +1

Query: 1438 LLDEKIAKIEAINENNMRIQK---------DIEVLQVKKLNLENEIKDHEEKDKLNKDVL 1590
            +L +KI +I  I +    I++         + +++ VK   L      H  +D  N   L
Sbjct: 138  ILQQKIDEIPIIKQQVTNIRQHYKSIKDRIENQLVAVKLKKLRTYFDSHFSRDSKNN--L 195

Query: 1591 QKLNVEKDYLPRLNEIDEQIA-------AKFDKLAIIKNETI 1695
             KL +E DY+  LNE + ++A         FDK  I+K + I
Sbjct: 196  FKL-LESDYVTELNEFENELADFLRSITDHFDKCTILKEQQI 236

>TBLA0A10610 Chr1 (2624948..2626219) [1272 bp, 423 aa] {ON} Anc_2.315
            YGL153W
          Length = 423

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 43/167 (25%), Positives = 75/167 (44%), Gaps = 5/167 (2%)
 Frame = +1

Query: 1000 SKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXX 1179
            SK   D+   EQ+  S+  K+    E E+   ++QE E KL +L + +D+          
Sbjct: 130  SKLENDKKEIEQEF-SKIDKSLEKMEQEQKLFQEQENE-KLKDLDETIDELKDTIMKTTR 187

Query: 1180 XXXXXXEIMEYQLVKNVLDVQSKYN-VDK----GKVIKETELMKLQKINAKEDLLAKQLD 1344
                     E++++K  L++ +  N VDK       IKE E +K Q+I++ + L+     
Sbjct: 188  TREKIEN--EFKILK--LEITNLQNTVDKFITGNDSIKEFEKVK-QEISSLKTLMEN--- 239

Query: 1345 VXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 1485
                         +  N  ++ NGN +N+T+ ++E   K   IN NN
Sbjct: 240  --------LKGSNSNNNSISLVNGNNQNITSFINETTMKSNNINNNN 278

>Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W
            (REAL)
          Length = 451

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 8/122 (6%)
 Frame = +1

Query: 1402 NIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNK 1581
            N+ N  L+ L  L    + K+E + E     Q D+++  ++KL+     +D EE+ +LN 
Sbjct: 324  NLINNKLKLLNVLETGILYKLEILQE-----QLDLQLKNLEKLS-----QDTEEESRLND 373

Query: 1582 DVLQKLNV--EKDYLPRLNEI-----DEQIAAKFDKLAIIKNETISE-NNQLSILTKKLE 1737
              L +L +  E +  P++++      DE I  K +KL    NE + +      +  K++E
Sbjct: 374  SKLNELQLKYENEIKPKIDKTDVFIQDELINGKINKL----NEEVKQLQKDFEMEVKEIE 429

Query: 1738 EE 1743
             E
Sbjct: 430  IE 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,088,204
Number of extensions: 2607951
Number of successful extensions: 10830
Number of sequences better than 10.0: 301
Number of HSP's gapped: 10675
Number of HSP's successfully gapped: 382
Length of query: 630
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 514
Effective length of database: 40,180,143
Effective search space: 20652593502
Effective search space used: 20652593502
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.3 bits)
S2: 35 (18.1 bits)