Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042303.489ON65265233440.0
Kpol_480.163.489ON65565619850.0
ZYRO0D10054g3.489ON66466915890.0
TBLA0C044603.489ON69870515880.0
TDEL0D055703.489ON64966115790.0
Suva_7.4163.489ON71371414840.0
KLTH0F14762g3.489ON65066014730.0
Skud_7.4393.489ON71371614730.0
NCAS0E008303.489ON67168414630.0
Smik_6.2243.489ON70570914540.0
YGR128C (UTP8)3.489ON71371414240.0
SAKL0F02838g3.489ON65465913980.0
AFR307C3.489ON65066013241e-175
NDAI0G009603.489ON70071212751e-167
KLLA0E04665g3.489ON64767012681e-166
CAGL0I10560g3.489ON67868812491e-163
Kwal_55.212223.489ON3733818561e-108
KNAG0B008303.489ON6076697742e-93
KAFR0C019403.489ON6096787313e-87
Kwal_55.21225singletonOFF2152114303e-48
NDAI0A087407.27ON72394761.6
KLTH0F01826g1.60ON663108751.8
Kwal_47.171834.291ON140978752.5
TBLA0B08340singletonON19572712.9
KLTH0D15334g4.291ON142078733.7
CAGL0I08415g7.519ON130881724.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04230
         (652 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...  1292   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   769   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   616   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   616   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   612   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   576   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   572   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   572   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   568   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   564   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   553   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   543   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   514   e-175
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   495   e-167
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   493   e-166
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   485   e-163
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   334   e-108
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   302   2e-93
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   286   3e-87
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   170   3e-48
NDAI0A08740 Chr1 (2011619..2013790) [2172 bp, 723 aa] {ON} Anc_7...    34   1.6  
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    33   1.8  
Kwal_47.17183 s47 (287015..291244) [4230 bp, 1409 aa] {ON} YLR41...    33   2.5  
TBLA0B08340 Chr2 complement(1995588..1996175) [588 bp, 195 aa] {...    32   2.9  
KLTH0D15334g Chr4 complement(1263836..1268098) [4263 bp, 1420 aa...    33   3.7  
CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some ...    32   4.6  

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score = 1292 bits (3344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/652 (98%), Positives = 642/652 (98%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120
           NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120

Query: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180
           TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF
Sbjct: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180

Query: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQF 240
           SEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQF
Sbjct: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQF 240

Query: 241 GKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILD 300
           GKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILD
Sbjct: 241 GKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILD 300

Query: 301 LVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINAN 360
           LVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINAN
Sbjct: 301 LVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINAN 360

Query: 361 VGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTENXXXXX 420
           VGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTEN     
Sbjct: 361 VGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTENDIKKF 420

Query: 421 XXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPIHQ 480
                GDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPIHQ
Sbjct: 421 DDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPIHQ 480

Query: 481 TKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIK 540
           TKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIK
Sbjct: 481 TKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIK 540

Query: 541 LELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEY 600
           LELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEY
Sbjct: 541 LELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEY 600

Query: 601 IDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
           IDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL
Sbjct: 601 IDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/656 (58%), Positives = 494/656 (75%), Gaps = 5/656 (0%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPS SQPFRLA+LPKI  LS+   Q   LQ+ADDF+L+SNKITIG+SG  +SQY+INPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQY-KDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFS 119
           ++   VPIPSTNNVTACN+  +  D D  +L E W Y L+ NK +TL+++IKT D DK++
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKL-ECWAYGLSYNKNHTLNISIKTSDDDKYA 119

Query: 120 TTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIY 179
           T+  + +ETY+ KCD  +  IKIN+++K IVV L NG IQ +DF LKLL SVN  Y +I 
Sbjct: 120 TSGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDIS 179

Query: 180 FSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQ 239
           F EHF E+ K FAIILS IEG K+S+KLYELF  DKTSI ELSSTILED    +S+I YQ
Sbjct: 180 FVEHFEEDGKQFAIILSNIEGKKISFKLYELFTNDKTSINELSSTILEDADLGESQICYQ 239

Query: 240 FGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFIL 299
           FGK+YRL+++++++Y+LPQCQL  TI LP I  K S  +SF P++NNRILLTV+NKI++L
Sbjct: 240 FGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYLL 299

Query: 300 DLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINA 359
           DLVH + LAER L HVK++QLLKS+V+ +   + N KTIAIGVS+KNGPSPI++LE+IN 
Sbjct: 300 DLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINV 359

Query: 360 NVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHD---FKYEAILKKLSSTENX 416
           +VG+GTLKDSLG SF V+   K+  LQ LF +D  +  + +   F Y+ IL++L + +N 
Sbjct: 360 DVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQKSFDYKNILQELQNNKND 419

Query: 417 XXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLF 476
                      L I + YYT+ +RFI+D  FLSDV+DLIF  F+K+YP ALTFLLTHPLF
Sbjct: 420 INKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTHPLF 479

Query: 477 PIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTK 536
           PI  T+NLL K R  PRLFKQAVVTCPNLP+ ELL ELF+ITNGEL +DISLRILQDYT+
Sbjct: 480 PISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTR 539

Query: 537 DSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596
           DSIK ELK L+K+DIQNFI+FVID ++E++ + N QLF LLSLVLDASGLF++E   L +
Sbjct: 540 DSIKQELKTLSKVDIQNFIEFVIDTDSEDKSQFNPQLFQLLSLVLDASGLFALEEETLEK 599

Query: 597 LSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
           LS YID QV + E++N+LWHL+D    KR+   Q +   V + K+L+AYSVEYLEL
Sbjct: 600 LSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/669 (49%), Positives = 444/669 (66%), Gaps = 22/669 (3%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPS+ QPFRL++LP+I  LS+Y VQS  L+V+ D + +SNKITIG+S  A+SQY++NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDK-FS 119
            +   + IPSTN V+AC+VA   D       EIW Y +   K + L+ ++K VD D    
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDK-----EIWCYCVKSGKSHFLNASVKPVDADTVLD 115

Query: 120 TTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIY 179
           T   D  E + +K D+ VVGIKI  + K IVV L +G IQ +DF+L+ L+S++ SY N+ 
Sbjct: 116 TDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVK 175

Query: 180 FSEHFVENKKSFAIILSTIEGNKLSYKLYELF---GQDKTSIKELSSTILEDIQCKDSKI 236
              +F EN ++F  +LS  E NK+ +KL+EL    G+  T IKELS+TILE+     SK+
Sbjct: 176 VVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKL 235

Query: 237 SYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKI 296
            YQ GKLY+L  + +  Y+LPQC LV T  LP I    SQ +S  PVS NRILLTV+N++
Sbjct: 236 CYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQV 295

Query: 297 FILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNH----KTIAIGVSVKNGPSPIT 352
           ++LDLVH + L+ER L H K FQLL+S  +  + +        +T+AIGV+ KNG +P +
Sbjct: 296 YLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTS 355

Query: 353 ALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDD-------ANLVKRHDFKYEA 405
           ALE+IN +VGTGTLKDSLG SF      K++ LQPLF+DD       A+  +   F YE 
Sbjct: 356 ALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYED 415

Query: 406 ILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPS 465
           I K+LS                L IQ+ +YTD ERFI D  FLS V+ LI  +F +EYP 
Sbjct: 416 IFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPR 475

Query: 466 ALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVD 525
           ALTFLLTHPLFP   T+ LL + R HPRLFKQA+VTCPNLP+D+LL+ELFSI NGEL +D
Sbjct: 476 ALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLD 535

Query: 526 ISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEE--EKKHNEQLFVLLSLVLDA 583
           ISLRILQD+T D IK E+K LNK+D+ NF++F+I P +EE  + K   +LF LLSLV+DA
Sbjct: 536 ISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDA 595

Query: 584 SGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALT 643
            GLF+++G LL +LS+YID+QV + E++ +LW+L+D     R      +G++  + + L 
Sbjct: 596 IGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLP 655

Query: 644 AYSVEYLEL 652
            Y+VEYLEL
Sbjct: 656 KYTVEYLEL 664

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/705 (47%), Positives = 469/705 (66%), Gaps = 60/705 (8%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVA-DDFTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRLA+LPKIA LS+Y++Q+  LQVA D FT D+NK+T+G+SG  +SQY+INPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQY--------------------KD--ADTEEL------- 90
           P +   + IPSTNNVTA N++ Y                    KD    TEE+       
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 91  -----FEIWVYNLAVNKKNTLHVAIKTVDPDKFSTTQSDALETYTVKCDASVVGIKINKE 145
                 E+W Y L  NK NTL++++KT   D+FSTT  + +   T+K D+ VV IKI KE
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 146 DKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLS- 204
            KTIVV L NG +++FDF L L +S++ +Y+++ F +HF E+K++F +ILS I+  K S 
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240

Query: 205 -YKLYEL-FGQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLV 262
            +KLY+L    D   + ELS +IL+D     SK+SYQFGKLYRL  +++FVYSLPQCQL+
Sbjct: 241 CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL 300

Query: 263 DTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLK 322
             I+L +I        S KPV+NNR++L ++N ++++D +HR+ LAER   HVK FQLL+
Sbjct: 301 QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ 360

Query: 323 SVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKS 382
           S  I   D++   +TIAIGVS K+GP+  +ALE+IN  VG+GTLKDSLG    VSK    
Sbjct: 361 SATI--GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKG--VSKKLSE 416

Query: 383 NI---LQPLF--TDDANLVKR--HD------FKYEAILKKLSSTENXXXXXXXXXXGDLY 429
                L+PLF   D+ +L+    HD      F +  IL  L S++             L 
Sbjct: 417 GSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFES-LE 475

Query: 430 IQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPIHQTKNLLLKLR 489
           I++N+YT+N+RFI D  F+++ IDLIFK F  E+P A TFLLTHPLFPI  T  LL KL+
Sbjct: 476 IKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLK 535

Query: 490 EHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKI 549
           +HPRLFKQA+VTCPNLP+ ELL +LF++ NGEL++DISLR+LQDY+++ +K E+K L+ +
Sbjct: 536 DHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNV 595

Query: 550 DIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIE 609
           DI+NFI+F+I P  EE + +  QLF LLSLVLD+ GLF+++GPLL +LS YI++QV + E
Sbjct: 596 DIENFIEFIITPTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655

Query: 610 KSNKLWHLIDGTLGKR--NNHYQTSGATVPEIKALTAYSVEYLEL 652
           +S++LWHL+D +   R   N Y  S   +   + L+ YSV+YL++
Sbjct: 656 RSSELWHLLDTSTTPRPFKNAYLKS--VIGNKETLSVYSVDYLDI 698

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/661 (49%), Positives = 447/661 (67%), Gaps = 21/661 (3%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPSLSQ F+LA+LP++A LS++  Q+  LQVADD    SN+ITIG+S  A+SQYV+NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120
            +  ++PIPSTN VTAC+VA+  +       EIW Y L   K  TL+VA K    +    
Sbjct: 61  KLVLSIPIPSTNIVTACDVARSDEQ------EIWCYALQAGKVCTLNVASKVSHAEN-GV 113

Query: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180
              D L+   VK D   VG+ +N +DKTIVV L NG IQ +DF+LKLL+S++ SY ++  
Sbjct: 114 NSDDVLK---VKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSV 170

Query: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELF--GQDKTSIKELSSTILEDIQCKDSKISY 238
           ++ F E    F  IL ++  +K+ +KL+EL     ++  IKELSS ILED     SKI Y
Sbjct: 171 TKFFTEGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICY 230

Query: 239 QFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298
           Q G+LYRL  +++ VY+LPQCQLV  +TLP +  + +  IS KP+S+NRIL+T DNKI++
Sbjct: 231 QSGRLYRLIGHEVLVYALPQCQLVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYL 288

Query: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASN--NHKTIAIGVSVKNGPSPITALEI 356
           L+L H + L +R L H+K FQLLKS VI++  +S+  N KT  IGV  K+G +P ++LEI
Sbjct: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348

Query: 357 INANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLV-----KRHDFKYEAILKKLS 411
           +N +VGTGTLKDSLG  F VS    S +L+PLF+D+ N       K   F +  I + L 
Sbjct: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLE 408

Query: 412 STENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLL 471
             +            +L I++ +YT+ +RFI D  FLS+V+ LI +NFQ+EYP ALTFLL
Sbjct: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468

Query: 472 THPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRIL 531
           THPLFP+  T  LL +LREHPRLFKQA+VTCPNLP+ ELL+ELFSI NGELS+DISLRIL
Sbjct: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528

Query: 532 QDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEG 591
           QDYT D IK E++ LNKID+QNFI+FVI  N+E   + + QLF LLSLVLD+ GLF+++G
Sbjct: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDG 588

Query: 592 PLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLE 651
            LL +L++YI ++V + E+++KL HL+D     R      +G+     +A+  Y+VEYL+
Sbjct: 589 VLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLD 648

Query: 652 L 652
           L
Sbjct: 649 L 649

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/714 (47%), Positives = 473/714 (66%), Gaps = 63/714 (8%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+G+SG ++SQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQ--------YKDADTEEL------------FEIWVYNLA 99
           P ++   PIPSTN +TACN  Q         K++D ++              EIW + L 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 100 VNKKN-TLHVAIKTVDPD---------------KFSTTQSDALETYTVKCDASVVGIKIN 143
           VNK N TL+V  K V+ +               K      D L  Y +K    V+ IKI+
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 144 KEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKL 203
            ++  ++  L NG ++ +DFKLKLL+S + SY N+ +++ F EN   F  +L  +E +K+
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240

Query: 204 SYKLYELF---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQ 260
            YKL+EL    G++ + IKELSSTI+E    + SK  YQFGKLY+L + ++ VYSLP CQ
Sbjct: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300

Query: 261 LVDTITLPQIDLKKSQA--ISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMF 318
           L   I +P I+   S+   ISF+PVS NRILLTV+N I++LDL+H + L +R L HV+ F
Sbjct: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360

Query: 319 QLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSK 378
           QLL+S VI++ + S N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF + K
Sbjct: 361 QLLRSAVIDS-EKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 379 SFKSNI-LQPLFTDDA---NLVKRHD---------FKYEAILKKLSSTENXXXXXXXXXX 425
           +  S++ L+PLF D+    N+VKR+D         F+Y+ I+KK+S+ +N          
Sbjct: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479

Query: 426 -GDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483
             DL +++ +YT+ +RFI D  FL+ V+DLIF+ F   +YP ALTFLLTHPLFP+++T N
Sbjct: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHN 539

Query: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543
           LL +LR+ PRLFKQA+VTCPNLP++ELL ELFSI N EL +DIS RILQD+T+DSIK E+
Sbjct: 540 LLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEM 599

Query: 544 KNLNKIDIQNFIDFVIDPNNE---EEKKHNE--QLFVLLSLVLDASGLFSIEGPLLTQLS 598
           KNL+K+DIQNFIDF+ + + +   E   H++  QLF LLSLVLD+ GLFS+EG LL  L+
Sbjct: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLA 659

Query: 599 EYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
            YIDKQVE+ E++ +LW+L++    +       S +   + +AL  Y++EYLE+
Sbjct: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/660 (47%), Positives = 443/660 (67%), Gaps = 18/660 (2%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPS+SQPFRL  LPKIA L++Y  Q   LQVAD  T  +N I +GVSG AVSQY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120
            +    PI STN V+AC VA+      ++  E+  Y +  N+  +L   IK V      +
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120

Query: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180
           +  +    + V     +V +K+  + K+IV  L +G IQ FDF+LKL +S+++SY N+ +
Sbjct: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180

Query: 181 SEHFV-ENKKSFAIILSTIEGNKLSYKLYELFGQDK-TSIKELSSTILEDIQCKDSKISY 238
            +HF  E+ + +  +LS I+G+K+S+KL+E+   D  T   ELSS ILE++  KDS+I Y
Sbjct: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240

Query: 239 QFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298
           QFG++YRL+ N + +Y+LP  Q   TI LP   L     ISFKP+S NR LLT DNKIF+
Sbjct: 241 QFGQVYRLHGNAVSIYNLPHFQHSRTIELPF--LAPESIISFKPISTNRALLTSDNKIFL 298

Query: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358
           LDL+H A L++R +GHVK+FQLL++ VI  N   NN KTIA+GVS+K+G +P ++L+IIN
Sbjct: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNN-KTIALGVSIKHGSNPSSSLDIIN 357

Query: 359 ANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTENXXX 418
            +VGTGTL+DS+G  F +S+  KS  LQPL +   N  +  +F Y+ ILK+LS   +   
Sbjct: 358 IDVGTGTLRDSMGKGF-MSRENKSQHLQPLIST-LNDTEAAEFNYDRILKELSKAADNIE 415

Query: 419 XXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPI 478
                    L I+ NYYTD++RF+ D  FL DV  LIFK+F+ EYP ALT+LLT+PLFP+
Sbjct: 416 NFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPV 475

Query: 479 HQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDS 538
             T NLL KL++HPRLFKQA+VTCPNL +DEL+ ELF++ N EL +D+SLRILQD+ KDS
Sbjct: 476 SHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDS 535

Query: 539 IKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVLLSLVLDASGLFSIEGPLLTQL 597
           IK  +K  +KID+ NFI+FVI  N EE++ K+  +LF LLSLVLD+ GLF++E  +L +L
Sbjct: 536 IKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595

Query: 598 SEYIDKQVEMIEKSNKLWHLID-----GTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
           ++YID+Q+ +++++ +L++L++        G+      TSG  V     +TAYS+E LEL
Sbjct: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPV-----ITAYSIEQLEL 650

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/716 (47%), Positives = 471/716 (65%), Gaps = 67/716 (9%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+G+SG ++SQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQYK------------DADTEEL---------FEIWVYNL 98
           P ++   PIPSTN +TAC+ A+ +            D++ EE           EIW +  
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 99  AVNKKN-TLHVAIKTVDPDKFSTTQ---------------SDALETYTVKCDASVVGIKI 142
            VNK N TL+V  K ++ +K ++ +                D L  + +K  A V+ IKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 143 NKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNK 202
           + ++  I+  L NG I+ +D KLKLL S + SYDN+ +++ F EN   F  +L  +E +K
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 203 LSYKLYELF---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQC 259
           + YK+ EL     +D + IKELSSTI+E    + SK+ YQFGKLY+L + +++VYSLP C
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 260 QLVDTITLPQIDLKKSQ--AISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKM 317
           QL   I LP I+   S+   ISF+PVS NRILLTV+N I++LDL+H + L  R L HVK 
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 318 FQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVS 377
           FQLLKS +I++ + S+N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF V 
Sbjct: 361 FQLLKSALIDS-EKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 378 KSFKSNILQPLFTDD---ANLVKRHD---------FKYEAILKKLSSTENXXXXXXXXXX 425
           K+  S IL+PLF D+    N+VKR+D         F Y+ +++KLS  +N          
Sbjct: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479

Query: 426 -GDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483
             DL +++ +YT+ +RFI D  FL+ V+DLIF  F   +YP ALTFLLTHPLFP+++T  
Sbjct: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHG 539

Query: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543
           LL  LR+ PRLFKQA+VTCPNLP++ELL ELFSI N EL +DIS R+LQD+T+DSIK E+
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEM 599

Query: 544 KNLNKIDIQNFIDFVIDPNNEEE-------KKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596
           K L+K+DIQNFI+ +   N EE+         H+ QLF LLSLVLD+ GLFS+EG LL  
Sbjct: 600 KKLSKLDIQNFIECIT--NTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 597 LSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
           L+ YIDKQV++ E++ +LW+LID    +      +SG+T  + +AL AY++EYL++
Sbjct: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/684 (46%), Positives = 461/684 (67%), Gaps = 45/684 (6%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRL ILPKIA LS++ +QS  +QV D  F+  +NKITIG+SG +VSQY++NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFS 119
           P +    PIPSTN VTACNV + K +  E     W +    NK +TL++    ++ +++ 
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEE----TWCFATMANKTSTLNL----INKNQYQ 112

Query: 120 TTQSDALETYTVKCDASVVG-IKINKEDKTI----------VVTLGNGFIQIFDFKLKLL 168
           T + ++ ++     D+SV    KI  +D  +          +V L NG IQ +DF+LKLL
Sbjct: 113 TNEEESGDS--APSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLL 170

Query: 169 NSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKT---SIKELSSTI 225
           NS+N +Y+N+ F EHF E+ K F  +L  +E +K+  KL+++    +T   S  EL+STI
Sbjct: 171 NSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTI 230

Query: 226 LEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQI-DLKKSQ-AISFKPV 283
           LE+   +++K  YQFGK Y+L  +++ VYSLPQ Q   +ITLP I DLK+ +  +SFKP+
Sbjct: 231 LENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPI 290

Query: 284 SNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVS 343
           S NRILLTV+NKI++LDL+H + L+ER L H+K FQLLK+ V++TN   N ++T+AIGVS
Sbjct: 291 SPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTN--INQNRTLAIGVS 348

Query: 344 VKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNI--LQPLFTDDANLVKRH-- 399
            K G +P ++LE++N +VGT T+KDSLG SF  S S ++N+  L+ LF D+ +   +   
Sbjct: 349 TKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTS-STENNVQSLKSLFDDENDYSDKKKQ 407

Query: 400 --DFKYEAILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFK 457
             +F YE I K+L  ++N              I++ YYT+ +RFI++  FL  +IDLIF+
Sbjct: 408 VKNFNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFE 467

Query: 458 NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSI 517
            F++EYP   T+LLT PLFP+ +TK LL +L  HPRLFKQA+VTCPNLP++ELL ELF+I
Sbjct: 468 TFKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTI 527

Query: 518 TNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNE-QLFVL 576
           +NGELS+DISLRILQDYT+DSIK ELK L KI+++NFI+F+ID  ++ +   N   LF L
Sbjct: 528 SNGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQL 587

Query: 577 LSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLID--GTLGKRNNHYQTSGA 634
           LSLV+D+ GLF+++  +L +LS+YID+QV + + + +LWHL+D    L  +N+ + TS +
Sbjct: 588 LSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTS 647

Query: 635 TVP------EIKALTAYSVEYLEL 652
                    + + L  YSVEYL+L
Sbjct: 648 KDSNTSLKLQEEVLPKYSVEYLDL 671

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/709 (47%), Positives = 467/709 (65%), Gaps = 61/709 (8%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+G+SG +VSQY+INPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQYK-------------DADTEELFEIWVYNLAVNKKN-T 105
           P +    PIPSTN +TACN  + +             ++ T+   EIW + L VNK N T
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 106 LHVAIKTVD---------------PDKFSTTQSDALETYTVKCDASVVGIKINKEDKTIV 150
           L+V  K ++                +   T     L  Y +K  A V+ IKI+ ++  I+
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 151 VTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYEL 210
             L NG I+ +DFKLKLL+S + SYDN+ +++ F EN   F  +L  ++ +K+ YKL EL
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240

Query: 211 F---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITL 267
                ++ + IKELSSTI+E     DSK+ YQFGKLY+L K +++VYSLP CQL   I L
Sbjct: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300

Query: 268 PQIDLK--KSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVV 325
           P I+    +   ISF+PVS NR+LLTV+N +++LDL+H +TL +R L HVK FQLL + V
Sbjct: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360

Query: 326 IETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNIL 385
           I + + S++ KTIAIG+S KNG +P ++LEIIN +VGT TLKDSLG SF   K   S IL
Sbjct: 361 INS-EKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVIL 419

Query: 386 QPLFTDDA---NLVKRHD---------FKYEAILKKLSSTE-NXXXXXXXXXXGDLYIQQ 432
           +PLF D+    N+VKR++         F+Y+ I+ KLS+ + N           DL I++
Sbjct: 420 KPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKE 479

Query: 433 NYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKNLLLKLREH 491
            +YT+ +RFI D+ FL+ V+DLIF+ F   +YP  LTFLLTHPLFP+ +T+NLL  LR+ 
Sbjct: 480 EHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQ 539

Query: 492 PRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDI 551
           PRLFKQA+VTCPNLP++ELL ELFSI N EL +DIS RILQD+T+DSIK E+K L+K+DI
Sbjct: 540 PRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDI 599

Query: 552 QNFIDFVIDPNNE---EEKKHNE--QLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVE 606
           QNFI+F+    N+   E   H++  QLF LLSLVLD+ GLFS+EG LL  L+ YIDKQV+
Sbjct: 600 QNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVK 659

Query: 607 MIEKSNKLWHLID---GTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
           + E++ +LW+LID      G  N  ++++ +   + +AL  Y++EYL++
Sbjct: 660 IAERNTELWNLIDIKSSQHGFTNLAFESASS---QKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/714 (46%), Positives = 463/714 (64%), Gaps = 63/714 (8%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+G+SG ++SQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQYK-------------DADTEELF--------EIWVYNL 98
           P ++   PIPSTN +TACN  + +             +A+ E+          EIW + L
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 99  AVNKKN-TLHVAIKTV--------------DPDKFSTTQSDA-LETYTVKCDASVVGIKI 142
            VNK N TL+V  K +              D D  + T SD  L  Y +K  A V+ IKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 143 NKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNK 202
           + ++  ++  L NG I+IFDFKL LL+S + SYDN+ +++ F EN   +  +L  ++ +K
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 203 LSYKLYEL--FGQDKTS-IKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQC 259
           + YKL EL   G  ++S IKELSSTI+E    ++SK+ YQFGKLY+L + ++++YSLP C
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 260 QLVDTITLPQID--LKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKM 317
           QL   I  P +D        ISF+PVS NR+LLTV+N I++LDL+H +TL++R L HVK 
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 318 FQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVS 377
           FQLLKS VI + + S+N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF V 
Sbjct: 361 FQLLKSAVINS-EKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 378 KSFKSNILQPLFTD-DAN--LVKRHDFKYEA---------ILKKLSS-TENXXXXXXXXX 424
            +  S IL+PLF D D N   VK +D   ++         +++KLS+  +N         
Sbjct: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479

Query: 425 XGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483
             +L I++ +YT+ +R+I D  FL+ V+DLIF  F   +YP  LTFLLTHPLFP+ +T+N
Sbjct: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRN 539

Query: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543
           LL  LR+ PRLFKQA+VTCPNLP++ELL ELFSI N EL +DIS RILQD+T+DSIK E+
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEM 599

Query: 544 KNLNKIDIQNFIDFVIDPNNEEEKK-----HNEQLFVLLSLVLDASGLFSIEGPLLTQLS 598
           K L+K+D+QNFI+F+     +   +      + QLF LLSLVLD+ GLFS+EG LL  L+
Sbjct: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 599 EYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652
            YIDKQVE+ E++ +LW+LID    +      T      + +AL  Y++EYL++
Sbjct: 660 LYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/659 (46%), Positives = 425/659 (64%), Gaps = 14/659 (2%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           M S+SQPFRL  LPKIA L++++ Q+  LQVA+  T  +NKI IGVSG ++SQY+INPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVA--QYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKF 118
            +   + IPST+ VTAC+V+  Q  + DTE   E+W Y L  NK  TL+  IK +  D  
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQ-EVWCYALVANKSFTLNTIIKPLTADAP 119

Query: 119 STTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNI 178
           S   +   E Y V     V  +KI    KTI+  L NG +Q FDF+LKLL+S + SY NI
Sbjct: 120 SVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNI 179

Query: 179 YFSEHFV-ENKKSFAIILSTIEGNKLSYKLYELFGQDK-TSIKELSSTILEDIQCKDSKI 236
              ++F  E  + F I+L+ +  +K+ YKL+E+   D    +KEL+S ILE    ++SK 
Sbjct: 180 SLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKT 239

Query: 237 SYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKI 296
            YQFGK+Y L   ++ +YSLP  QL +TI LP +       +SFKP+S NR LLTVDN+I
Sbjct: 240 FYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV--THENVVSFKPISTNRALLTVDNRI 297

Query: 297 FILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEI 356
           ++LDL+H A L++R L HVK FQLL + +I  N A NN KTIAIGVS K+  +  +AL+I
Sbjct: 298 YLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENN-KTIAIGVSTKSDNNATSALDI 356

Query: 357 INANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKR---HDFKYEAILKKLSST 413
           +N NVG+GTLKDS+   F +++     +L  LF +  + +       F Y  IL +L   
Sbjct: 357 VNINVGSGTLKDSMSKGF-LTQDATEEVLNSLFDEQDDELDEDGTSQFDYNQILSELEKA 415

Query: 414 ENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTH 473
           ++            L I++ YYT+ +RF     FL  V+ LIF+NF KEYP ALT+LLTH
Sbjct: 416 KSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTH 475

Query: 474 PLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQD 533
           PLFP      LL K +EHPRLF+QA+VTCPNLP+D LL ELF++ N EL +D+SLRILQD
Sbjct: 476 PLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQD 535

Query: 534 YTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVLLSLVLDASGLFSIEGP 592
           +TKDSIK  +K ++K+DI NFI FVI+ +++EE+ K   QLF LL+LVLD+ GLF+++G 
Sbjct: 536 FTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGE 595

Query: 593 LLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEI-KALTAYSVEYL 650
            L  L ++I+ QV+++E++ +L +L+D T  K  +   +  A+     +AL +YSVEYL
Sbjct: 596 SLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  514 bits (1324), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 289/660 (43%), Positives = 411/660 (62%), Gaps = 20/660 (3%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           M  ++QPFRLA LPKI+ L++Y  Q+  LQVAD     SN +T+GVSG ++SQYVINPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKK-NTLHVAIKTVD--PDK 117
            +   +PIPSTN VT C+V    D       E+W Y L  N K +TLH  ++     P +
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGA-----ELWSYALTANGKVHTLHAVLRKAGAAPQE 115

Query: 118 FSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDN 177
                S+  E +       VV ++I    K I+V L  G IQ +D++L+LL+S++ SY N
Sbjct: 116 TGLDASED-EHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTN 174

Query: 178 IYFSEHFVENK-KSFAIILSTIEGNKLSYKLYEL-FGQDKTSIKELSSTILEDIQCKDSK 235
           +   E+F ++  K +  +L  I+  K  YKL++L    +   I EL+S ILED    +SK
Sbjct: 175 VGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESK 234

Query: 236 ISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNK 295
           + YQFGKLYRL  ++M+VYSLP  QL   + LP +  +K   +S + +S NR+LLT  NK
Sbjct: 235 MVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV--RKDDQVSLQAISTNRLLLTCCNK 292

Query: 296 IFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALE 355
           IF+LDL+H A L ER L ++K FQLL++ VI       +++T AIGVS K G +P +AL+
Sbjct: 293 IFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALD 352

Query: 356 IINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTEN 415
           ++   VGTGTLKDSLG  F   +  ++  L+PLF  D +     DF   AIL +L+S   
Sbjct: 353 VVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDESPNIDFA--AILAELTS-RT 409

Query: 416 XXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPL 475
                       L  ++ YYT+++RFI +  FL+ ++D IF  F  E+P AL +LLTHPL
Sbjct: 410 TPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPL 469

Query: 476 FPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYT 535
           FP   TK LL KL+ HPRLFKQAVVTCPNLP+DELL ELF++ N ELS+D+SLR+LQ++T
Sbjct: 470 FPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFT 529

Query: 536 KDSIKLELKNLNKIDIQNFIDFVIDPNN--EEEKKHNEQLFVLLSLVLDASGLFSIEGPL 593
           K+ IK  ++ L+++D+ NF++FVI  +   EE +K   QLF LLSLV+DA GL ++EG +
Sbjct: 530 KEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDI 589

Query: 594 LTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQ--TSGATVPEIKALTAYSVEYLE 651
           L +LS +ID QV + ++  +L +L++ +  K+  H    T     P    +  YSVEYL+
Sbjct: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  495 bits (1275), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 317/712 (44%), Positives = 440/712 (61%), Gaps = 72/712 (10%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59
           MPSLSQPFRL +LPKIA LS+Y++Q   +QV    F   +NK+ IGVSG A+SQY+INPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PNVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFS 119
           P +    PIPSTN VTAC+V +  + +T    E+W + L  NK  TL +  K  D  K S
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNN--EVWCFGLVANKTYTLTLITK--DKQKSS 116

Query: 120 TTQSDAL-----------ETYTVKCDASVVGIKINKEDK---TIVVTLGNGFIQIFDFKL 165
            T  D             + + VK D+ +V IKI K+     +I++ L NG IQ F+  L
Sbjct: 117 ATMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSL 176

Query: 166 KLLNSVNTSYDNIYFSEHFVENKKSFAIILSTI-EGNKLSYKLYELFGQDKTSIKELSST 224
           KLLN+V  +Y N+ F EHF E+ K F   +  + + NK+  KL+++   +  S  EL+S 
Sbjct: 177 KLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI---NNDSAIELNSI 233

Query: 225 ILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVS 284
           I+E+   +++K  YQFGK Y+L  N + VYSLPQ QL  T T+P I     Q +S KP+S
Sbjct: 234 IMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIK-TDDQIVSMKPIS 292

Query: 285 NNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSV 344
            NRILLT++NKI++LDL+H + L+ER L H+K  QLL+S VI      NN+KTI IGVS 
Sbjct: 293 TNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI--GKGENNNKTITIGVST 350

Query: 345 KNGPSPITALEIINANVGTGTLKDSLGNSFDVSK-----SFKSNILQPLFTDDAN----- 394
           K G +P ++LEIIN +VG+ TLKDSLG  F            +  L+PLF  + +     
Sbjct: 351 KFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDD 410

Query: 395 -----LVKRHDFKYEAILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLS 449
                LV +  F Y+ IL KLS   N              I++ +YT+N+RFI++  F  
Sbjct: 411 DLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFL 470

Query: 450 DVIDLIFKNF--------QKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVT 501
            +IDLIF+ F          EYP  LTFLLTHPLFP+ +T++LL +   HPRLFKQA+VT
Sbjct: 471 KLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVT 530

Query: 502 CPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDP 561
           CPNLP+ ELL EL +I N ELS+DISLRILQDY+KDSIK EL+NL +++I+NFIDF++  
Sbjct: 531 CPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFIL-- 588

Query: 562 NNE-EEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDG 620
           N+E ++ +++ QLF LL+LVLD+ GLF++   +L  LS YID+QV ++EK+ +LW+LID 
Sbjct: 589 NDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDS 648

Query: 621 -----TLGKRNNHYQTSGATV---------------PEIKALTAYSVEYLEL 652
                +  K++N + ++ A+                 + +AL  YSV+YLEL
Sbjct: 649 NNNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  493 bits (1268), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 279/670 (41%), Positives = 427/670 (63%), Gaps = 43/670 (6%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           M S+SQPFRL+ LPKI  L++Y  Q+  LQV D+ +  +NK+ IG+SG ++SQY+INPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120
            +   +PIPSTN VTAC+V +   A+TE    +W Y L   K + LH+A K +  D  S+
Sbjct: 61  KLVFNLPIPSTNIVTACDVVE-DAANTE----VWCYGLEARKVSHLHLATKPMIQDAVSS 115

Query: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180
           + ++    +  K  + VV IKI  + + ++V L NG IQ FD++LKL N+++ SYD+I F
Sbjct: 116 SNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRF 175

Query: 181 SEHFVENKKS-FAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQ 239
            + F + + + F  +L  +   K+ YKL+++  +  + I EL+S ILE+   +++K+ ++
Sbjct: 176 VQFFQDGQGNDFFFVLCQLSDEKICYKLFQVRSESVSCI-ELNSIILENYTLENAKLCFE 234

Query: 240 FGKLYRLY-KNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298
           FGKLY L   N++ +Y LP  QL  +I LP I   K   +S KPVS+NR+LLT DN I++
Sbjct: 235 FGKLYVLKNSNELSIYQLPHLQLQTSIQLPFI--SKDAVVSIKPVSSNRVLLTADNTIYL 292

Query: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358
           +DL++ A L ++ L ++K  QLL + V++ N + +N KTIA+ V+ KNG +P + L++IN
Sbjct: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQEN-SEDNRKTIALDVTTKNGANPTSYLDVIN 351

Query: 359 ANVGTGTLKDSLGNSFDVSKSFKSNILQPLF--TDDANLVKRHDFKYEAILKKL---SST 413
            +VGTGTLKD++G  F V +  K   LQ LF  +++ + V+     YE I+K+L      
Sbjct: 352 IDVGTGTLKDAMGKGFMVKQKQK---LQKLFEESNEDDDVELPSPDYERIIKQLHICKKI 408

Query: 414 ENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTH 473
           EN            L + + YYTDN+RF+ D   L+ +ID +F NF+ EYP ALT+LLTH
Sbjct: 409 ENFDSIFFKM----LSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTH 464

Query: 474 PLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQD 533
           PLFP    K LL KL+ +PRLFKQA+VTCPN+P+D+LLTELF+ITN EL  DI+LR+LQD
Sbjct: 465 PLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQD 524

Query: 534 YTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEE--KKHNEQLFVLLSLVLDASGLFSIEG 591
           Y K+SIK  ++ + K+DI NF+D +++ N  +   K +  Q+F L+SL++D+ GLF+++ 
Sbjct: 525 YKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDD 584

Query: 592 PLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATV----------PEIKA 641
             L +LS ++D QV ++ ++ +L HL +        HY    + V             + 
Sbjct: 585 EYLEKLSSFVDAQVSVVSQNIELLHLAE--------HYTKHSSVVNNKSNSSTNSSSTQP 636

Query: 642 LTAYSVEYLE 651
           ++AY+V+YLE
Sbjct: 637 ISAYTVDYLE 646

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/688 (41%), Positives = 436/688 (63%), Gaps = 46/688 (6%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPSLSQPFRLA+LPKIA L +++ +   ++VAD FT DSN + +G+SG ++S+YVI PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADT-----------------------EEL--FEIWV 95
            +   VPIPST+ V+ACN+  Y +  T                       EE   +EIW 
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 96  YNLAVNKK-NTLHVAIKTVDPDKFSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLG 154
           Y L+ N K +TL+  I+ VD +  S T+++    +  K    ++ I+++ + K IV+   
Sbjct: 121 YALSANNKTHTLNCLIREVDNNNTSITENNP--QFNAKFKEQIINIEVDTKHKVIVILFE 178

Query: 155 NGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQD 214
            G +Q +D +LKLLNS+NT Y +I   + F EN   + +++S ++  K++ +LYE+  ++
Sbjct: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEE 238

Query: 215 KTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLP---QID 271
           K  +KEL+S+I+E+   +DS + YQFG++YRL+K+++ VYS+P  QL   + +P   +I+
Sbjct: 239 K-KVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIE 297

Query: 272 LKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDA 331
             K+  IS KP++ NR+LLTV NKI++LDL+H++ L+ER + H+K FQ+LK+ +    D 
Sbjct: 298 -DKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM--NRDG 354

Query: 332 SNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTD 391
           S +  T+A+G+S KNG +P +ALEIIN +VG+ +LKDSLG SF    +     L+ LF +
Sbjct: 355 SESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414

Query: 392 DANLVKRHDFKYEAILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDV 451
               +   +F    IL KL +  N            L I++  +T+N RF+ D  FL+ V
Sbjct: 415 PKYELPSINFP--EILGKLKNA-NSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASV 471

Query: 452 IDLIFK--NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDE 509
           +DLIF   ++ K  P +L FLLTHPLFP  +   LL K++ + RLFKQA+VTCPNLP+ E
Sbjct: 472 LDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQE 531

Query: 510 LLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKH 569
           LL ELF+I N EL VDIS+RILQDYTKD+IK E+K L+++ ++NF++F+I  NN E    
Sbjct: 532 LLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVS 591

Query: 570 N-----EQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGK 624
           +      Q+F LLSL+LD+ GLF +E  +L QLS  I+K+V++ E++ +LW+++D  +  
Sbjct: 592 DFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMDAKMLS 651

Query: 625 RNNHYQTSGATVPEIKALTAYSVEYLEL 652
                 T+ + + E  + T Y VEY+++
Sbjct: 652 VKKSSSTAASKLAE-NSQTPYIVEYIDI 678

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  334 bits (856), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 263/381 (69%), Gaps = 14/381 (3%)

Query: 278 ISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKT 337
           +SF P+S NR LLT DNK+++LDL+H A L++R   HVK FQLL + VI  N +SNN  T
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNN-ST 59

Query: 338 IAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVK 397
           IAIGV+ K G +  ++L+++N +VGTGTLKDS+G  F  SK+        L T +   V+
Sbjct: 60  IAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQ 119

Query: 398 RHDFKYEAILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFK 457
            H+  Y  ILK L+ T++            L I+ +YYTD++RF+ D  FL + + LIF+
Sbjct: 120 EHN--YTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFE 177

Query: 458 NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSI 517
           NFQ EYP ALT+LLTHPLFPI  T +LL KL++HPRLFKQA+VTCPNLP+ +LL ELF++
Sbjct: 178 NFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTV 237

Query: 518 TNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVL 576
            N EL +D+SLRILQD++KDSIK  +K  +K+D+  FI+FV++ N +E++ K+  +LF L
Sbjct: 238 INDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQL 297

Query: 577 LSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRN-----NHYQT 631
           L+LVLD+ GLF++E   L +LS YID+Q+ +++++ +L++L+D    +RN       +  
Sbjct: 298 LNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD----ERNFKNILGQHHA 353

Query: 632 SGATVPEIKALTAYSVEYLEL 652
              +V E  A+TAYSVE LEL
Sbjct: 354 DSLSVGE-GAITAYSVEQLEL 373

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  302 bits (774), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 227/669 (33%), Positives = 358/669 (53%), Gaps = 84/669 (12%)

Query: 3   SLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTPNV 62
           S+SQPF +A +P+ A       Q+K+L      T ++N + + VS  ++SQY+INPTP +
Sbjct: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57

Query: 63  SQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFSTTQ 122
             +  IPS   VTA +   Y      + F +++                         + 
Sbjct: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYL-----------------------DESH 94

Query: 123 SDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSE 182
              L++  V C    +  KI+ E       L +G +Q +    ++  + +    +I   E
Sbjct: 95  QIPLKSAVVNC----LSEKIHDESVVTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQVE 149

Query: 183 HFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQFGK 242
            F++ +  +A+I++       S  LYEL  ++ T ++   ST L   Q K  +I    GK
Sbjct: 150 -FIDGQ--YALIVAA-----QSTALYEL--ENLTELR--VSTTLHFEQFK--QIRQHLGK 195

Query: 243 LYR--LYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILD 300
           +Y+  L  N   ++ L     +  + +P +   K   ++F  V ++R+ L + N+I++LD
Sbjct: 196 IYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYLLD 255

Query: 301 LVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSP-ITALEIINA 359
           L H  +    VL H K  QL +  +I    A     + AI +S  +GP     +L+IIN 
Sbjct: 256 L-HLGS----VLSHNKFAQLKQVELI----AGARDGSFAIALS--HGPQDNAVSLDIINL 304

Query: 360 NVGTGTLKDSLGNSFDV----SKSFKSNI-LQPLFTDDANLVKRHDFKYEAILKKLSSTE 414
            +G+ ++KDSLG  F       +S +S + L+P+   DA    +  F Y +ILKKL++  
Sbjct: 305 ELGSRSIKDSLGKGFATFMKERRSAESQVTLRPIL--DAGDKTKRSFDYASILKKLTAAA 362

Query: 415 NXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKE----YPSALTFL 470
                       +LYI Q  YT+ +RFI D  FLS+ + +I KN+  E    YP+A T+L
Sbjct: 363 KDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYL 422

Query: 471 LTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRI 530
           LTHPLFP  +T++LL K+++ PRL+KQ +VTCPNLP+DELLTE F I N ELS+D+SL+I
Sbjct: 423 LTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKI 482

Query: 531 LQDYTKDSIKLELKNLNKIDIQNFIDFVID--PNNEEEKKHNEQLFVLLSLVLDASGLFS 588
           LQDYTKDSIK E+K L ++++ NFI FVI    N++E      QLF LLSLV+D+ GLF+
Sbjct: 483 LQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLFA 542

Query: 589 IEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEI-----KALT 643
           ++G LLT+L+ YID  V++ E + +LW+L++     R N    +G+   +      K   
Sbjct: 543 LDGELLTELAGYIDNMVKIAEMNTELWNLLEF----RTNKASVAGSNRSKYVKTQKKVFP 598

Query: 644 AYSVEYLEL 652
            Y V++LE+
Sbjct: 599 PYLVDHLEI 607

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  286 bits (731), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 223/678 (32%), Positives = 373/678 (55%), Gaps = 95/678 (14%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPS+SQPF +  +PK +  S   V S  L      T +SN + + +S  AVS++VINPTP
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSHSL------TANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120
            +  ++PIPS   VTA +   +  A              VN+K TLH+  K V       
Sbjct: 55  KLINSIPIPSNEVVTAFHDTVFATA-------------TVNQKYTLHLNGKKV------P 95

Query: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYF 180
            QS  ++ ++              E +TI + L NG I+ +D  L + ++  T + ++  
Sbjct: 96  IQSKIMKLFS-------------DESQTITI-LENGTIEKYDSNL-IKSTYKTPHKDLVN 140

Query: 181 SEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQF 240
            E F+E+K  +A+++S     + S  LY++     T I+  +   ++DI   DS      
Sbjct: 141 VE-FIESK--YALLIS-----QNSISLYDI----NTMIELRNVANVQDIV--DSDFKSLD 186

Query: 241 GKLYRLYK--NQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298
           GKLY+  +  ++  ++ +    +V+ IT+P I+  +   +SF  V +N +++ V++ I+ 
Sbjct: 187 GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246

Query: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358
           L+L   + ++   L ++K F+L+        D  +N   + +  + +N    +  L++ N
Sbjct: 247 LNLHLSSVISMSELLNLKWFKLI--------DNLSNQFVLGLSFNNENYKFELINLDL-N 297

Query: 359 ANVGTGTLKDSLGNSF-----DVSKSFKSNILQPLFT---------DDANLVKRHDFKYE 404
           +N G   LKDSLG  F     D     ++ +L+ LF+         +D++    H F Y+
Sbjct: 298 SNFG---LKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYD 354

Query: 405 AILKKLSSTENXXXXXXXXXXGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ---- 460
            I+  L+                  I++ +YT+ +RF+ +  FL+ VI+LI +N++    
Sbjct: 355 KIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTD 414

Query: 461 -KEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITN 519
              YP  LT+LLTHPLFP+  TKNLL K RE PRL+KQA+VTCPNLP+ ELL +LF+I N
Sbjct: 415 GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIEN 474

Query: 520 GELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSL 579
            ELS+DISLR+LQDYTKDSIK ++K L K+DI+NFI+FV     +E+++ + QLF LLSL
Sbjct: 475 NELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV---TQDEDQQVSSQLFQLLSL 531

Query: 580 VLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTS-----GA 634
           ++D+ GLF+++  +L ++S +I+++  + +++++L HL+D    K+++  Q+S       
Sbjct: 532 IIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLINNNN 591

Query: 635 TVPEIKALTAYSVEYLEL 652
                K L  Y+VE+L+L
Sbjct: 592 KSLHRKTLPTYTVEHLDL 609

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  170 bits (430), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 130/211 (61%), Gaps = 4/211 (1%)

Query: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60
           MPS+SQPFRL  LPKIA L++Y  Q   LQVAD  T  +N++ +G+SG A+SQYVINPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  NVSQTVPIPSTNNVTACNVAQYKDADTE---ELFEIWVYNLAVNKKNTLHVAIKTVDPDK 117
            +   +PI STN VTAC+VA+    + E   E  E+  Y L  NK  ++    K +    
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 118 FSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDN 177
             ++  +   T+ V      V +K+    K+IV  L +G IQ FD+ LKL +S+++SY N
Sbjct: 121 TDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGN 180

Query: 178 IYFSEHFV-ENKKSFAIILSTIEGNKLSYKL 207
           + F +HFV E+K+ F  +LS ++G K+S+KL
Sbjct: 181 VQFVQHFVSESKQDFMFLLSDLDGRKVSFKL 211

>NDAI0A08740 Chr1 (2011619..2013790) [2172 bp, 723 aa] {ON} Anc_7.27
           YOR359W
          Length = 723

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 10/94 (10%)

Query: 292 VDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIG-VSVKNGPSP 350
           +D + F+LDL +R+T++   L    + Q        +++ + N  +I +G  S+ + P P
Sbjct: 80  LDQQPFMLDLPNRSTVSSPPLTMHDVSQQYNVPKTSSSNPTPNLNSITVGSTSLLSSPKP 139

Query: 351 I---TALEIIN------ANVGTGTLKDSLGNSFD 375
           +   T +E IN       ++ + TLK+SL  SFD
Sbjct: 140 LPLPTTVENINDFINTQPSIPSATLKNSLQTSFD 173

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 456 FKNFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDE----LL 511
            K FQ E    L  LL H LFP  Q+      LR     + Q  +   ++PIDE     L
Sbjct: 166 LKTFQPEERVKLEHLLQHILFPDDQSIQFETALRNLEETYPQTRLNL-DIPIDEHGNTSL 224

Query: 512 TELFSITNGELSVDI----SLRILQDYTKDSIKLE-LKNLNKIDIQNF 554
             L SI N  L+ D+    + R+L D + +S  ++ +K++N  D   F
Sbjct: 225 HWLCSIANVRLTKDLIHTGADRLLGDMSGESALVKAVKSVNNYDSGTF 272

>Kwal_47.17183 s47 (287015..291244) [4230 bp, 1409 aa] {ON} YLR419W -
            Hypothetical ORF [contig 212] FULL
          Length = 1409

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 537  DSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596
            +S+ L +K++   D+  F+   +DP   +  K +EQL       L ASGL S E  LL++
Sbjct: 991  ESLYLSVKSMGIKDVIGFLGKGLDPPPLDSLKKSEQL-------LTASGLLSEEDNLLSE 1043

Query: 597  LSEYIDKQVEMIEKSNKL 614
            L ++I     M  K  KL
Sbjct: 1044 LGKFISLMPLMDHKHGKL 1061

>TBLA0B08340 Chr2 complement(1995588..1996175) [588 bp, 195 aa] {ON}
           
          Length = 195

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 145 EDKTIVVTLGNGF---IQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGN 201
           ED+  ++  GN     I++ D  L   N+ NTS DNI    +  +  K++ + +  +  N
Sbjct: 118 EDRINIIENGNENKPDIEVNDQSLTTDNNTNTSSDNIETVSNLSKGDKNYNLAIDDVNSN 177

Query: 202 KLSYKLYELFGQ 213
           +L+ K  +L  +
Sbjct: 178 ELTKKDSQLISE 189

>KLTH0D15334g Chr4 complement(1263836..1268098) [4263 bp, 1420 aa]
            {ON} similar to uniprot|Q06698 Saccharomyces cerevisiae
            YLR419W Hypothetical ORF
          Length = 1420

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 537  DSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596
            +S+ L +K++   D+  F+   +DP   +  K +EQL       L  SGL S E  LLT+
Sbjct: 998  ESLYLSVKSMGIKDVVAFLGSGLDPPPLDALKKSEQL-------LTTSGLLSEEDNLLTE 1050

Query: 597  LSEYIDKQVEMIEKSNKL 614
            L ++I     M  K  KL
Sbjct: 1051 LGKFIGLMPVMDHKHGKL 1068

>CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some
           similarities with uniprot|Q06211 Saccharomyces
           cerevisiae YPR164w KIM3 drug resistance
          Length = 1308

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 246 LYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILDLVHRA 305
            Y+ +++ Y L   +L D      ID        FK V NNR+LL    K+++LD+ +  
Sbjct: 713 FYETRIYAYKLDNYKLRDC-KYTSID-NLIGGFKFKKVDNNRLLLYGSKKLYLLDIQNDL 770

Query: 306 TLAERVLGHVKMFQLLKSVVI 326
           T+ E     +++F+ LK+ +I
Sbjct: 771 TIEE-----IEVFENLKNDII 786

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,523,039
Number of extensions: 3357581
Number of successful extensions: 11923
Number of sequences better than 10.0: 73
Number of HSP's gapped: 12365
Number of HSP's successfully gapped: 74
Length of query: 652
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 536
Effective length of database: 40,180,143
Effective search space: 21536556648
Effective search space used: 21536556648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)