Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042503.492ON62962932320.0
Kpol_480.143.492ON6993938241e-100
Skud_7.4413.492ON8076927643e-90
Suva_7.4183.492ON8314385795e-64
YGR130C3.492ON8163835611e-61
Smik_6.2263.492ON8393925585e-61
NCAS0E008103.492ON6923834725e-50
SAKL0F02772g3.492ON7733204543e-47
CAGL0I10516g3.492ON8133654369e-45
ZYRO0D09988g3.492ON9943224291e-43
KNAG0B008103.492ON7576174243e-43
NDAI0G009403.492ON6563964036e-41
TDEL0D056003.492ON7003173942e-39
KLTH0F14828g3.492ON8363213775e-37
KLLA0D16236g3.492ON8713433402e-32
Kwal_55.212293.492ON7873233383e-32
KAFR0C019603.492ON5636153159e-30
Ecym_12373.492ON7272762064e-16
TBLA0C044803.492ON8021102012e-15
AFR310C3.492ON6232491894e-14
KAFR0G036903.492ON3631231623e-11
NCAS0F035503.492ON4411111287e-07
KNAG0A079403.492ON275771231e-06
NDAI0B058603.492ON681741101e-04
Smik_7.563.516ON103543830.24
YGL207W (SPT16)3.516ON103543830.26
Suva_7.543.516ON103643800.58
Skud_7.613.516ON103545771.1
ZYRO0A08888g2.409ON1266275771.4
KNAG0B057504.185ON84799742.8
TBLA0G015806.268ON27598722.8
CAGL0F00913g7.86ON120685742.8
ZYRO0E05412g1.380ON1244135733.3
SAKL0E14916g5.702ON1779153733.4
Suva_13.1185.512ON670120724.1
KLLA0A03938g7.69ON420104714.4
TPHA0B008404.237ON1119153716.3
KNAG0A067402.497ON145054708.6
TPHA0H017705.251ON434226699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04250
         (629 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...  1249   0.0  
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   322   e-100
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   298   3e-90
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   227   5e-64
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   220   1e-61
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   219   5e-61
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   186   5e-50
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   179   3e-47
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   172   9e-45
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   169   1e-43
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   167   3e-43
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   159   6e-41
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   156   2e-39
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   149   5e-37
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   135   2e-32
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   134   3e-32
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   125   9e-30
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    84   4e-16
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    82   2e-15
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    77   4e-14
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    67   3e-11
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    54   7e-07
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    52   1e-06
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    47   1e-04
Smik_7.56 Chr7 (93864..96971) [3108 bp, 1035 aa] {ON} YGL207W (R...    37   0.24 
YGL207W Chr7 (98969..102076) [3108 bp, 1035 aa] {ON}  SPT16Subun...    37   0.26 
Suva_7.54 Chr7 (95556..98666) [3111 bp, 1036 aa] {ON} YGL207W (R...    35   0.58 
Skud_7.61 Chr7 (104429..107536) [3108 bp, 1035 aa] {ON} YGL207W ...    34   1.1  
ZYRO0A08888g Chr1 complement(707590..711390) [3801 bp, 1266 aa] ...    34   1.4  
KNAG0B05750 Chr2 (1133580..1136123) [2544 bp, 847 aa] {ON} Anc_4...    33   2.8  
TBLA0G01580 Chr7 (417358..417394,417473..418263) [828 bp, 275 aa...    32   2.8  
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    33   2.8  
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    33   3.3  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    33   3.4  
Suva_13.118 Chr13 (188941..190953) [2013 bp, 670 aa] {ON} YML042...    32   4.1  
KLLA0A03938g Chr1 (351240..352502) [1263 bp, 420 aa] {ON} some s...    32   4.4  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    32   6.3  
KNAG0A06740 Chr1 (1049153..1053505) [4353 bp, 1450 aa] {ON} Anc_...    32   8.6  
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...    31   9.3  

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 1249 bits (3232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/629 (100%), Positives = 629/629 (100%)

Query: 1   MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60
           MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK
Sbjct: 1   MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60

Query: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120
           FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL
Sbjct: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120

Query: 121 HELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEE 180
           HELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEE
Sbjct: 121 HELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEE 180

Query: 181 EEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEE 240
           EEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEE
Sbjct: 181 EEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEE 240

Query: 241 EEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 300
           EEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA
Sbjct: 241 EEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 300

Query: 301 SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360
           SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED
Sbjct: 301 SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360

Query: 361 EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD 420
           EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD
Sbjct: 361 EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD 420

Query: 421 KGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480
           KGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTL
Sbjct: 421 KGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480

Query: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540
           LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL
Sbjct: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540

Query: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600
           PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ
Sbjct: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600

Query: 601 DELLQKKLTELQEKHNEEMAEIQKKYQEK 629
           DELLQKKLTELQEKHNEEMAEIQKKYQEK
Sbjct: 601 DELLQKKLTELQEKHNEEMAEIQKKYQEK 629

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  322 bits (824), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/393 (45%), Positives = 265/393 (67%), Gaps = 20/393 (5%)

Query: 237 DEEEEEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTA 296
           ++E  +E  E+  V PI+P   PM+ + P        P++++T  I ++  G   SN   
Sbjct: 299 EDESVQETEEKSLVEPINPDEAPMLHMGP------PQPQSSST-GIMAIFKGNSSSN--- 348

Query: 297 KAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFN 356
                     +     + ++SPENPEY+++T ++  +SKAVYD++ Y+Q +H  WL N  
Sbjct: 349 ----------IQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLE 398

Query: 357 AAEDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSK 416
             E+EKY  KK EYED L ++Q ++D+I +      +K  QKIE+MEYQLVKN+LD+   
Sbjct: 399 TTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQT 458

Query: 417 YNVDKGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLEN 476
           +N  K K+ KETELMKL+K+NAK+D ++KQ +++ EIE L+ E+  +T+++N WN  L  
Sbjct: 459 HNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNE 518

Query: 477 LTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVE 536
           +T  LD KI  I A N+  + I++++  L + K+ LE EIK +EE  K N ++L  LNV 
Sbjct: 519 ITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVR 578

Query: 537 KDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKM 596
           K+YLPR+NEID +IA + +KL+ IK ETI ENN+L+ILTKKLE+ERIA ENEI++KNEK+
Sbjct: 579 KNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKL 638

Query: 597 KREQDELLQKKLTELQEKHNEEMAEIQKKYQEK 629
           KREQ++ LQK+L EL+ KHNEE+ EIQKKY++K
Sbjct: 639 KREQEQKLQKQLAELKAKHNEELLEIQKKYEKK 671

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 96/147 (65%), Gaps = 12/147 (8%)

Query: 21  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 80
            + L + +SR   N EY+SPFR+P +   +NYAK+ K ++FPT SA+S+F++M P E+GY
Sbjct: 23  HSMLKKVVSR-DHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGY 81

Query: 81  SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNELV 140
            +++K+ KRAKDI FP +L+ NE+RQ  ++ +L++KE  L  L+ S           +++
Sbjct: 82  KNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNS-----------QIL 130

Query: 141 LEESSSSDEEEESEEDDDDGDEGEDED 167
           L E+ +S + +ES +++  GDE   +D
Sbjct: 131 LNENGTSTQTKESSDEESSGDETSTDD 157

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  298 bits (764), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 234/692 (33%), Positives = 373/692 (53%), Gaps = 110/692 (15%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76
           FL + +S + +  E ++SPFR  QD +  N     Y    K KKFPT SATS ++K  P 
Sbjct: 38  FLQKVVSNEPKGKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPK 95

Query: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDK 136
           ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L++  ++  L  D 
Sbjct: 96  DLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLTSDG 155

Query: 137 NE------------------------LVLEESSSSDEEEESEED-------DDDGDEGE- 164
           N+                         +  E++++D  + +           D GDE   
Sbjct: 156 NDDAATSADSSLSSSDKEDSTTSKGNEIAGEAAAADMTKITTTTAPTSSAVGDSGDEATS 215

Query: 165 -DEDGDESVEEEKYVEEEEDNN---AEENISEKIESIIGELDSQNENVSKNAEILEEQSN 220
            +E+ D+   E   VE+    N   A+E ++ K E  + E  +    V      +  QSN
Sbjct: 216 IEEEQDDKASETTSVEKAAAGNGEGAQEPVALKNEGSVAEPTAVTTQVDVPEPAVTSQSN 275

Query: 221 V-----VDTEASQHES----------KGESLD-EEEEEEDTEQDAV-------------- 250
           V     + TE S+ E+          +G++ +  +EE+E +EQ +V              
Sbjct: 276 VPESAVLPTEESKSETSVVKEVNPTEEGQTEEVHDEEDEKSEQSSVEEHGEETSTPETSE 335

Query: 251 -------GPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNM 303
                   PIDPS  P  ++P         PK   T  I +L      S  +A+ G    
Sbjct: 336 AESVEDKAPIDPSKAP--KVP-----FKERPKKERT-GIFALWKSPTSS--SAQKG---- 381

Query: 304 TLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKY 363
             GV  P ++ VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY
Sbjct: 382 --GVTAP-SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKY 438

Query: 364 NTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGK 423
           +     Y ++L +LQ Q+D+IE   K    +  +KIE+ + +LVK ++DV + +N  K  
Sbjct: 439 DATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLM 498

Query: 424 VIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDE 483
           + K+TE MK QK+  K+++L KQ  VK+EI++LN+ K  +  E+N W  NL NL+  LD 
Sbjct: 499 IFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDA 558

Query: 484 KIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLP 541
           +I KI  IN    ++Q +I+ LQ KK +L   I   EE  KL++  +Q L +VE K+YLP
Sbjct: 559 QIFKINQINLKQSKVQNEIDALQKKKEDL---IAQTEENKKLHERNVQTLESVENKEYLP 615

Query: 542 RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQD 601
           ++N+ID Q++   +K+ II+ E  +E  +LS +TK+LE+ER AHE ++K++ E+ KR+++
Sbjct: 616 QINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEE 675

Query: 602 ELLQKKLTELQEK-------HNEEMAEIQKKY 626
            LL+K+  EL+E+       H +++ ++++ Y
Sbjct: 676 NLLEKQRQELEEQAHQAQLDHEQQITQVKQTY 707

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  227 bits (579), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 163/438 (37%), Positives = 253/438 (57%), Gaps = 49/438 (11%)

Query: 217 EQSNVVDTEASQHESKGESLDEEEEEEDTEQDAVG------------------PIDPSIV 258
           E+++VV T+    E KGE  D EEE E +  D  G                  PIDPS  
Sbjct: 314 EKTSVVKTDTVTKEGKGEVADVEEETEQSSADEHGEETSTPETSEAESDGDITPIDPSKA 373

Query: 259 PMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASP 318
           P  ++P         P+   T       S    S   AK GA+   L       + VA+P
Sbjct: 374 P--KVP-----FQERPQKERTGFFALWKSPTSSS---AKKGAATAPL-------NPVATP 416

Query: 319 ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ 378
           ENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K  EY++KL +LQ
Sbjct: 417 ENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQ 476

Query: 379 KQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 438
            Q+D+IE   K    +  QKIE+ + +LVK ++D+ +++N  K  + K+TE MK QK+  
Sbjct: 477 NQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEE 536

Query: 439 KEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 498
           K ++L KQ +VK+EI++LN+EK  +  E+N W  NL +L+  LD +I KI  IN    + 
Sbjct: 537 KNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKA 596

Query: 499 QKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 555
           Q +I+ L+ +K +L   I   EE  KL   N +VL+ +   K+YLP++N+ID QI+   +
Sbjct: 597 QNEIDNLEKQKKDL---ITQTEENKKLHEKNVEVLESVE-NKEYLPQINDIDTQISTLLN 652

Query: 556 KLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTELQEK- 614
           ++ II+ E  +E   LS +TKKLE+ER AHE ++K++ E+ KR+++ LL+K+  EL+E+ 
Sbjct: 653 QMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQA 712

Query: 615 ------HNEEMAEIQKKY 626
                 H E++ +++K Y
Sbjct: 713 HQAELEHEEQITQVKKTY 730

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 8/121 (6%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76
           FL + +S + +  E ++SPFR  QD +  N     Y    K +KFPT SATS ++K  P 
Sbjct: 36  FLQKVVSNEPKGKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQ 93

Query: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDK 136
           ++GY ++ K+ KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  L  D 
Sbjct: 94  DLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTGDA 153

Query: 137 N 137
           N
Sbjct: 154 N 154

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  220 bits (561), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 147/383 (38%), Positives = 237/383 (61%), Gaps = 29/383 (7%)

Query: 253 IDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPET 312
           IDPS  P  ++P         P       I +L      S        S      A P +
Sbjct: 354 IDPSKAP--KVP------FQEPSRKERTGIFALWKSPTSS--------STQKSKTAAP-S 396

Query: 313 HAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYED 372
           + VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E +KY+ K +EY++
Sbjct: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456

Query: 373 KLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMK 432
           KL +LQ Q+D+IE   K    +  +KIE+ + +LVK ++DV +++N  K  ++K+TE MK
Sbjct: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516

Query: 433 LQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAIN 492
            QK+  K ++L KQ +VK+EI+ LNNEK  +  E+N W  NL NL+  LD +I KI  IN
Sbjct: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576

Query: 493 ENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDEQI 550
               ++Q +I+ L+ KK +L   +   EE  KL++  +Q L +VE K+YLP++N+ID QI
Sbjct: 577 LKQGKVQNEIDNLEKKKEDL---VTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQI 633

Query: 551 AAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTE 610
           ++  +++ IIK E  +E  QLS +TK+LE+ER AHE ++K++ E+ KR+++ LL+K+  E
Sbjct: 634 SSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQE 693

Query: 611 LQEK-------HNEEMAEIQKKY 626
           L+E+       H +++ ++++ Y
Sbjct: 694 LEEQAHQAQLDHEQQITQVKQTY 716

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 78/126 (61%), Gaps = 5/126 (3%)

Query: 14  HPGQEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN---YAKSLKEKKFPTTSATSN 69
           H  + P Q FL + +S + +  E ++SPFR      R N   Y +  K +KFPT SATS 
Sbjct: 30  HQQESPYQ-FLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSA 88

Query: 70  FNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRV 129
           ++K  P ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++
Sbjct: 89  YSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKI 148

Query: 130 LVLDED 135
             L +D
Sbjct: 149 TDLTKD 154

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  219 bits (558), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 147/392 (37%), Positives = 245/392 (62%), Gaps = 26/392 (6%)

Query: 242 EEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGAS 301
           E ++E+D V PIDPS  P  ++P         P+       K+ I     S+ ++ A  S
Sbjct: 367 ESESEEDKV-PIDPSKAP--KVP-----FQERPRKG-----KTGIFALWKSSTSSSAQKS 413

Query: 302 NMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDE 361
           N     A P ++ VA+PE PE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  
Sbjct: 414 N----TAAP-SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKA 468

Query: 362 KYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDK 421
           KY+ K +EYE+KL +LQ Q+D++E+  K    +  +KIE+ + +LVK ++DV + +N  K
Sbjct: 469 KYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKK 528

Query: 422 GKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLL 481
             + K+TE MK QK+  K  +L KQ +VK++I++LN+EK  +  ++N W  NL NL+  L
Sbjct: 529 LMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQL 588

Query: 482 DEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLP 541
           D +I KI  IN    ++Q +I+ L+ KK  L  + +++E+  + N  VL+ +   ++YLP
Sbjct: 589 DAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREYLP 647

Query: 542 RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQD 601
           ++N+ID QI+   +++ IIK E  +E  QLS +TK+LE+ER AHE ++K++ E+ KR+++
Sbjct: 648 QINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEE 707

Query: 602 ELLQKKLTELQEK-------HNEEMAEIQKKY 626
            LL+K+  EL+E+       H E++ +++K Y
Sbjct: 708 NLLEKQRQELEEQARQAQLDHEEQITQVKKTY 739

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 9/120 (7%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN------YAKSLKEKKFPTTSATSNFNKMVP 75
           FL + +S + +  E +ISPFR  QD + S       Y +  K +KFPT SATS ++K  P
Sbjct: 38  FLQKVVSNEPKGKEEWISPFR--QDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQP 95

Query: 76  GEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDED 135
            ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  L +D
Sbjct: 96  KDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTKD 155

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  186 bits (472), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 220/383 (57%), Gaps = 34/383 (8%)

Query: 236 LDEEEEEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKT 295
           L + EEE  T      PIDP++ PMV                      SL +  + S K 
Sbjct: 219 LVQSEEEIHTPNVVEPPIDPALAPMVPF--------------------SLATPNQKSKKE 258

Query: 296 AKAGASNMTLGVAVPE--THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLK 353
            +A           PE  ++ VASP N E +V+T ++  +SKAVYD++ Y+++ H +WL 
Sbjct: 259 TEA-----------PEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLA 307

Query: 354 NFNAAEDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDV 413
           ++   ++EKY  K QEY+  L ++  Q+ ++ +  +   +  ++KI++M  QLVK V D 
Sbjct: 308 DYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDK 367

Query: 414 QSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGN 473
           +     DK K+  ET+ +KL+K++ KE++L    +VK  I++L NEK  + +EY+ W  N
Sbjct: 368 KGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTN 427

Query: 474 LENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL 533
           + N+ + LD K+ KI  IN   M +Q  I+ L  +K NL++EI  ++     N  +++ +
Sbjct: 428 MTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESV 487

Query: 534 NVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKN 593
           +  K+YLP+LN+ID +I    +++ I+K E  +E  QL+ +TKKLE+ER AHE +++++ 
Sbjct: 488 D-NKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEA 546

Query: 594 EKMKREQDELLQKKLTELQEKHN 616
           E+ KR+++ LL K+  EL+ K N
Sbjct: 547 EERKRQEENLLGKQRDELEAKAN 569

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 20/128 (15%)

Query: 22  TFLTRHISRKSENTE-----------------YISPFRNPQDTVRSNYAKSLKEKKFPTT 64
           +FL R +S  S  T+                 Y SPFR     V     ++ K ++FPT 
Sbjct: 41  SFLQRVVSTTSSTTQKQPKKKIAASEAKAMSDYASPFRAEYSNVN---VQNEKTRRFPTV 97

Query: 65  SATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQ 124
           SATSN+    P + G++++ K    AKDI FP YL +NE+RQ   L+ L+ KE  L  LQ
Sbjct: 98  SATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQ 157

Query: 125 KSSRVLVL 132
            S  ++ L
Sbjct: 158 DSQNIIDL 165

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  179 bits (454), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 203/320 (63%), Gaps = 9/320 (2%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           +A+P++PEY+VRT++   +SKA+YD++ Y++++H   L  FN  + +KY+  ++EY DKL
Sbjct: 351 LATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKL 409

Query: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             LQ Q+D+++   +   +  ++KI++ E +L K +LD+ + +   K  + KETE +K Q
Sbjct: 410 TLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQ 469

Query: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           KI  ++++ AK  +VK EIE+LN  K+ +  E+N +   L++LT  LD K+ KI+ +N+ 
Sbjct: 470 KIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDK 529

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
            M I   I  L  KKL +E E +D EE  K +  +L+ +   K+YLP++N ID Q+A   
Sbjct: 530 QMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLL 588

Query: 555 DKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTELQE- 613
             L +IK E  ++  + + +TK+LEEER AHE +++ + E+ KR ++E LQK+  EL+  
Sbjct: 589 GSLTLIKQENANQKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAK 648

Query: 614 ------KHNEEMAEIQKKYQ 627
                 KH EE+ +I+++++
Sbjct: 649 AEDARLKHEEELRQIKEEHE 668

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  172 bits (436), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 135/365 (36%), Positives = 217/365 (59%), Gaps = 35/365 (9%)

Query: 287 SGAKGSN---KTAKAGASNMTLGVAVPET----HAVASPENPEYLVRTNEYNIVSKAVYD 339
           SG K S+   +   AG   +T    +P+       +A+PENPE + +T EY  +SK +YD
Sbjct: 384 SGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYD 443

Query: 340 QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQ-- 397
           ++ Y++  H  WLK F  +E  KY+ K +EY ++L ELQK++D I E   + N+KK+   
Sbjct: 444 KVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINE--SMENLKKETAD 501

Query: 398 KIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLN 457
           KIE+ E  LVK + +  + +N  K K+ KETE +K QKI  K+++L K   V++EI +LN
Sbjct: 502 KIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLN 561

Query: 458 NEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI- 516
           + K+ +  E++ W  N+  L   LD KI K+  I       QK+IE L+ +K   + +I 
Sbjct: 562 DRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQID 621

Query: 517 ---KDHEEKDKLNKDVLQKLNVE----KDYLPRLNEIDEQIAAKFDKLAIIKNETISENN 569
              K+HEE  K+         VE    K+YLP+++ ID QI+   ++LAIIK E  +E  
Sbjct: 622 AAKKEHEEGQKV---------VESYENKEYLPKIHTIDNQISELLNELAIIKQENANEQT 672

Query: 570 QLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTELQEK-------HNEEMAEI 622
           +LS +TK+LEEER AHE ++K++ E+ +R++  LL+K+  EL+EK       H E++ ++
Sbjct: 673 ELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEEQVRKM 732

Query: 623 QKKYQ 627
           +++Y+
Sbjct: 733 KEQYE 737

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  169 bits (429), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/322 (33%), Positives = 195/322 (60%), Gaps = 8/322 (2%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           +A+PENPE LV+T+    +SKAVYD++ YE   HSEWL  F ++E ++Y  K+ +Y+++L
Sbjct: 489 LATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRL 548

Query: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
            EL+K+++ +EE  +       + IEI   +L K  L+   +Y   K  +  ET+ ++ Q
Sbjct: 549 EELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQ 608

Query: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           K    +++  +Q +V+ EI  LN EK+ I  E+  W   L + +  LD K+  +  + + 
Sbjct: 609 KDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQK 668

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
           + + Q  I+ L  KK  LE E+  H+E    N   ++K +  K+YLP+++EID++I+   
Sbjct: 669 HTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK-HANKEYLPKVHEIDDKISNLL 727

Query: 555 DKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTE---- 610
            +L++IK E+ +E  +L  +TKKLE ER AHE ++K++ E+ +R++ +LL K+  E    
Sbjct: 728 GELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAV 787

Query: 611 ---LQEKHNEEMAEIQKKYQEK 629
              L+++H EE+ ++++ Y+++
Sbjct: 788 AAGLKKQHEEELRKMKQDYEKR 809

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 82/158 (51%), Gaps = 39/158 (24%)

Query: 2   SKRKDTFTVL--EDHPGQEPQQ-TFLTRHISRKSEN------------------------ 34
           SKR D FT L  E H  ++ ++ TFLT+ ++    N                        
Sbjct: 4   SKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRASARK 63

Query: 35  ---TEYISPFR---NPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDK 88
               E+ SPFR   N +D      A+  + ++FPT S  S F+K+ P E+GY ++ +  +
Sbjct: 64  SHLGEFASPFRLESNEKD------AEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSR 117

Query: 89  RAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKS 126
           RAKDIQFP YL +NE RQ QLL E++I+E KL  ++ S
Sbjct: 118 RAKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNS 155

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  167 bits (424), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 165/617 (26%), Positives = 292/617 (47%), Gaps = 65/617 (10%)

Query: 36  EYISPFRNPQDTVRSNYAKSL-KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 94
           EY+SPFR  Q T  S     L + KKFPT SATS +N     E+G+S +  + +RA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 95  FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNELVLEESSSSDEEEESE 154
           FP+YLL+NE RQ  +L +L+ +E  L  LQ+            + VL+ +    +EE+ +
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRC-----------QSVLDRTCKPAKEEKRK 155

Query: 155 E--------DDDDGDEGEDEDGDESVEEEKYVEEEEDNNAEENISEKIESIIG--ELDSQ 204
           E         D       D D    V+  +  E++E + ++  + E I    G    ++ 
Sbjct: 156 ELKAIEPVKRDTTNRFAIDYDFVPPVDPTQE-EKDEIDVSDPIVREYIRDARGIPRAEAN 214

Query: 205 NENVSKNAEILEEQSNVVDTEASQHESKGESLDEEEEEEDTEQDAVGPIDPSIVPMVRIP 264
             + S +A   +   +V++ E +Q       +D ++     E +   P+DP+  P + + 
Sbjct: 215 GGDASGDASGYDYDRDVLNIEQNQ------LVDAQQMALQNEIEWRKPVDPATQPKLYVD 268

Query: 265 PICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYL 324
                L+    T    S K  +                    +  P T+  A+ + PE L
Sbjct: 269 LDSLQLIDPGSTAVGVSTKQRL--------------------MDTPVTNPQATEDTPELL 308

Query: 325 VRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDI 384
           ++  +Y  VS AV++++ Y+ K+H   + ++   ++ K+  K QEYE KL ++  +   +
Sbjct: 309 LKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSV 368

Query: 385 EEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLA 444
             K   + + K  K E++E Q +K + D  + +N  K KV+ E +L+KLQK+   + +  
Sbjct: 369 LAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKLQDLKFISQ 428

Query: 445 KQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEV 504
           K+  +++E+ +L  EK     +Y++W  NL N+T  LD ++ K+   N    +I + I  
Sbjct: 429 KKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRD 488

Query: 505 LQVKKLNLENEIKDHEEKDKLNKDV-LQKLNVEKDYLPR-LNEIDEQIAAKFDKLAIIKN 562
           L  +K  LE EI D  +  K N D  L  L   +      L ++ + I  K D LA++K 
Sbjct: 489 LTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQ 547

Query: 563 ETISENNQLSILTKKLEEERIAHENEIKMKNEKMKR----------EQDELLQKKLTELQ 612
           E   E  +L  +T ++E  R   E   ++ NEK+            E+D  L ++L +L 
Sbjct: 548 EISGERLKLIGITNEMERARAERE---RIWNEKLDSNTKFYEDKLGEKDADLDERLKQLD 604

Query: 613 EKHNEEMAEIQKKYQEK 629
            +H   + ++++ Y+ K
Sbjct: 605 VEHTANLVQVREIYEAK 621

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  159 bits (403), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 222/396 (56%), Gaps = 54/396 (13%)

Query: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311
           PIDP + PMV         LS P  N               NK  K           VPE
Sbjct: 190 PIDPKLTPMVSFQ------LSTPPVN---------------NKNKKTQV--------VPE 220

Query: 312 -----THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTK 366
                 +  A+P + E +V+T ++ I+SK++YDQ+ Y+Q+ H ++L ++ A   EKY+ K
Sbjct: 221 EEEKERNPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVK 280

Query: 367 KQEYEDKLVELQKQL----DDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKG 422
            QEYE++L  L +++    + IE+ KK ++     K++IM  +LVK + D +S    DK 
Sbjct: 281 MQEYENELKSLDEKIVASNELIEQCKKDTDA----KLDIMNAELVKRMFDERSVQTDDKM 336

Query: 423 KVIKETELMKLQKINAKEDLLAKQLD--VKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480
           K+  ET+L+K +KI+  E +  ++LD  V  EI++LN EKE + +E+N W  N+ N+   
Sbjct: 337 KIFSETKLIKREKID--EKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQ 394

Query: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540
           LD K+ KI+ IN   M +Q  I+ L  +KL L  EI+ ++     N + ++ ++  K YL
Sbjct: 395 LDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYL 453

Query: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600
           P+LN ID QI    ++L +IK E  +E  QLS LT+KLE+ER+ HE ++K+  E+ KR++
Sbjct: 454 PKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQE 513

Query: 601 DELLQKKLTELQEK-------HNEEMAEIQKKYQEK 629
           + LL K+  EL++K       H  EM  ++  Y+++
Sbjct: 514 ENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQ 549

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95
           EY+SPFR+   T    Y ++ K K+FPT SATSN+      EMG+  + K+   AKDI F
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126

Query: 96  PKYLLDNEKRQ 106
           P YL  NE+RQ
Sbjct: 127 PSYLTQNEQRQ 137

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  156 bits (394), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 192/317 (60%), Gaps = 13/317 (4%)

Query: 319 ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ 378
           ENPE++V+T +   ++K +YD++  + + H+EW+  +   E +K++ K+ E   K+  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 379 KQLDDIEEKKKISNMKKQ--QKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKI 436
            Q+ +I  K +++ ++     KIE+ E +L +   ++   +   K +V K+TE++K QK+
Sbjct: 405 AQIKEI--KNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKL 462

Query: 437 NAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNM 496
           + K+ +L KQ +V+ EI++LN EKE +  E   W  ++E L+  +D K+A +E +N    
Sbjct: 463 SEKDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQK 522

Query: 497 RIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDK 556
             Q++I  LQ +K+++ ++I+ +      N+ V++     K YLP+LNE+D QI+    +
Sbjct: 523 NTQEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQISVLLGQ 581

Query: 557 LAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTEL----- 611
           L  I+    +E  +LS +TKKL++ER+ HE ++K++ E  +R++++LL K+  EL     
Sbjct: 582 LTTIRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQ 641

Query: 612 --QEKHNEEMAEIQKKY 626
             +EKH +EM +++  Y
Sbjct: 642 EAREKHEQEMQKLKTDY 658

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  149 bits (377), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 180/321 (56%), Gaps = 9/321 (2%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           VASP +PE++V+ ++   +SKA+YD + YE+ +H   + ++    D KY  K  EYED+L
Sbjct: 377 VASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435

Query: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             L+ Q+ ++E   +       +KIEI E +L   ++D+ ++++  K  + KETE MK  
Sbjct: 436 TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAA 495

Query: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           K+  KE + AKQ DVK E+E+L   +  I  E     G ++ LT  LD K+A I+ +N  
Sbjct: 496 KVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
              +Q  I+ LQ +K  L +E    +E+   N  VL+ +   K+YLP+LN ID +I+   
Sbjct: 556 QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEYLPKLNAIDTKISELL 614

Query: 555 DKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTE---- 610
             L ++K ET +   + + ++K+LEEE    + +++ + E  KR + E LQK+  E    
Sbjct: 615 TSLTVVKQETANHKTEFAAVSKRLEEEDEERKEKLRQEEENRKRLEAERLQKQREEHDQQ 674

Query: 611 ---LQEKHNEEMAEIQKKYQE 628
              LQ++H  ++AE  +K  E
Sbjct: 675 ILLLQQEHERQLAEASQKAAE 695

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 5/108 (4%)

Query: 23  FLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSS 82
           FL + +S++ E + Y SPFR  Q       A+  K +KFPT SA+ + +     +MGY  
Sbjct: 27  FLHKVVSKEQEQSAYNSPFRTSQSLA---AAQKRKMQKFPTVSASVSAHSSS--DMGYKV 81

Query: 83  LAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           +    +RAKDI  P+YL  N++RQ + L +L+ KE  L   + S R++
Sbjct: 82  IDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/343 (30%), Positives = 188/343 (54%), Gaps = 28/343 (8%)

Query: 264 PPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAG-----------------ASNMTLG 306
           PP   D+ SAP+   T S  +    A  ++  A +G                 A+N   G
Sbjct: 378 PP--PDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAG 435

Query: 307 VAVPETHA-VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNT 365
             VP   A VA+PE+PE +VRT E   VSK+VYD++ Y++  H   L  ++  +DE+Y T
Sbjct: 436 TVVPGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYET 494

Query: 366 KKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVI 425
           K QEYE+K+  +Q ++ +++ + +   ++ ++K+++ + +  + +L+   K+   KG + 
Sbjct: 495 KAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLY 554

Query: 426 KETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKI 485
           K+TE +K Q I+ KED       V++EI++L   K+ +  E       +E LT  LD K 
Sbjct: 555 KQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKT 614

Query: 486 AKIEAINENNMR---IQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPR 542
           +   A+NE+  +      +I+ L+ +K  LE EIK+ +E  + N   ++ ++  K+YLP+
Sbjct: 615 S---ALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID-NKEYLPK 670

Query: 543 LNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           +NEI+ +I++    L +I+ E  ++  + S +T++LEEER  H
Sbjct: 671 VNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQH 713

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 22/144 (15%)

Query: 6   DTFTVL---EDHPGQEPQQTFLT------RHISRKSE-------NTEYISPFRNPQDTVR 49
           D F  L    DH  ++ QQ  LT      + ++ K +       + EY SPFR  ++T R
Sbjct: 14  DPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSPFRTAEETQR 73

Query: 50  SNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLA-KNDKRAKDIQFPKYLLDNEKRQAQ 108
              A+ ++++KFPT S      ++ P +MGYS +  K+ K+AKDI  P  L D E  Q  
Sbjct: 74  ---ARQVRQEKFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKV 128

Query: 109 LLMELQIKEHKLHELQKSSRVLVL 132
            L  L+ KE +L   +KS +++ L
Sbjct: 129 RLTALEKKEKQLRYWRKSQKIVDL 152

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  134 bits (338), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 181/323 (56%), Gaps = 19/323 (5%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           VASP++PE++V+ ++   +SKA+YD + YE+ +H + +  +     +KY+ K QEYED L
Sbjct: 349 VASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407

Query: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             L+ Q+ ++E   +   +    KI I   +L   +++  +K++  K  + KETE  K  
Sbjct: 408 TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467

Query: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWN----GNLENLTTLLDEKIAKIEA 490
           KI+ K  ++AKQ +VK E    N E EA   E +  N      ++ LTT LD K + I+ 
Sbjct: 468 KIDEKAAVVAKQDEVKAE----NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQE 523

Query: 491 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQI 550
           +N+    IQ  I+ L+ +K  L  +    +E    N  +L+ ++  KDYLP++N +D QI
Sbjct: 524 LNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGIS-NKDYLPKINALDSQI 582

Query: 551 AAKFDKLAIIKNETISENNQLSILT--------KKLEEERIAHENEIKMKNEKMKREQDE 602
           +     LA++K ET +++ + + ++        ++ E+ R+  EN  +++ E+ ++++DE
Sbjct: 583 SQLLSSLALVKQETANQHTEFAAVSKRLEEENEERKEKLRLEEENRKRLEAERFQKQRDE 642

Query: 603 LLQKKLTELQEKHNEEMAEIQKK 625
             Q  LT LQ++H  ++AE  +K
Sbjct: 643 HDQHVLT-LQQEHERQLAEASQK 664

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  125 bits (315), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 164/615 (26%), Positives = 288/615 (46%), Gaps = 110/615 (17%)

Query: 23  FLTRHISRKSENTE----YISPFRNPQDTV-RSNYAKSLKEKKFPTTSATSNFNKMVPGE 77
           FL++  + KS+  +    Y SPFRN   +  +    + LK  KFP  SATS +N     +
Sbjct: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN--TDTK 90

Query: 78  MGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKN 137
             Y  L      A+DI+FP  L+DNE RQ Q+L++L+IK+  L  L+ S +V+ +     
Sbjct: 91  DVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV----- 145

Query: 138 ELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEEEEDNNAEENISEKIESI 197
                E    D++E+ EE+ D     E    +E++ ++  +++  D N++   + K +  
Sbjct: 146 -----EDLPRDDKEKGEEEKDSDPVPEQPSNNENITDKDALQDAYDLNSKA--ATKTDPD 198

Query: 198 IGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEEEEEDTEQDAVGPIDPSI 257
           I         VS N  +L  ++N++D +    E+K                         
Sbjct: 199 I---------VSHNYSVL-NKNNLIDAKDMSIENK------------------------- 223

Query: 258 VPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVAS 317
             +  + PI       PK  +T   K                       VA P       
Sbjct: 224 --LFYLKPIHRK--DYPKVQSTTESK---------------------FPVASP------- 251

Query: 318 PENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVEL 377
            EN E +V+      +SK VYD++ ++ K++ +++  +   +  K N  K EY +K+  +
Sbjct: 252 -ENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSI 310

Query: 378 Q----KQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKL 433
           Q    K L++IE      N++     E+++ +LVKN++D  + ++ +K K++++T  +KL
Sbjct: 311 QLEKFKTLNEIEN----LNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 434 QKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINE 493
           QK+N  + L  K+  ++ E   +N EK++    +N  N +L  +   LD K+ K+   N 
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 494 NNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAK 553
            N  ++ +I  LQ KK  L +EI D  E  KL+ D       +      LNE+DEQI +K
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEI-DSIEYKKLHPD-------DDSKQLELNEMDEQINSK 478

Query: 554 FDKLAIIKNETISENNQLSILTKKLEEERIAHENE-IKMKNEKMKREQDELLQKKLTELQ 612
              L +IK E I+E  ++S LT  L  + I ++NE +++ +E  K      L  K+  +Q
Sbjct: 479 LSNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTK------LNDKIHNMQ 532

Query: 613 EKHNEEMAEIQKKYQ 627
           E H  E+  + ++++
Sbjct: 533 ELHKNELKNLTERHE 547

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 145/276 (52%), Gaps = 6/276 (2%)

Query: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375
           A+PE+PE++V T E   +SK +YD++ YE++LH E L + +     KY    + YE+KL 
Sbjct: 323 ATPEDPEFIVLT-EKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 376 ELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQK 435
            L  ++ ++         + + +++ +E  L +N++D+Q+K++  K  ++KE E  K  K
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 436 INAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 495
           I  K  +  K   V+ E+E L   +     E   +   ++ LT  LD ++ +++ +++  
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 496 MRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 555
             +   +  L+ +++ +E +I +       NK++LQ L    +  P +  +D Q++    
Sbjct: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL----ENHPSIAALDNQVSEVTR 557

Query: 556 KLAIIKNETISENNQLSILTKKLEEERIAHENEIKM 591
            ++ ++ E  ++ ++L+ L+ K +E  ++  N  KM
Sbjct: 558 TVSAVEQEHAAQKDELTELSTK-KEPTLSAVNPPKM 592

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 21  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 80
           QT +  H +   +  +Y SPFR+ Q     N A   K  ++PT SATS ++ M P ++GY
Sbjct: 41  QTAINSH-TLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGY 99

Query: 81  SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
            ++  + KRAKDI FP  L++NE RQ +L  +L  KE +L  LQKS +++
Sbjct: 100 KNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 100/187 (53%), Gaps = 18/187 (9%)

Query: 316 ASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371
           A+P+NPE LV+T  YN    I+SK+VYD +NY  K+H++ +K++    + KY  K +E+ 
Sbjct: 379 ATPKNPELLVKT-RYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFN 437

Query: 372 DKLVELQKQLDDIEEKKKISNMKKQQKIE-IMEYQLVKNVLDVQS---KYNVDKGKVIKE 427
           + + EL  ++  IE  K I + K   KI+ +M   + KN +D+++   K  + K ++IK+
Sbjct: 438 NSINELDLKIKSIE--KDIIDYK--AKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKK 493

Query: 428 TELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAK 487
            + +    + +     A  LD K+ + K ++    I +    W      L   +D K+  
Sbjct: 494 NDEITYI-LQSSPPTAAISLDTKDAVTKQSDCTPLIKD----WKSEQSKLNEQIDSKVNV 548

Query: 488 IEAINEN 494
           I+ +N+N
Sbjct: 549 IKQLNKN 555

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 128/249 (51%), Gaps = 4/249 (1%)

Query: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375
            +PE PE ++ TN    +SKAVYD++N E+K H   L N +    + Y    Q YE ++ 
Sbjct: 281 GTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIA 339

Query: 376 ELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKE-TELMKLQ 434
           +L  ++  +         + + +I+ +E  L KN+ D++++ N DK  V+ E  E  + +
Sbjct: 340 DLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHEQAEAQRAE 398

Query: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           ++  KE+++ +  +++ EI++L   KE    E       ++ L   LD +  ++  + + 
Sbjct: 399 QLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
              +   +  LQ +K  LE E+ D  E  K N++ L++LN + DY   + EID + +   
Sbjct: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEIL 517

Query: 555 DKLAIIKNE 563
            ++A I+ E
Sbjct: 518 TEIAKIRQE 526

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 19/139 (13%)

Query: 28  ISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKND 87
           ++  + + EY SPFR   D +    A      KFPTT              G     +  
Sbjct: 47  VTGDASHDEYYSPFR---DAIAVEEAHGSGTLKFPTT--------------GTHVTEEAR 89

Query: 88  KRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNELVLEESSSS 147
           +R  DI  PK L   ++RQ Q L EL++KE +L  L K S+ +V    K++ V +  ++ 
Sbjct: 90  RRVPDIDEPKRLSTVDERQRQQLQELELKEGQLR-LYKESQKIVDVRGKSD-VTQRRAAQ 147

Query: 148 DEEEESEEDDDDGDEGEDE 166
           +  + S    D G  G+D+
Sbjct: 148 NTSKTSTTTGDKGALGDDD 166

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 6/123 (4%)

Query: 16  GQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVP 75
            + P + FL   I+    + +Y SPFR   +    NY +  K  K+  T+  S+FNK+  
Sbjct: 21  AKNPHRNFLKDTIA---HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNL 77

Query: 76  GEMGYSSLA---KNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132
             +GY ++    K+ K AKDI FP+ L +NE+ Q   L EL+ KE+ L  L+ S  ++ +
Sbjct: 78  NTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137

Query: 133 DED 135
           DED
Sbjct: 138 DED 140

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 67/126 (53%), Gaps = 4/126 (3%)

Query: 314 AVASPENPEYLV----RTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369
           ++A+P+N E ++    +       SK V+D + YE K+H + LK  NA  DE++ +K  E
Sbjct: 184 SLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINE 243

Query: 370 YEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429
           Y+ ++  L  ++D   EK +  N K     +  +++  KN L   ++YN  K ++  E E
Sbjct: 244 YDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIE 303

Query: 430 LMKLQK 435
            +K Q+
Sbjct: 304 AIKNQR 309

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 23/111 (20%)

Query: 306 GVAVPET-HAVASPENPEYLVRT--NEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEK 362
           G+  P   + +A+P+NPE LV+   N+  IVSK  YD++   Q  H  WLK++NA     
Sbjct: 171 GMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMAN 230

Query: 363 YNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDV 413
           YN + Q Y       QKQ+D ++EK             I  YQ + NVL+ 
Sbjct: 231 YNQRHQWY-------QKQIDVLDEK-------------IRYYQEMSNVLEA 261

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 21/102 (20%)

Query: 32  SENTEYISPFRNP--QDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKR 89
           + N  ++S FR P   +   +NY   +K+++ P                   SL K + R
Sbjct: 52  TPNARFVSTFREPLMNNRYYANYLYHMKQQRHP-------------------SLRKYESR 92

Query: 90  AKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLV 131
             +I  P++L   E++Q   L  LQ+KE  L  L+ S R++ 
Sbjct: 93  NPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIIT 134

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 57  KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIK 116
           K K  P ++  S++N + P E+GY       K A++I FP  L +NE RQ  +L +L  K
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAILQDLDEK 67

Query: 117 EHKLHELQKSSRVLVLD 133
           E  L  L+KS RV+ +D
Sbjct: 68  EQHLDHLKKSQRVVYID 84

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 315 VASPENPEYLVRTNEYNIVSKA----VYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370
           VA+PE PE +V     N  +KA    ++D +  +   H+ WL +     +++  TK +EY
Sbjct: 122 VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181

Query: 371 EDKLVELQKQLDDIEEKKKISNMKKQQK--IEIMEYQLVKNVLDVQSKYNVDKGKVIKET 428
             +L  L  Q+    EK  ++N++++Q+  I++ E +L K  L    ++  +K K+ KET
Sbjct: 182 NKQLAVLDDQIKS--EKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKET 239

Query: 429 ELMKL 433
           E +  
Sbjct: 240 ERLNF 244

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 310 PETHAVASPENPEYLVRTNE-YNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 368
           P+ + +A+  NPE L++ N+   I++K  YD++    + H+ W+ N N      YNTK +
Sbjct: 380 PQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439

Query: 369 EYEDKLVELQKQLD 382
            Y++KL +L +Q++
Sbjct: 440 TYQEKLNKLNEQIN 453

>Smik_7.56 Chr7 (93864..96971) [3108 bp, 1035 aa] {ON} YGL207W (REAL)
          Length = 1035

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 140  VLEESSSSDEEEESEEDDD-DGDEGEDEDGDESVEEEKYVEEE 181
            V +ES+ S++EE SE DDD  GDE ED  GDES E E + E E
Sbjct: 979  VSDESAFSEDEEGSEVDDDISGDESEDYSGDESEEGEDWDELE 1021

>YGL207W Chr7 (98969..102076) [3108 bp, 1035 aa] {ON}  SPT16Subunit of
            the heterodimeric FACT complex (Spt16p-Pob3p), which
            associates with chromatin via interaction with Nhp6Ap and
            Nhp6Bp, and reorganizes nucleosomes to facilitate access
            to DNA by RNA and DNA polymerases
          Length = 1035

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 140  VLEESSSSDEEEESEEDDD-DGDEGEDEDGDESVEEEKYVEEE 181
            V +ES+ S++EE SE DDD  GDE ED  GDES E E + E E
Sbjct: 979  VSDESAFSEDEEGSEVDDDISGDESEDYTGDESEEGEDWDELE 1021

>Suva_7.54 Chr7 (95556..98666) [3111 bp, 1036 aa] {ON} YGL207W (REAL)
          Length = 1036

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 140  VLEESSSSDEEEESEEDDD-DGDEGEDEDGDESVEEEKYVEEE 181
            V +ES+ S+EEE SE DDD  G E ED  GDES E E + E E
Sbjct: 980  VSDESAFSEEEEGSEVDDDISGGESEDYSGDESEEGEDWDELE 1022

>Skud_7.61 Chr7 (104429..107536) [3108 bp, 1035 aa] {ON} YGL207W
            (REAL)
          Length = 1035

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 140  VLEESSSSDEEEESEEDDD-DGDEGEDEDGDESVEEEKYVEEEED 183
            V +ES+ S++EE SE  DD  GDE ED  GDES E E + E E++
Sbjct: 979  VSDESAFSEDEEGSEVGDDISGDESEDYSGDESEEGEDWDELEKN 1023

>ZYRO0A08888g Chr1 complement(707590..711390) [3801 bp, 1266 aa]
           {ON} similar to uniprot|Q04217 Saccharomyces cerevisiae
           YMR128W ECM16 Essential DEAH-box ATP-dependent RNA
           helicase specific to the U3 snoRNP predominantly
           nucleolar in distribution required for 18S rRNA
           synthesis
          Length = 1266

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 111/275 (40%), Gaps = 47/275 (17%)

Query: 115 IKEHKLHELQKSSRVLVLDEDKNELVLEE-----SSSSDEEEESEEDDDDGDEGEDEDGD 169
           + +HK  + +   R LV  E+K +  +E+     SS SD E++S E +D GDE    D +
Sbjct: 228 VHKHKAPKKKYHWRTLVEMEEKRKHGIEDEMDFASSGSDSEDKSSE-EDSGDEDSGADDE 286

Query: 170 ESVEEEKYVEEEEDNNAEENISEKIESIIG--------------ELDSQNENVS------ 209
           E V+E   V++EE  NAE + S +                    EL ++ +  +      
Sbjct: 287 EEVQEHAEVDKEE--NAEVSDSSEEHQEESSDGESESSEPVNPEELAAERQTTADTFKEW 344

Query: 210 KNAEILEEQSNVVDTEASQHESKGESLDEEEEEEDTEQDAVGPIDPS------IVPMVRI 263
            N +I E     VD E    + K E +  EE+ +D       PID S       VP+ R 
Sbjct: 345 ANEQIREMDGGNVDVEMPSLDFKYEPIVREEDLDDGLGSEDVPIDESSKRKAFYVPVTRP 404

Query: 264 PPICTDLLSAPKTNATFSIK--------SLISGAKGSNKTAKAGASNMTLGVAVPETHAV 315
             I    +  P       I          ++ G  GS KT +        G   PE    
Sbjct: 405 EEIQAVRMQLPVFGEEHKIMEAIHHNDVVIVCGETGSGKTTQVPQFMYESGFGSPE---- 460

Query: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSE 350
            SP++P  +  T    + + A+ ++++ E   HS+
Sbjct: 461 -SPDHPGMIGVTQPRRVATVAMANRISNELGDHSD 494

>KNAG0B05750 Chr2 (1133580..1136123) [2544 bp, 847 aa] {ON}
           Anc_4.185 YLR352W
          Length = 847

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 17/99 (17%)

Query: 372 DKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 431
           DKL+E    ++DI     +  +K+ QK++ +               NV     + +  + 
Sbjct: 412 DKLIEFLSPIEDIAYYDNLKGLKEFQKLKFL---------------NVANNSYVNQWTIQ 456

Query: 432 KLQKINAKEDLLAKQL--DVKNEIEKLNNEKEAITNEYN 468
               +     L + +L  D   +IEKLN+  E IT +YN
Sbjct: 457 NPNLLTCSPSLCSLELGFDAWQQIEKLNSNHEFITVKYN 495

>TBLA0G01580 Chr7 (417358..417394,417473..418263) [828 bp, 275 aa]
           {ON} Anc_6.268 YPL241C
          Length = 275

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF-PKYLLDNEKRQAQLLMELQIKEH- 118
           + T    SN++K   G + +S++ K+   ++DI F    +  N+ ++  +L+EL  K   
Sbjct: 134 YCTIMVDSNYSKKPTGSITFSNIKKSIIYSRDILFESGSIFFNDCKECIILLELSSKNRT 193

Query: 119 --KLHELQKSSRVLVLDEDKNELVLEESSSSDEEEESE 154
             +LH L    ++     DK  +++E+  +     ++E
Sbjct: 194 QLRLHNLI-GCKIYFKSNDKQTIIIEDCKNCVFHNDTE 230

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
           or uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 318 PENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVEL 377
           PE P  + R      VS AV  Q       +S + K+FN    +   TK +  +D L  L
Sbjct: 220 PERPVQMQRA-----VSLAVLPQSISNHSNNSPFKKDFNFRGTQS-GTKFRHNKDILEGL 273

Query: 378 QKQLDDIEEKKKISNMKKQQKIEIM 402
           +K LDD  EKK +SN  K  K+ ++
Sbjct: 274 RKLLDDTLEKKSMSNASKLHKLSLL 298

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256W HAP1
          Length = 1244

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 57/135 (42%), Gaps = 15/135 (11%)

Query: 291 GSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSE 350
           GSN  +     N T G A P   AVAS E  ++  R   Y IVS  V   ++        
Sbjct: 581 GSNPMSNNNGVNAT-GSARPHKDAVASTEKFKHTWRKTWYYIVSLDVQQSLSLGTP---R 636

Query: 351 WLKNFNAAEDEKYNT-KKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKN 409
            L+N N   D K  T  K +Y          + DI+E   + N     +I++    ++ +
Sbjct: 637 LLRNLNDFSDTKLPTASKLDY----------VSDIKELVIVKNTTLFFQIDLCIIAVLNH 686

Query: 410 VLDVQSKYNVDKGKV 424
           VL+V    NV K ++
Sbjct: 687 VLNVSVARNVKKSQL 701

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1779

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 431 MKLQKINAKEDLLAKQLDV-KNEIEKLNNEKEAITNEYNIWNGNL--------------E 475
           ++L+KIN   + L K+ D  ++E  KL +EK   + E N+    L              +
Sbjct: 80  LQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQ 139

Query: 476 NLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNV 535
           ++  LL+EKI  +EA  +   ++ ++ + L+ + L LENE++  +  D   K  +Q+L  
Sbjct: 140 DVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQ 199

Query: 536 EKDYLPRLNE-IDEQIAAKFDKLAIIKNETISE 567
           E + L   N+ +++++A+K ++    +    SE
Sbjct: 200 EMNLLKSNNQWLEKELASKSEEFGSYRQRVNSE 232

>Suva_13.118 Chr13 (188941..190953) [2013 bp, 670 aa] {ON} YML042W
           (REAL)
          Length = 670

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 17/120 (14%)

Query: 43  NPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKND--KRAKDIQF----- 95
           NPQD   +N   S+ E  F T +    F K+V  +     L++N+  K+   + F     
Sbjct: 226 NPQDNQDTNIFYSIYENNFITVAYKGRFYKLVTHDGDKKPLSENEIWKQLYSVVFQGSQP 285

Query: 96  -PKY--------LLDNEKRQAQL-LMELQIKEHKLHELQKSSRVLVLDEDKNELVLEESS 145
            PK         L  ++ R+  L L++  I +  L  + KSS +L LD D++ + LEE S
Sbjct: 286 EPKLKGIGSLTSLPRDQWREVHLELVKDPISQDSLETIHKSSFMLCLDLDQSPVTLEEKS 345

>KLLA0A03938g Chr1 (351240..352502) [1263 bp, 420 aa] {ON} some
           similarities with uniprot|P39734 Saccharomyces
           cerevisiae YAL028W FRT2 Tail-anchored endoplasmic
           reticulum membrane protein
          Length = 420

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 423 KVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNE--YNIWNGN-----LE 475
           KVI   E+   Q IN   +L      +  +IEK+ ++ + I  E     +NG+     + 
Sbjct: 270 KVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVS 329

Query: 476 NLTTLLDEKIAKIEAINENNMRIQKDIEV--LQVKKLNLENEIK 517
            LTTL+D  +++++A+    +  Q ++E   LQ++K  LEN IK
Sbjct: 330 KLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRK--LENLIK 371

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 75/153 (49%), Gaps = 30/153 (19%)

Query: 327 TNEYNIVSKAVYDQMNYEQKLHSE----------WLKNFNAAEDEKYNTKKQEYEDKLVE 376
           T+ Y +V     D ++Y+ KL  +          +LK F   E  + N KKQ Y++++ E
Sbjct: 671 TSGYQLVGGFRLDTVDYQNKLQIKVGSSSKNEETYLKEFIKQETNELNAKKQRYQERMSE 730

Query: 377 LQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYN--VDKGKVI-KETELMKL 433
           ++ +L  + ++   + ++ +Q          K++ D++   N  VD G +I K+T+    
Sbjct: 731 VRNKLRSVVDESSEARLQLKQN--------SKHITDLKVNMNKVVDTGALISKQTD---- 778

Query: 434 QKINAKEDLLAKQLDVKNEIEKLNNEKEAITNE 466
            K N K+ ++A +    N I+++ N  + IT E
Sbjct: 779 -KDNQKKAIIAYE----NSIQQIRNNLDQITEE 806

>KNAG0A06740 Chr1 (1049153..1053505) [4353 bp, 1450 aa] {ON}
           Anc_2.497 YKL010C
          Length = 1450

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 5/54 (9%)

Query: 147 SDEEEESEED--DDDGDEG-EDEDGDESVEEEKYVEEEEDNNAEENISEKIESI 197
           S++   SEED   DD  EG +D+DGD S   E + ++  DN  +EN+ E+I+S+
Sbjct: 11  SEDGHYSEEDYMRDDRSEGHQDDDGDHSEGFEDFYDDYHDN--DENVDEEIDSV 62

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 106/226 (46%), Gaps = 29/226 (12%)

Query: 197 IIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEEEEEDTEQDAVGPIDPS 256
           ++G +D +N   +    + ++   ++DT  S+ +S+ ++++ +E+  +T  D VG +D  
Sbjct: 131 LVGLVDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSD-VGGLDKQ 189

Query: 257 I--------VPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKT----AKAGASNMT 304
           I        +PM R        + APK        +L+ G  G+ KT    A A  +N T
Sbjct: 190 IEELVEAIVLPMKRADKFKELGIKAPK-------GALMYGPPGTGKTLLARACAAQTNAT 242

Query: 305 -LGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKY 363
            L +A P+   +   E  + LVR  +   ++K     + +  +L +   K F++   EK 
Sbjct: 243 FLKLAAPQLVQMFIGEGAK-LVR--DAFALAKEKAPTIIFIDELDAIGTKRFDS---EK- 295

Query: 364 NTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKN 409
            +  +E +  ++EL  QLD      ++  +    ++++++  L+++
Sbjct: 296 -SGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRS 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.303    0.124    0.321 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,089,801
Number of extensions: 4242113
Number of successful extensions: 156245
Number of sequences better than 10.0: 7626
Number of HSP's gapped: 90563
Number of HSP's successfully gapped: 15671
Length of query: 629
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 513
Effective length of database: 40,180,143
Effective search space: 20612413359
Effective search space used: 20612413359
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 69 (31.2 bits)