Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042403.490ON2092098521e-117
Kpol_480.153.490ON2072081871e-16
SAKL0F02816g3.490ON1922091731e-14
ZYRO0D10032g3.490ON2092211563e-12
TDEL0D055803.490ON1932161511e-11
Kwal_55.212263.490ON1962101371e-09
KLTH0F14784g3.490ON1952121361e-09
NCAS0E008203.490ON2022161231e-07
AFR308W3.490ON1922021167e-07
Ecym_12393.490ON1932101105e-06
NDAI0G009503.490ON2131141106e-06
Suva_7.4173.490ON2122221011e-04
CAGL0I10538g3.490ON200215920.002
YGR129W (SYF2)3.490ON21588740.28
KLLA0E04643g3.490ON221216730.45
KNAG0B008203.490ON207208730.46
Kpol_2002.321.33ON50141740.48
KAFR0C019503.490ON15746700.80
Skud_7.4403.490ON21382701.0
NOTE: 2 genes in the same pillar as TPHA0D04240 were not hit in these BLAST results
LIST: Smik_6.225 TBLA0C04470

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04240
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...   332   e-117
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    77   1e-16
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    71   1e-14
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    65   3e-12
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    63   1e-11
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    57   1e-09
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    57   1e-09
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    52   1e-07
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    49   7e-07
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    47   5e-06
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    47   6e-06
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    44   1e-04
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    40   0.002
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    33   0.28 
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    33   0.45 
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    33   0.46 
Kpol_2002.32 s2002 (65490..66995) [1506 bp, 501 aa] {ON} (65490....    33   0.48 
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    32   0.80 
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    32   1.0  

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/209 (82%), Positives = 173/209 (82%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINM           L
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
           LTNNSERALLTYTIRDYEEWEESLKRKHKNVTN           AKFTYDKEIHRMKKRQ
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLNAVNND 180
           GKFATDEEITRGSAMKEV              VNGFISDINKVSNDRYIKRMKLNAVNND
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNND 180

Query: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLEG 209
           ATGSKVSHDKGKTSYNNAKNKDFNDKLEG
Sbjct: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLEG 209

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 104/208 (50%), Gaps = 14/208 (6%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           M++   ++EFK LK++A+D LIE+RK L+A+ +E K   KPK YS  M            
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYS--MEELAEDDTVNTG 60

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
             + ++R LL Y+IR+YEEWE+   R  +NV             AKFTYD    ++KK Q
Sbjct: 61  TVDEADR-LLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYD---KQIKKLQ 116

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLNAVNND 180
            + +T++   + S +++               +     D+N+ + +RY +  +    N+D
Sbjct: 117 KQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSD 176

Query: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
              +         SY N KNK+FNDKLE
Sbjct: 177 QNEN--------YSYINEKNKEFNDKLE 196

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 94/209 (44%), Gaps = 29/209 (13%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+  L+ + K LK++ +D  +++RK  E +EK+ K   KPKVYS+N             
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEE-- 58

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
              ++   LL Y+I+DYE+W+     K KN              AK+TYDKEI  M+K  
Sbjct: 59  ---DTRGKLLNYSIKDYEKWQLKRTAKLKNSDG-----SSQQDLAKYTYDKEIREMEK-- 108

Query: 121 GKFATDEEITRGSAMK-EVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMK-LNAVN 178
                D  + RG   K  +              +     ++NK +  RYI+R K    ++
Sbjct: 109 -----DGSLNRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLD 163

Query: 179 NDATGSKVSHDKGKTSYNNAKNKDFNDKL 207
           +  TG           + N KNK FN+KL
Sbjct: 164 SSTTG----------GFINDKNKQFNEKL 182

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 99/221 (44%), Gaps = 42/221 (19%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+   I +F  LKK++ +  +E+RK + A+ KE  +  KP+VY +             L
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL-------EAPEPSL 63

Query: 61  LTNNSERA--LLTYTIRDYEEW-----EESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEI 113
            T + +    L+ YTI+ YEEW     +++ KR   N+ +           AK+TYDKE+
Sbjct: 64  PTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQD----------MAKYTYDKEL 113

Query: 114 HRMKKR---QGKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIK 170
           +++ K    Q ++     I +   M                 V     D++K + +RY  
Sbjct: 114 NKLHKDTMLQNRYTNGGSIQK---MNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEA 170

Query: 171 R---MKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
           R   M+ + V N ++G           Y N KNK FN+KL+
Sbjct: 171 RRREMERSNVQNASSGG---------GYINEKNKQFNEKLD 202

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 100/216 (46%), Gaps = 39/216 (18%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+ S+ + FK LKK+++D  I+ RK  E + K+   V KPK+YS+              
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSM-----EDTNEMGTR 55

Query: 61  LTNNSER---ALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMK 117
             ++SER    L+ Y++R+YEEW++  K+K K V             AK++Y+K++ R K
Sbjct: 56  PVDSSERRRLKLMNYSMREYEEWDK--KQKGKEV---KRGGANVQELAKYSYEKDLSRSK 110

Query: 118 KRQG----KFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMK 173
           +  G    K +TD +  R                     VN   +D+ K + +R++ R K
Sbjct: 111 QNNGNRVVKISTDAKTNR------------LQVKDDEKLVNKLANDLKKTTRERFLARKK 158

Query: 174 -LNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
            +   +  AT            Y N KNK FN KL+
Sbjct: 159 DMEKADARATPG---------GYINEKNKQFNLKLD 185

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 26/210 (12%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+    D  K LK++ +D  ++++  +  +EK   +  KP VYS+N             
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
             N     LL Y++ +YE+W++ +K+     ++           AK TYDKE+ ++ K  
Sbjct: 61  EAN----KLLKYSMLEYEQWQDKVKKN----SHRLEGGASFQDLAKSTYDKEVQQLSKID 112

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRY--IKRMKLNAVN 178
           G         R      V              V G +  +NK +++RY  I++     +N
Sbjct: 113 GNRVNKNTKYR------VNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMN 166

Query: 179 NDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
           N  +G           Y N KNK FNDKLE
Sbjct: 167 NTTSG----------GYINEKNKQFNDKLE 186

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 94/212 (44%), Gaps = 30/212 (14%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+    D  K LK++ +   +++++ +  +EK+  +  KP VYS+              
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEE- 59

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKR- 119
              + E  LL Y+++D+E+W++  +RK +  ++           AKFTYDKE+ +++K  
Sbjct: 60  ---SKEAKLLQYSMKDFEQWQDKERRKSQKSSD----VAKYQDLAKFTYDKEVQQLRKNY 112

Query: 120 QGKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYI---KRMKLNA 176
             K    ++++       +              V      +NK +N+RY    K++    
Sbjct: 113 TNKVEKPKKVS-------INKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQM 165

Query: 177 VNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
           V++   G           + N KNK FNDK+E
Sbjct: 166 VSDTPGG-----------FINEKNKQFNDKIE 186

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 93/216 (43%), Gaps = 33/216 (15%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           +D+     + K LK++A D+ IE+R  ++ + K+ +S  KP+VY++              
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNM-------QDDQDNQ 54

Query: 61  LTNNSERA------LLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIH 114
           L    E A      L+ YT+R YEEWE+  K K                 A F+YDK + 
Sbjct: 55  LETQEEDADDKVAKLMNYTLRQYEEWEKKQKDKKIKDD-----SSDMKQLAMFSYDKGVS 109

Query: 115 RMKKRQGKFATDEEITRGSAMKEVXXXXXXXX-XXXXXXVNGFISDINKVSNDRY-IKRM 172
            +     +F TD+  T      +V               VN    ++ K +N RY + + 
Sbjct: 110 NL----NRFRTDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK 165

Query: 173 KLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
           KL+A + D++            Y N +NK FN+KL+
Sbjct: 166 KLDARSKDSSAE---------GYINERNKHFNEKLD 192

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 86/202 (42%), Gaps = 30/202 (14%)

Query: 10  FKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXLLTNNSERAL 69
            + LKK+ +D+ I +RK   ++E+ R +  KP+VYS+               T + +  L
Sbjct: 10  LRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADD---TQSEQLKL 66

Query: 70  LTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQGKFATDEEI 129
           L Y I DYE+W+E  KR HK  ++           A  TY  E+H++ +R         +
Sbjct: 67  LNYRIADYEKWDEKQKR-HKQPSD----GADLGELANSTYRSELHQLHRRG--------V 113

Query: 130 TRGSAM-KEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLNAVNNDATGSKVSH 188
            +G A    +              V    + + + +  R+ +R K           K + 
Sbjct: 114 VKGRATNGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQK-----------KAAK 162

Query: 189 DKGKTSYN--NAKNKDFNDKLE 208
           D G+ +    N KN+ FN+KL+
Sbjct: 163 DGGRATAGSLNDKNRHFNEKLD 184

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 91/210 (43%), Gaps = 29/210 (13%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+  +    + LK + +D  I++RK + ++E  +    KP+VYSIN             
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQST- 59

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
            +N   R LL Y++ DYE+W+E  K+ + + T            A  TY  EI ++  R+
Sbjct: 60  -SNTERRKLLNYSLIDYEKWDEKEKQANFDGT-------YSGDIAYSTYKNEIKQL--RK 109

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYI---KRMKLNAV 177
           G   T  +IT+G     +              VN     + K S +R++   KR+  +  
Sbjct: 110 GGL-TKGKITKG----RISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKA 164

Query: 178 NNDATGSKVSHDKGKTSYNNAKNKDFNDKL 207
           N    G+ V          N KN+ FN+KL
Sbjct: 165 NTSELGNFV----------NEKNRHFNEKL 184

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 11/114 (9%)

Query: 10  FKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXX----XLLTNNS 65
            K LK+  LD + E+RK  + + KE+    KPKVY I                   +N  
Sbjct: 13  LKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEE 72

Query: 66  ER---ALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRM 116
           E+    L+ YTIR+YEEW++  K K +   +           A FTY+KE+ ++
Sbjct: 73  EKRKFKLMNYTIREYEEWDKQQKDKQRKRVD----GSDLTELATFTYEKELSKL 122

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 97/222 (43%), Gaps = 33/222 (14%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           MD+  L ++ K LK++ +D+ ++ RK  + + +E  S  KP+VYS  M            
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYS--MEDASDDELVRET 58

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
            +++ +RA   YT+++Y  WE+  K+K +               AK +YDK +  +  + 
Sbjct: 59  KSDDKDRA-FHYTVQEYNAWEQ--KQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQN 115

Query: 121 -GKF--ATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLNAV 177
            GK   + +E+ ++GS  K                 N     I  V +D  + ++  + +
Sbjct: 116 YGKHESSVNEKDSKGSLGK---------SRIEKIQKNSITGKIRIVDDDELVNKL-ASTL 165

Query: 178 NNDATGSKVSHD------------KGKTSYNNAKNKDFNDKL 207
            +D   SK  HD             G  S+ N KNK FN+KL
Sbjct: 166 ESD---SKKRHDARKRQMENVKTPSGVESFINDKNKQFNEKL 204

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 90/215 (41%), Gaps = 29/215 (13%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           M++    ++ K+LKK   D  I +R  L+ + +E++  LKP+VYS++             
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
             ++    L  YT++D+ +WE+  +++ K               AK TYDKE+  + + +
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKR-QQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPE 119

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLN----A 176
            K    E   R                     +N     +N   N   ++R+  N    A
Sbjct: 120 FKMKAKETQFR---------------------INKDSGKVNIKDNKELVQRLSQNLKETA 158

Query: 177 VNNDATGSKVSHDKGKTSYN---NAKNKDFNDKLE 208
                +  K+++DK  TS +   NAKN  FN  L+
Sbjct: 159 KQRYDSNRKIANDKEHTSLSGSINAKNLQFNKSLD 193

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member
          of the NineTeen Complex (NTC) that contains Prp19p and
          stabilizes U6 snRNA in catalytic forms of the
          spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
          cells have defective spindles activiating cell cycle
          arrest
          Length = 215

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 1  MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
          MD   L ++ K LK++ +D  I+ RK  + + +E  +  KP+VYS  M            
Sbjct: 1  MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYS--MEDVNDADESVGD 58

Query: 61 LTNNSERALLTYTIRDYEEWEESLKRKH 88
            +  +     YT+++Y+ WE    R+H
Sbjct: 59 TESPEKEKAFHYTVQEYDAWE----RRH 82

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 91/216 (42%), Gaps = 47/216 (21%)

Query: 2   DMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXLL 61
           D++ +  + K L+KQ ++  I ++K + A+EK+       +VYS+               
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER---RVYSM------ADDGEDKAR 88

Query: 62  TNNSERA----LLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMK 117
           +N SE      L  Y+IR+YE+WE     K +N  +           AK +Y KE+  + 
Sbjct: 89  SNKSEPEDPIKLANYSIREYEKWEA----KTQNSRHNKSVMGDFQTIAKNSYKKEVDALP 144

Query: 118 KR-----QGKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRY-IKR 171
           K      +G    D ++                       V   ++D+N+ S  RY +++
Sbjct: 145 KDISHPLKGGITEDGKVQ---------------VEDNPELVEKMVNDLNERSKKRYMVRK 189

Query: 172 MKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKL 207
            KL+  N      K++ D G   + N KNK FN KL
Sbjct: 190 QKLDKQN------KINLDDG---FINDKNKRFNAKL 216

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 77/208 (37%), Gaps = 41/208 (19%)

Query: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
           M +  L D+FK L +++    +  RK       ++  V KPKVYS+              
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQAAEPSVDGIDGAE 87

Query: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNXXXXXXXXXXXAKFTYDKEIHRMKKRQ 120
           + +N    LL   +R  E  E    R+ +N  +           AK TY KE+  + ++ 
Sbjct: 88  VVDNVTVKLLNTPLRQLEAREA---RRGEN-GDDAVARVEGDRVAKDTYKKELALLGRKS 143

Query: 121 GKFATDEEITRGSAMKEVXXXXXXXXXXXXXXVNGFISDINKVSNDRYIKRMKLNAVNND 180
                    TRG+    V                  ++ +N VS  RY+ R   N +   
Sbjct: 144 ---------TRGTYRDNVER---------------LVTHLNDVSKKRYLVRK--NKMKRQ 177

Query: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLE 208
                 S D     Y N KNK FN KL+
Sbjct: 178 GARGGSSLD----GYINEKNKQFNKKLQ 201

>Kpol_2002.32 s2002 (65490..66995) [1506 bp, 501 aa] {ON}
           (65490..66995) [1506 nt, 502 aa]
          Length = 501

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 169 IKRMKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLEG 209
           +KR+K+ A+ ND  G+ +SH  G  S N+  + D ++ + G
Sbjct: 208 LKRIKIVALTNDTVGTFLSHCYGSGSSNSLASGDVSEPVIG 248

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
          YGR129W
          Length = 157

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 1  MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSI 46
          MDM +L +EF+ L+K+  +  IE+RK +           KPK YSI
Sbjct: 3  MDMANLREEFRDLRKKCREIKIENRKLISI-------ASKPKTYSI 41

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
          (REAL)
          Length = 213

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 1  MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMXXXXXXXXXXXL 60
          M++  L  + KVLK++ ++  I++RK  + + +E     KPKVYS+              
Sbjct: 1  MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSME-DVNDGAEPVEDA 59

Query: 61 LTNNSERALLTYTIRDYEEWEE 82
           T++ ++A   YT+++Y  W++
Sbjct: 60 ETSDKDKA-FHYTVQEYNAWKQ 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,498,586
Number of extensions: 691764
Number of successful extensions: 2299
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2258
Number of HSP's successfully gapped: 26
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)