Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042503.492ON62962924600.0
Kpol_480.143.492ON6993806411e-73
Skud_7.4413.492ON8073374731e-49
YGR130C3.492ON8163354614e-48
Suva_7.4183.492ON8313394492e-46
Smik_6.2263.492ON8393344492e-46
SAKL0F02772g3.492ON7732713986e-40
NCAS0E008103.492ON6923363959e-40
CAGL0I10516g3.492ON8133103581e-34
ZYRO0D09988g3.492ON9942713501e-33
NDAI0G009403.492ON6563413132e-29
KLTH0F14828g3.492ON8362613125e-29
KLLA0D16236g3.492ON8713482974e-27
TDEL0D056003.492ON7002672955e-27
Kwal_55.212293.492ON7872642635e-23
KNAG0B008103.492ON7573332288e-19
TBLA0C044803.492ON8021101984e-15
KAFR0C019603.492ON5632641956e-15
Ecym_12373.492ON7272641932e-14
KAFR0G036903.492ON3631231623e-11
AFR310C3.492ON6232631538e-10
KNAG0A079403.492ON275771258e-07
NCAS0F035503.492ON441721153e-05
NDAI0B058603.492ON681741092e-04
SAKL0E14916g5.702ON1779100725.4
ZYRO0E03542gsingletonON11963666.7
KLTH0E01914g7.476ON57643698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04250
         (629 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   952   0.0  
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   251   1e-73
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   186   1e-49
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   182   4e-48
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   177   2e-46
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   177   2e-46
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   157   6e-40
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   156   9e-40
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   142   1e-34
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   139   1e-33
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   125   2e-29
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   124   5e-29
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   119   4e-27
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   118   5e-27
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   105   5e-23
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    92   8e-19
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    81   4e-15
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    80   6e-15
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    79   2e-14
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    67   3e-11
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    64   8e-10
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    53   8e-07
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    49   3e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    47   2e-04
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    32   5.4  
ZYRO0E03542g Chr5 complement(275553..275912) [360 bp, 119 aa] {O...    30   6.7  
KLTH0E01914g Chr5 complement(178565..180295) [1731 bp, 576 aa] {...    31   8.8  

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/629 (79%), Positives = 498/629 (79%)

Query: 1   MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60
           MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK
Sbjct: 1   MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60

Query: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120
           FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL
Sbjct: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120

Query: 121 HELQKSSRVLVLDEDKNELVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           HELQKSSRVLVLDEDKNELVL                                       
Sbjct: 121 HELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDGDEGEDEDGDESVEEEKYVEE 180

Query: 181 XXXXXXXXXXXXXXXXXXGELDSQNENVSKNAEILEEQSNVVDTEASQHXXXXXXXXXXX 240
                             GELDSQNENVSKNAEILEEQSNVVDTEASQH           
Sbjct: 181 EEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQSNVVDTEASQHESKGESLDEEE 240

Query: 241 XXXXXXQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 300
                 QDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA
Sbjct: 241 EEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGA 300

Query: 301 SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360
           SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED
Sbjct: 301 SNMTLGVAVPETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360

Query: 361 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVD 420
           EKYNTKKQEYEDKLVELQKQLDD                EIMEYQLVKNVLDVQSKYNVD
Sbjct: 361 EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD 420

Query: 421 KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 480
           KGKVIKETELMKLQKINAKEDLLAKQLDV            AITNEYNIWNGNLENLTTL
Sbjct: 421 KGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480

Query: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540
           LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL
Sbjct: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540

Query: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHXXXXXXXXXXXXXXX 600
           PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH               
Sbjct: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600

Query: 601 XXXXXXXXXXXXXXHNEEMAEIQKKYQEK 629
                         HNEEMAEIQKKYQEK
Sbjct: 601 DELLQKKLTELQEKHNEEMAEIQKKYQEK 629

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  251 bits (641), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/380 (38%), Positives = 217/380 (57%), Gaps = 20/380 (5%)

Query: 250 VGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAV 309
           V PI+P   PM+ + P        P++++T  I ++  G   SN             +  
Sbjct: 312 VEPINPDEAPMLHMGP------PQPQSSST-GIMAIFKGNSSSN-------------IQP 351

Query: 310 PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369
              + ++SPENPEY+++T ++  +SKAVYD++ Y+Q +H  WL N    E+EKY  KK E
Sbjct: 352 VSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTE 411

Query: 370 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429
           YED L ++Q ++D+                E+MEYQLVKN+LD+   +N  K K+ KETE
Sbjct: 412 YEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471

Query: 430 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 489
           LMKL+K+NAK+D ++KQ ++             +T+++N WN  L  +T  LD KI  I 
Sbjct: 472 LMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIR 531

Query: 490 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 549
           A N+  + I++++  L + K+ LE EIK +EE  K N ++L  LNV K+YLPR+NEID +
Sbjct: 532 AKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNE 591

Query: 550 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHXXXXXXXXXXXXXXXXXXXXXXXX 609
           IA + +KL+ IK ETI ENN+L+ILTKKLE+ERIA                         
Sbjct: 592 IAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLA 651

Query: 610 XXXXXHNEEMAEIQKKYQEK 629
                HNEE+ EIQKKY++K
Sbjct: 652 ELKAKHNEELLEIQKKYEKK 671

 Score =  109 bits (272), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 78/109 (71%), Gaps = 1/109 (0%)

Query: 22  TFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYS 81
           + L + +SR   N EY+SPFR+P +   +NYAK+ K ++FPT SA+S+F++M P E+GY 
Sbjct: 24  SMLKKVVSR-DHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYK 82

Query: 82  SLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           +++K+ KRAKDI FP +L+ NE+RQ  ++ +L++KE  L  L+ S  +L
Sbjct: 83  NISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  186 bits (473), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 187/337 (55%), Gaps = 22/337 (6%)

Query: 251 GPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVP 310
            PIDPS  P  ++P         PK   T  I +L      S  +A+ G      GV  P
Sbjct: 343 APIDPSKAP--KVP-----FKERPKKERT-GIFALWKSPTSS--SAQKG------GVTAP 386

Query: 311 ETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370
            ++ VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+     Y
Sbjct: 387 -SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGY 445

Query: 371 EDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL 430
            ++L +LQ Q+D+                E+ + +LVK ++DV + +N  K  + K+TE 
Sbjct: 446 SERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTEN 505

Query: 431 MKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEA 490
           MK QK+  K+++L KQ  V             +  E+N W  NL NL+  LD +I KI  
Sbjct: 506 MKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQ 565

Query: 491 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDE 548
           IN    ++Q +I+ LQ KK +L   I   EE  KL++  +Q L +VE K+YLP++N+ID 
Sbjct: 566 INLKQSKVQNEIDALQKKKEDL---IAQTEENKKLHERNVQTLESVENKEYLPQINDIDN 622

Query: 549 QIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           Q++   +K+ II+ E  +E  +LS +TK+LE+ER AH
Sbjct: 623 QVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAH 659

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76
           FL + +S + +  E ++SPFR  QD +  N     Y    K KKFPT SATS ++K  P 
Sbjct: 38  FLQKVVSNEPKGKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPK 95

Query: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDK 136
           ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L++  ++  L  D 
Sbjct: 96  DLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLTSDG 155

Query: 137 NE 138
           N+
Sbjct: 156 ND 157

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  182 bits (461), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 188/335 (56%), Gaps = 22/335 (6%)

Query: 253 IDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPET 312
           IDPS  P  ++P         P       I +L      S        S      A P +
Sbjct: 354 IDPSKAP--KVP------FQEPSRKERTGIFALWKSPTSS--------STQKSKTAAP-S 396

Query: 313 HAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYED 372
           + VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E +KY+ K +EY++
Sbjct: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456

Query: 373 KLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMK 432
           KL +LQ Q+D+                E+ + +LVK ++DV +++N  K  ++K+TE MK
Sbjct: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516

Query: 433 LQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAIN 492
            QK+  K ++L KQ +V             +  E+N W  NL NL+  LD +I KI  IN
Sbjct: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576

Query: 493 ENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDEQI 550
               ++Q +I+ L+ KK +L   +   EE  KL++  +Q L +VE K+YLP++N+ID QI
Sbjct: 577 LKQGKVQNEIDNLEKKKEDL---VTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQI 633

Query: 551 AAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           ++  +++ IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 634 SSLLNEVTIIKQENANEKTQLSAITKRLEDERRAH 668

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 78/126 (61%), Gaps = 5/126 (3%)

Query: 14  HPGQEPQQTFLTRHISRKSENTE-YISPFRNPQDTVRSN---YAKSLKEKKFPTTSATSN 69
           H  + P Q FL + +S + +  E ++SPFR      R N   Y +  K +KFPT SATS 
Sbjct: 30  HQQESPYQ-FLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSA 88

Query: 70  FNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRV 129
           ++K  P ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++
Sbjct: 89  YSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKI 148

Query: 130 LVLDED 135
             L +D
Sbjct: 149 TDLTKD 154

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  177 bits (449), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 184/339 (54%), Gaps = 24/339 (7%)

Query: 250 VGPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAV 309
           + PIDPS  P  ++P         P+   T       S    S   AK GA+   L    
Sbjct: 365 ITPIDPSKAP--KVP-----FQERPQKERTGFFALWKSPTSSS---AKKGAATAPL---- 410

Query: 310 PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369
              + VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K  E
Sbjct: 411 ---NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTE 467

Query: 370 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429
           Y++KL +LQ Q+D+                E+ + +LVK ++D+ +++N  K  + K+TE
Sbjct: 468 YKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTE 527

Query: 430 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 489
            MK QK+  K ++L KQ +V             +  E+N W  NL +L+  LD +I KI 
Sbjct: 528 NMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKIN 587

Query: 490 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVEKDYLPRLNEI 546
            IN    + Q +I+ L+ +K +L   I   EE  KL   N +VL+ +   K+YLP++N+I
Sbjct: 588 QINLKQSKAQNEIDNLEKQKKDL---ITQTEENKKLHEKNVEVLESVE-NKEYLPQINDI 643

Query: 547 DEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           D QI+   +++ II+ E  +E   LS +TKKLE+ER AH
Sbjct: 644 DTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAH 682

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 75/121 (61%), Gaps = 8/121 (6%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76
           FL + +S + +  E ++SPFR  QD +  N     Y    K +KFPT SATS ++K  P 
Sbjct: 36  FLQKVVSNEPKGKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQ 93

Query: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDK 136
           ++GY ++ K+ KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  L  D 
Sbjct: 94  DLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTGDA 153

Query: 137 N 137
           N
Sbjct: 154 N 154

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  177 bits (449), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 187/334 (55%), Gaps = 18/334 (5%)

Query: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311
           PIDPS  P  ++P         P+       K+ I     S+ ++ A  SN     A P 
Sbjct: 376 PIDPSKAP--KVP-----FQERPRKG-----KTGIFALWKSSTSSSAQKSN----TAAP- 418

Query: 312 THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371
           ++ VA+PE PE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K +EYE
Sbjct: 419 SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478

Query: 372 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 431
           +KL +LQ Q+D+                E+ + +LVK ++DV + +N  K  + K+TE M
Sbjct: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538

Query: 432 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 491
           K QK+  K  +L KQ +V             +  ++N W  NL NL+  LD +I KI  I
Sbjct: 539 KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598

Query: 492 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA 551
           N    ++Q +I+ L+ KK  L  + +++E+  + N  VL+ +   ++YLP++N+ID QI+
Sbjct: 599 NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREYLPQINDIDNQIS 657

Query: 552 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
              +++ IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 658 TLLNEMTIIKQENANEKTQLSAITKRLEDERRAH 691

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 9/120 (7%)

Query: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN------YAKSLKEKKFPTTSATSNFNKMVP 75
           FL + +S + +  E +ISPFR  QD + S       Y +  K +KFPT SATS ++K  P
Sbjct: 38  FLQKVVSNEPKGKEEWISPFR--QDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQP 95

Query: 76  GEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDED 135
            ++GY ++ KN KRAKDI+FP YL  NE+RQ QLL EL++KE  L  L+K  ++  L +D
Sbjct: 96  KDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTKD 155

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  157 bits (398), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 155/271 (57%), Gaps = 2/271 (0%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           +A+P++PEY+VRT++   +SKA+YD++ Y++++H   L  FN  + +KY+  ++EY DKL
Sbjct: 351 LATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKL 409

Query: 375 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             LQ Q+D+                ++ E +L K +LD+ + +   K  + KETE +K Q
Sbjct: 410 TLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQ 469

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           KI  ++++ AK  +V             +  E+N +   L++LT  LD K+ KI+ +N+ 
Sbjct: 470 KIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDK 529

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
            M I   I  L  KKL +E E +D EE  K +  +L+ +   K+YLP++N ID Q+A   
Sbjct: 530 QMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLL 588

Query: 555 DKLAIIKNETISENNQLSILTKKLEEERIAH 585
             L +IK E  ++  + + +TK+LEEER AH
Sbjct: 589 GSLTLIKQENANQKTEFAAITKRLEEERKAH 619

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 59/95 (62%), Gaps = 5/95 (5%)

Query: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95
           +Y SPFR+ Q+ +    AK++K KKFPT SATS        ++GY  +    +RAKDI  
Sbjct: 44  DYSSPFRSQQELI---AAKNVKAKKFPTVSATSGTASA--ADLGYKVIDSAKRRAKDISV 98

Query: 96  PKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           P+YL + +++Q + L +L+ KE+ L  L+ S +++
Sbjct: 99  PRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIV 133

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  156 bits (395), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 106/336 (31%), Positives = 176/336 (52%), Gaps = 34/336 (10%)

Query: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311
           PIDP++ PMV                      SL +  + S K  +A           PE
Sbjct: 235 PIDPALAPMVPF--------------------SLATPNQKSKKETEA-----------PE 263

Query: 312 --THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369
             ++ VASP N E +V+T ++  +SKAVYD++ Y+++ H +WL ++   ++EKY  K QE
Sbjct: 264 KPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQE 323

Query: 370 YEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429
           Y+  L ++  Q+ +                ++M  QLVK V D +     DK K+  ET+
Sbjct: 324 YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETK 383

Query: 430 LMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIE 489
            +KL+K++ KE++L    +V             + +EY+ W  N+ N+ + LD K+ KI 
Sbjct: 384 QIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKIS 443

Query: 490 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 549
            IN   M +Q  I+ L  +K NL++EI  ++     N  +++ ++  K+YLP+LN+ID +
Sbjct: 444 QINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVD-NKEYLPKLNDIDNE 502

Query: 550 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           I    +++ I+K E  +E  QL+ +TKKLE+ER AH
Sbjct: 503 INGLLNQMTIVKQENANEKVQLAEITKKLEDERRAH 538

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 3/98 (3%)

Query: 35  TEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 94
           ++Y SPFR     V     ++ K ++FPT SATSN+    P + G++++ K    AKDI 
Sbjct: 71  SDYASPFRAEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127

Query: 95  FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132
           FP YL +NE+RQ   L+ L+ KE  L  LQ S  ++ L
Sbjct: 128 FPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDL 165

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  142 bits (358), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 164/310 (52%), Gaps = 16/310 (5%)

Query: 287 SGAKGSN---KTAKAGASNMTLGVAVPET----HAVASPENPEYLVRTNEYNIVSKAVYD 339
           SG K S+   +   AG   +T    +P+       +A+PENPE + +T EY  +SK +YD
Sbjct: 384 SGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYD 443

Query: 340 QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXX 399
           ++ Y++  H  WLK F  +E  KY+ K +EY ++L ELQK++D                 
Sbjct: 444 KVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKI 503

Query: 400 EIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXX 459
           E+ E  LVK + +  + +N  K K+ KETE +K QKI  K+++L K   V          
Sbjct: 504 EVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDR 563

Query: 460 XXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI--- 516
              +  E++ W  N+  L   LD KI K+  I       QK+IE L+ +K   + +I   
Sbjct: 564 KKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAA 623

Query: 517 -KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILT 575
            K+HEE  K    V++     K+YLP+++ ID QI+   ++LAIIK E  +E  +LS +T
Sbjct: 624 KKEHEEGQK----VVESYE-NKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKIT 678

Query: 576 KKLEEERIAH 585
           K+LEEER AH
Sbjct: 679 KELEEERRAH 688

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 5/95 (5%)

Query: 38  ISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPK 97
           ++PF N     +  Y K+ K+ KFPT SATS      P E+G+ +L K+ KRAKDI+FP 
Sbjct: 105 VNPFTN-----KPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPV 159

Query: 98  YLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132
           YL +NE RQ  +L EL++KE KL  L+ S +++ L
Sbjct: 160 YLTENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 147/271 (54%), Gaps = 1/271 (0%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           +A+PENPE LV+T+    +SKAVYD++ YE   HSEWL  F ++E ++Y  K+ +Y+++L
Sbjct: 489 LATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRL 548

Query: 375 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
            EL+K+++                 EI   +L K  L+   +Y   K  +  ET+ ++ Q
Sbjct: 549 EELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQ 608

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           K    +++  +Q +V             I  E+  W   L + +  LD K+  +  + + 
Sbjct: 609 KDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQK 668

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
           + + Q  I+ L  KK  LE E+  H+E    N   ++K +  K+YLP+++EID++I+   
Sbjct: 669 HTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK-HANKEYLPKVHEIDDKISNLL 727

Query: 555 DKLAIIKNETISENNQLSILTKKLEEERIAH 585
            +L++IK E+ +E  +L  +TKKLE ER AH
Sbjct: 728 GELSVIKQESANEKLKLGSITKKLESERQAH 758

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 78/151 (51%), Gaps = 37/151 (24%)

Query: 2   SKRKDTFTVL--EDHPGQEPQQ-TFLTRHISRKSEN------------------------ 34
           SKR D FT L  E H  ++ ++ TFLT+ ++    N                        
Sbjct: 4   SKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRASARK 63

Query: 35  ---TEYISPFRNPQDTVRSNYAKSLKEK--KFPTTSATSNFNKMVPGEMGYSSLAKNDKR 89
               E+ SPFR     + SN   + K +  +FPT S  S F+K+ P E+GY ++ +  +R
Sbjct: 64  SHLGEFASPFR-----LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRR 118

Query: 90  AKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120
           AKDIQFP YL +NE RQ QLL E++I+E KL
Sbjct: 119 AKDIQFPIYLRENEARQDQLLTEVEIREQKL 149

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 173/341 (50%), Gaps = 39/341 (11%)

Query: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311
           PIDP + PMV         LS P  N               NK  K           VPE
Sbjct: 190 PIDPKLTPMVSFQ------LSTPPVN---------------NKNKKTQV--------VPE 220

Query: 312 -----THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTK 366
                 +  A+P + E +V+T ++ I+SK++YDQ+ Y+Q+ H ++L ++ A   EKY+ K
Sbjct: 221 EEEKERNPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVK 280

Query: 367 KQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIK 426
            QEYE++L  L +++                  +IM  +LVK + D +S    DK K+  
Sbjct: 281 MQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFS 340

Query: 427 ETELMKLQKINAKEDLLAKQLD--VXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEK 484
           ET+L+K +KI+ K  +  ++LD  V             + +E+N W  N+ N+   LD K
Sbjct: 341 ETKLIKREKIDEK--INVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAK 398

Query: 485 IAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLN 544
           + KI+ IN   M +Q  I+ L  +KL L  EI+ ++     N + ++ ++  K YLP+LN
Sbjct: 399 LFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYLPKLN 457

Query: 545 EIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
            ID QI    ++L +IK E  +E  QLS LT+KLE+ER+ H
Sbjct: 458 NIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDH 498

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95
           EY+SPFR+   T    Y ++ K K+FPT SATSN+      EMG+  + K+   AKDI F
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126

Query: 96  PKYLLDNEKRQ 106
           P YL  NE+RQ
Sbjct: 127 PSYLTQNEQRQ 137

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  124 bits (312), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 134/261 (51%), Gaps = 2/261 (0%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           VASP +PE++V+ ++   +SKA+YD + YE+ +H   + ++    D KY  K  EYED+L
Sbjct: 377 VASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435

Query: 375 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             L+ Q+ +                EI E +L   ++D+ ++++  K  + KETE MK  
Sbjct: 436 TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAA 495

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           K+  KE + AKQ DV             I  E     G ++ LT  LD K+A I+ +N  
Sbjct: 496 KVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
              +Q  I+ LQ +K  L +E    +E+   N  VL+ +   K+YLP+LN ID +I+   
Sbjct: 556 QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEYLPKLNAIDTKISELL 614

Query: 555 DKLAIIKNETISENNQLSILT 575
             L ++K ET +   + + ++
Sbjct: 615 TSLTVVKQETANHKTEFAAVS 635

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 65/118 (55%), Gaps = 10/118 (8%)

Query: 18  EPQ-----QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNK 72
           EPQ     + FL + +S++ E + Y SPFR  Q       A+  K +KFPT SA+ + + 
Sbjct: 17  EPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLA---AAQKRKMQKFPTVSASVSAHS 73

Query: 73  MVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
               +MGY  +    +RAKDI  P+YL  N++RQ + L +L+ KE  L   + S R++
Sbjct: 74  SS--DMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIV 129

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  119 bits (297), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 170/348 (48%), Gaps = 28/348 (8%)

Query: 259 PMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAG-----------------AS 301
           P    PP   D+ SAP+   T S  +    A  ++  A +G                 A+
Sbjct: 373 PEAISPP--PDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAA 430

Query: 302 NMTLGVAVPETHA-VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAED 360
           N   G  VP   A VA+PE+PE +VRT E   VSK+VYD++ Y++  H   L  ++  +D
Sbjct: 431 NAAAGTVVPGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQD 489

Query: 361 EKYNTKKQEYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVD 420
           E+Y TK QEYE+K+  +Q ++ +                ++ + +  + +L+   K+   
Sbjct: 490 ERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINA 549

Query: 421 KGKVIKETELMKLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTL 480
           KG + K+TE +K Q I+ KED       V             +  E       +E LT  
Sbjct: 550 KGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAE 609

Query: 481 LDEKIAKIEAINENNMR---IQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEK 537
           LD K +   A+NE+  +      +I+ L+ +K  LE EIK+ +E  + N   ++ ++  K
Sbjct: 610 LDNKTS---ALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID-NK 665

Query: 538 DYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585
           +YLP++NEI+ +I++    L +I+ E  ++  + S +T++LEEER  H
Sbjct: 666 EYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQH 713

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 22/144 (15%)

Query: 6   DTFTVL---EDHPGQEPQQTFLT------RHISRKSE-------NTEYISPFRNPQDTVR 49
           D F  L    DH  ++ QQ  LT      + ++ K +       + EY SPFR  ++T R
Sbjct: 14  DPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSPFRTAEETQR 73

Query: 50  SNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLA-KNDKRAKDIQFPKYLLDNEKRQAQ 108
              A+ ++++KFPT S      ++ P +MGYS +  K+ K+AKDI  P  L D E  Q  
Sbjct: 74  ---ARQVRQEKFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKV 128

Query: 109 LLMELQIKEHKLHELQKSSRVLVL 132
            L  L+ KE +L   +KS +++ L
Sbjct: 129 RLTALEKKEKQLRYWRKSQKIVDL 152

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  118 bits (295), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 143/267 (53%), Gaps = 2/267 (0%)

Query: 319 ENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQ 378
           ENPE++V+T +   ++K +YD++  + + H+EW+  +   E +K++ K+ E   K+  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 379 KQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINA 438
            Q+ +                E+ E +L +   ++   +   K +V K+TE++K QK++ 
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 439 KEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRI 498
           K+ +L KQ +V             +  E   W  ++E L+  +D K+A +E +N      
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 499 QKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLA 558
           Q++I  LQ +K+++ ++I+ +      N+ V++     K YLP+LNE+D QI+    +L 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTYLPKLNEVDNQISVLLGQLT 583

Query: 559 IIKNETISENNQLSILTKKLEEERIAH 585
            I+    +E  +LS +TKKL++ER+ H
Sbjct: 584 TIRQHCANERTELSAITKKLDKERLEH 610

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 58/89 (65%), Gaps = 3/89 (3%)

Query: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95
           +Y+SPFR+ Q+ +    A+  + ++FPTTSA S +    P E+GY  +   +KRAKDI F
Sbjct: 39  DYVSPFRDEQEVLS---AQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95

Query: 96  PKYLLDNEKRQAQLLMELQIKEHKLHELQ 124
           P YL + EK+Q +LL EL++KE  L  L+
Sbjct: 96  PVYLEEIEKKQLELLRELEVKEAHLRYLK 124

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  105 bits (263), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 135/264 (51%), Gaps = 8/264 (3%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           VASP++PE++V+ ++   +SKA+YD + YE+ +H + +  +     +KY+ K QEYED L
Sbjct: 349 VASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407

Query: 375 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             L+ Q+ +                 I   +L   +++  +K++  K  + KETE  K  
Sbjct: 408 TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           KI+ K  ++AKQ +V                        ++ LTT LD K + I+ +N+ 
Sbjct: 468 KIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQ 527

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVEKDYLPRLNEIDEQIA 551
              IQ  I+ L+ +K  L   + D    D+L   N  +L+ ++  KDYLP++N +D QI+
Sbjct: 528 QAEIQASIDALEQQKDTL---VADATAADELHNSNIAILEGIS-NKDYLPKINALDSQIS 583

Query: 552 AKFDKLAIIKNETISENNQLSILT 575
                LA++K ET +++ + + ++
Sbjct: 584 QLLSSLALVKQETANQHTEFAAVS 607

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 7/130 (5%)

Query: 3   KRKDTFTVL--EDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60
           K+ D F  L  +D P +E  + FL + ++++ E+  Y SPFR  Q  V    A+  K ++
Sbjct: 4   KKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVE---AQKRKVQR 60

Query: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120
           FPT SA+S  N     EMG+  +    KRAKDI  P+YL  N++RQ + L +L+ KE  L
Sbjct: 61  FPTVSASSGGNSSA--EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSL 118

Query: 121 HELQKSSRVL 130
              + S +++
Sbjct: 119 QYKKDSQKIV 128

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 146/333 (43%), Gaps = 23/333 (6%)

Query: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311
           P+DP+  P + +      L+    T    S K  +                    +  P 
Sbjct: 256 PVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRL--------------------MDTPV 295

Query: 312 THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371
           T+  A+ + PE L++  +Y  VS AV++++ Y+ K+H   + ++   ++ K+  K QEYE
Sbjct: 296 TNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYE 355

Query: 372 DKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 431
            KL ++  +                   E++E Q +K + D  + +N  K KV+ E +L+
Sbjct: 356 QKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLV 415

Query: 432 KLQKINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAI 491
           KLQK+   + +  K+  +                +Y++W  NL N+T  LD ++ K+   
Sbjct: 416 KLQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQF 475

Query: 492 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV-LQKLNVEKDYLPR-LNEIDEQ 549
           N    +I + I  L  +K  LE EI D  +  K N D  L  L   +      L ++ + 
Sbjct: 476 NHKQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDS 534

Query: 550 IAAKFDKLAIIKNETISENNQLSILTKKLEEER 582
           I  K D LA++K E   E  +L  +T ++E  R
Sbjct: 535 IQGKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 60/96 (62%), Gaps = 1/96 (1%)

Query: 36  EYISPFRNPQDTVRSNYAKSL-KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 94
           EY+SPFR  Q T  S     L + KKFPT SATS +N     E+G+S +  + +RA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 95  FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           FP+YLL+NE RQ  +L +L+ +E  L  LQ+   VL
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 21  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 80
           QT +  H +   +  +Y SPFR+ Q     N A   K  ++PT SATS ++ M P ++GY
Sbjct: 41  QTAINSH-TLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGY 99

Query: 81  SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
            ++  + KRAKDI FP  L++NE RQ +L  +L  KE +L  LQKS +++
Sbjct: 100 KNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 5/66 (7%)

Query: 316 ASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371
           A+P+NPE LV+T  YN    I+SK+VYD +NY  K+H++ +K++    + KY  K +E+ 
Sbjct: 379 ATPKNPELLVKT-RYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFN 437

Query: 372 DKLVEL 377
           + + EL
Sbjct: 438 NSINEL 443

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 132/264 (50%), Gaps = 8/264 (3%)

Query: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374
           VASPEN E +V+      +SK VYD++ ++ K++ +++  +   +  K N  K EY +K+
Sbjct: 248 VASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKI 307

Query: 375 VELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434
             +Q +                   E+++ +LVKN++D  + ++ +K K++++T  +KLQ
Sbjct: 308 KSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQ 367

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           K+N  + L  K+  +            +    +N  N +L  +   LD K+ K+   N  
Sbjct: 368 KLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIR 427

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
           N  ++ +I  LQ KK  L +EI D  E  KL+ D   K          LNE+DEQI +K 
Sbjct: 428 NENLEHEINKLQSKKQTLLDEI-DSIEYKKLHPDDDSK-------QLELNEMDEQINSKL 479

Query: 555 DKLAIIKNETISENNQLSILTKKL 578
             L +IK E I+E  ++S LT  L
Sbjct: 480 SNLNLIKQEIINEKLKISKLTNDL 503

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (55%), Gaps = 7/113 (6%)

Query: 23  FLTRHISRKSENTE----YISPFRNPQDTV-RSNYAKSLKEKKFPTTSATSNFNKMVPGE 77
           FL++  + KS+  +    Y SPFRN   +  +    + LK  KFP  SATS +N     +
Sbjct: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN--TDTK 90

Query: 78  MGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
             Y  L      A+DI+FP  L+DNE RQ Q+L++L+IK+  L  L+ S +V+
Sbjct: 91  DVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVI 143

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 128/264 (48%), Gaps = 5/264 (1%)

Query: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375
           A+PE+PE++V T E   +SK +YD++ YE++LH E L + +     KY    + YE+KL 
Sbjct: 323 ATPEDPEFIVLT-EKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 376 ELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQK 435
            L  ++ +                + +E  L +N++D+Q+K++  K  ++KE E  K  K
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 436 INAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 495
           I  K  +  K   V                E   +   ++ LT  LD ++ +++ +++  
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 496 MRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 555
             +   +  L+ +++ +E +I +       NK++LQ L    +  P +  +D Q++    
Sbjct: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL----ENHPSIAALDNQVSEVTR 557

Query: 556 KLAIIKNETISENNQLSILTKKLE 579
            ++ ++ E  ++ ++L+ L+ K E
Sbjct: 558 TVSAVEQEHAAQKDELTELSTKKE 581

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 15/98 (15%)

Query: 34  NTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKR-AKD 92
             EY+SPFR+ +       A+ +++ KFPTT           G      +  N KR A+D
Sbjct: 54  GGEYVSPFRDDKAVAE---AERIRDLKFPTT-----------GHHSTVRVKDNVKRKAQD 99

Query: 93  IQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           I  P+     + +Q + L EL +KE++L  L+ S +++
Sbjct: 100 IAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIV 137

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 6/123 (4%)

Query: 16  GQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVP 75
            + P + FL   I+    + +Y SPFR   +    NY +  K  K+  T+  S+FNK+  
Sbjct: 21  AKNPHRNFLKDTIA---HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNL 77

Query: 76  GEMGYSSLA---KNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132
             +GY ++    K+ K AKDI FP+ L +NE+ Q   L EL+ KE+ L  L+ S  ++ +
Sbjct: 78  NTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137

Query: 133 DED 135
           DED
Sbjct: 138 DED 140

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 313 HAVASPENPEYLV----RTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 368
           +++A+P+N E ++    +       SK V+D + YE K+H + LK  NA  DE++ +K  
Sbjct: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242

Query: 369 EYEDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKET 428
           EY+ ++  L  ++D                 +  +++  KN L   ++YN  K ++  E 
Sbjct: 243 EYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEI 302

Query: 429 ELMKLQK 435
           E +K Q+
Sbjct: 303 EAIKNQR 309

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 121/263 (46%), Gaps = 4/263 (1%)

Query: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375
            +PE PE ++ TN    +SKAVYD++N E+K H   L N +    + Y    Q YE ++ 
Sbjct: 281 GTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIA 339

Query: 376 ELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKE-TELMKLQ 434
           +L  ++                  + +E  L KN+ D++++ N DK  V+ E  E  + +
Sbjct: 340 DLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHEQAEAQRAE 398

Query: 435 KINAKEDLLAKQLDVXXXXXXXXXXXXAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494
           ++  KE+++ +  ++                E       ++ L   LD +  ++  + + 
Sbjct: 399 QLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458

Query: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554
              +   +  LQ +K  LE E+ D  E  K N++ L++LN + DY   + EID + +   
Sbjct: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEIL 517

Query: 555 DKLAIIKNETISENNQLSILTKK 577
            ++A I+ E   +  +L  L ++
Sbjct: 518 TEIAKIRQEIEFQRKELVALKER 540

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 17/103 (16%)

Query: 28  ISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKND 87
           ++  + + EY SPFR   D +    A      KFPTT              G     +  
Sbjct: 47  VTGDASHDEYYSPFR---DAIAVEEAHGSGTLKFPTT--------------GTHVTEEAR 89

Query: 88  KRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130
           +R  DI  PK L   ++RQ Q L EL++KE +L   ++S +++
Sbjct: 90  RRVPDIDEPKRLSTVDERQRQQLQELELKEGQLRLYKESQKIV 132

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 57  KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIK 116
           K K  P ++  S++N + P E+GY       K A++I FP  L +NE RQ  +L +L  K
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAILQDLDEK 67

Query: 117 EHKLHELQKSSRVLVLD 133
           E  L  L+KS RV+ +D
Sbjct: 68  EQHLDHLKKSQRVVYID 84

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 4/123 (3%)

Query: 315 VASPENPEYLVRTNEYNIVSKA----VYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370
           VA+PE PE +V     N  +KA    ++D +  +   H+ WL +     +++  TK +EY
Sbjct: 122 VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181

Query: 371 EDKLVELQKQLDDXXXXXXXXXXXXXXXXEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL 430
             +L  L  Q+                  ++ E +L K  L    ++  +K K+ KETE 
Sbjct: 182 NKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETER 241

Query: 431 MKL 433
           +  
Sbjct: 242 LNF 244

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 313 HAVASPENPEYLVRT--NEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370
           + +A+P+NPE LV+   N+  IVSK  YD++   Q  H  WLK++NA     YN + Q Y
Sbjct: 179 YPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWY 238

Query: 371 EDKLVELQKQLD 382
                  QKQ+D
Sbjct: 239 -------QKQID 243

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 21/100 (21%)

Query: 34  NTEYISPFRNP--QDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAK 91
           N  ++S FR P   +   +NY   +K+++ P                   SL K + R  
Sbjct: 54  NARFVSTFREPLMNNRYYANYLYHMKQQRHP-------------------SLRKYESRNP 94

Query: 92  DIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLV 131
           +I  P++L   E++Q   L  LQ+KE  L  L+ S R++ 
Sbjct: 95  NIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIIT 134

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 310 PETHAVASPENPEYLVRTNE-YNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 368
           P+ + +A+  NPE L++ N+   I++K  YD++    + H+ W+ N N      YNTK +
Sbjct: 380 PQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439

Query: 369 EYEDKLVELQKQLD 382
            Y++KL +L +Q++
Sbjct: 440 TYQEKLNKLNEQIN 453

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1779

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 1/100 (1%)

Query: 469 IWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKD 528
           I+  + +++  LL+EKI  +EA  +   ++ ++ + L+ + L LENE++  +  D   K 
Sbjct: 133 IFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKA 192

Query: 529 VLQKLNVEKDYLPRLNE-IDEQIAAKFDKLAIIKNETISE 567
            +Q+L  E + L   N+ +++++A+K ++    +    SE
Sbjct: 193 EMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSE 232

>ZYRO0E03542g Chr5 complement(275553..275912) [360 bp, 119 aa] {ON}
           no similarity
          Length = 119

 Score = 30.0 bits (66), Expect = 6.7,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 310 PETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369
           P+  AVA+   P Y   T++YN V    Y  M +  KL S   +       E+++ + +E
Sbjct: 22  PQYCAVAATIQPRYTCDTHDYNTVQ---YGTMPFFSKLRSNKPEEKKYISVEEFHKRNKE 78

Query: 370 YED 372
           YE+
Sbjct: 79  YEE 81

>KLTH0E01914g Chr5 complement(178565..180295) [1731 bp, 576 aa] {ON}
           highly similar to uniprot|P28274 Saccharomyces
           cerevisiae YBL039C
          Length = 576

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 478 TTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHE 520
           T L D  ++ I+A+  ++MR  + +E++ V+  +LE E  +HE
Sbjct: 313 TNLKDSYLSVIKALEHSSMRCHRRLEIVWVEASDLEPETTEHE 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,984,697
Number of extensions: 2278104
Number of successful extensions: 12615
Number of sequences better than 10.0: 429
Number of HSP's gapped: 13067
Number of HSP's successfully gapped: 587
Length of query: 629
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 513
Effective length of database: 40,180,143
Effective search space: 20612413359
Effective search space used: 20612413359
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)