Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D042203.488ON31631616130.0
Kpol_480.173.488ON3133197741e-101
TDEL0D055603.488ON3113087234e-94
TBLA0C044503.488ON3093177165e-93
ZYRO0D10076g3.488ON3053166748e-87
YPR147C3.488ON3043186549e-84
Smik_16.4003.488ON3043186434e-82
NCAS0F035303.488ON3133246314e-80
Skud_16.4423.488ON3043186295e-80
Suva_16.4763.488ON3043176262e-79
Kwal_55.212193.488ON3022796225e-79
KLTH0F14740g3.488ON3023056165e-78
CAGL0L08514g3.488ON3123215932e-74
SAKL0F02860g3.488ON3052785713e-71
NDAI0B058303.488ON3293365516e-68
Ecym_12413.488ON3053085131e-62
AFR306C3.488ON3192844951e-59
YGR212W (SLI1)5.119ON46866750.60
TPHA0L016008.524ON372132750.60
KLTH0G10912g2.306ON436106711.9
Kpol_1028.877.497ON44747702.8
KLTH0D10670g8.652ON44481693.4
CAGL0G07491g1.156ON44159684.8
CAGL0M05467g8.524ON354229675.5
Smik_2.3458.524ON37559668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04220
         (316 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   625   0.0  
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   302   e-101
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   283   4e-94
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   280   5e-93
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   264   8e-87
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   256   9e-84
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   252   4e-82
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   247   4e-80
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   246   5e-80
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   245   2e-79
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   244   5e-79
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   241   5e-78
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   233   2e-74
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   224   3e-71
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   216   6e-68
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   202   1e-62
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   195   1e-59
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    33   0.60 
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    33   0.60 
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...    32   1.9  
Kpol_1028.87 s1028 (195196..196539) [1344 bp, 447 aa] {ON} (1951...    32   2.8  
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    31   3.4  
CAGL0G07491g Chr7 (711001..712326) [1326 bp, 441 aa] {ON} simila...    31   4.8  
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    30   5.5  
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    30   8.1  

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/316 (96%), Positives = 304/316 (96%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPG           
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120
            HVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120

Query: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180
           HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV
Sbjct: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180

Query: 181 SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRH 240
           SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRH
Sbjct: 181 SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRH 240

Query: 241 DWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVP 300
           DWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVP
Sbjct: 241 DWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVP 300

Query: 301 HAFVIKNSCHVVDNYF 316
           HAFVIKNSCHVVDNYF
Sbjct: 301 HAFVIKNSCHVVDNYF 316

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  302 bits (774), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 212/319 (66%), Gaps = 14/319 (4%)

Query: 3   ITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXXXH 62
           + VF+DS +PTSI+ +      D L+ +L+  D  SPLFVWIPGNPG            H
Sbjct: 4   VKVFEDSIYPTSIVHL------DPLTKELSPED--SPLFVWIPGNPGLLEYYVDFLALVH 55

Query: 63  VKNPEWDILGISHAGMS-SGNSNLKE----NECSVYTLDEQIHHKIEIINKFAAYGRELI 117
            KNP W++LGISHAGMS  GN   K+    ++  V+ L+EQ+ HK++IINKF++  R LI
Sbjct: 56  KKNPTWEVLGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLI 115

Query: 118 VMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLA 177
           +MGHSVGA++ Q+V+M+NKL GK+ K+G L PTV+DIHLS+KG +++ + NW  NLP   
Sbjct: 116 IMGHSVGAYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHV 175

Query: 178 GWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQI 237
           GW+S+ IF   LP+  VKF IS  ++ + ++ A  A+ T L+++N +EQ+LGLA YEM+ 
Sbjct: 176 GWISQFIFHKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEA 235

Query: 238 IRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITD 297
           I  DW F ++L+  CN   ++ W LFAE DHWV++ TR E+I+ Y+     +     I D
Sbjct: 236 IHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-D 294

Query: 298 QVPHAFVIKNSCHVVDNYF 316
            +PHAFVIK S ++VD YF
Sbjct: 295 TIPHAFVIKKSKYIVDQYF 313

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  283 bits (723), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 197/308 (63%), Gaps = 12/308 (3%)

Query: 11  FPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDI 70
           +PTSI+  K   +         +     PLFVWIPGNPG            H ++PEW++
Sbjct: 11  YPTSIVHFKSISI---------RGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEV 61

Query: 71  LGISHAGMSSGN--SNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMGHSVGAFMA 128
           LGISHAGMS+ +   + K     VY+L +QI HK+EII  F++  R LI+MGHSVGA+M 
Sbjct: 62  LGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMV 121

Query: 129 QKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGF 188
           Q +V+S+KL GKV K+GLL PT++DIH S+KG  ++ +L W+ +LPQLAGW S  +FG F
Sbjct: 122 QHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFF 181

Query: 189 LPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQREL 248
           LP  +++ ++SFFM  +  +     T   L++  FV+Q+LGL+ YEM+ IR DW FQR L
Sbjct: 182 LPSFILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRL 241

Query: 249 VKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVPHAFVIKNS 308
           +  CN   I  W LF++SDHWV++ TR +LI+ YR+   +D      T ++PH+FV+ +S
Sbjct: 242 IVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLNHS 300

Query: 309 CHVVDNYF 316
            +++  YF
Sbjct: 301 KYLISEYF 308

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  280 bits (716), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 196/317 (61%), Gaps = 9/317 (2%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           MTI ++ DS++PTSI+           + D   T+  +PLF+WIPGNPG           
Sbjct: 1   MTIQIYPDSRYPTSIVHFPP-------AKDYKITED-TPLFIWIPGNPGLLEYYTKMLRS 52

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120
            H K P W+ILG+SHAGMS+GN         VYTLDEQ+ HK+E+IN F++  R +I+MG
Sbjct: 53  LHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMG 112

Query: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180
           HSVGA+MAQ+V+M + L G V K+GL+ PTV+DIH S KG +++   N    LP   G +
Sbjct: 113 HSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLL 172

Query: 181 SEKIFGGFLPITLVKFIISFFMEL-NNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIR 239
           S   F    P    +++++  M   NN+N AA A+  FL + +FV+Q LGLA +EM+ IR
Sbjct: 173 STLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIR 232

Query: 240 HDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQV 299
            DW FQ+ L+  CN   +  W LF+ +DHWVS+ TR+ELI  YR +  SD    S+++ +
Sbjct: 233 DDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNII 292

Query: 300 PHAFVIKNSCHVVDNYF 316
           PH+FVI  S   V++YF
Sbjct: 293 PHSFVINFSDFTVNSYF 309

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  264 bits (674), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 193/316 (61%), Gaps = 11/316 (3%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M+I     ++ PTS+L IK    +               LFVWIPGNPG           
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPSSP-----------LFVWIPGNPGIVQYYEEFLNL 49

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120
            H K   ++IL ISHAGM++ + +L++ + ++YTLD+QI HK+EIIN+F+A  R LIVMG
Sbjct: 50  LHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMG 109

Query: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180
           HSVGA+MAQ VV++ KL G+V K+GL+ PTV+DIH S+KGTQ++    W+  LP +A WV
Sbjct: 110 HSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWV 169

Query: 181 SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRH 240
           S+ +F     I     +IS FM ++ E+     + + +++   + Q+LGLA  EMQ IR 
Sbjct: 170 SDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRG 229

Query: 241 DWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVP 300
            W FQ++L+  CN N+IE   +F+ +D WVSN TR  L+  YR +        S++  + 
Sbjct: 230 CWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLA 289

Query: 301 HAFVIKNSCHVVDNYF 316
           H+F++K+S ++VD YF
Sbjct: 290 HSFIVKHSKYIVDEYF 305

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  256 bits (654), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 195/318 (61%), Gaps = 16/318 (5%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           MT+  +  SK P SIL+IK T         +TK+ + +PL VWIPGNPG           
Sbjct: 1   MTVKEYTKSKLPCSILNIKPT---------VTKSGEDAPLLVWIPGNPGLLYYYQEMLHH 51

Query: 61  XHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119
            H+K+P+W+ILGISHAGM+ + +SN       +++L +Q+ H++E+IN F+   R++I+M
Sbjct: 52  LHLKHPDWEILGISHAGMTLNAHSN-----TPIFSLQDQVDHQVEVINNFSCKNRKIIIM 106

Query: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179
           GHSVGA++ QKV +SNKL G V+K+GL+ PTV+DIH SE G +++  L +IP L  +   
Sbjct: 107 GHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSL 166

Query: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238
            S   F   L     +FII  FM   +   +A  +T  FL    FV QSLGLA  EM+ I
Sbjct: 167 FSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEI 226

Query: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298
             +WEFQ   +  C  N I +W LF+ +DHWVS +TRS L + Y++ V  +     +TD+
Sbjct: 227 TTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDK 286

Query: 299 VPHAFVIKNSCHVVDNYF 316
           +PH+FV+K++ + ++ +F
Sbjct: 287 IPHSFVVKHAEYAINAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  252 bits (643), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 196/318 (61%), Gaps = 16/318 (5%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M I  +  SKFP SIL+IK T         +T++D+ + L VWIPGNPG           
Sbjct: 1   MPIQEYTKSKFPCSILNIKPT---------ITRSDEDAALLVWIPGNPGLLYYYQEMLQY 51

Query: 61  XHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119
            H K+P+W+ILGISHAGM+ + +SN       VY+L +Q+ H++E+IN F+   R++I+M
Sbjct: 52  LHSKHPDWEILGISHAGMTLNAHSN-----TPVYSLQDQVDHQVEVINNFSHENRKIIIM 106

Query: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179
           GHSVGA++ QKV +S+ L G V+K+GL+ PTV+DIH SE G +++T L++IP L  +   
Sbjct: 107 GHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSL 166

Query: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238
            S   F   L     +FII  FM   + + +A  +T  FL    FV QSLGLA  EM+ I
Sbjct: 167 FSYIFFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEI 226

Query: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298
             +WEFQ + +  C  N   +W LF+ +DHWVS +TRS L   Y++ V+ +     +TD+
Sbjct: 227 TTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDK 286

Query: 299 VPHAFVIKNSCHVVDNYF 316
           +PH+FV+K++ + ++ +F
Sbjct: 287 IPHSFVVKHAKYAINTFF 304

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  247 bits (631), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 193/324 (59%), Gaps = 19/324 (5%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M++  + D +FPT ++ I              KT +++P+FVWIPGNPG           
Sbjct: 1   MSVEAYDDDEFPTCVVHILPI-----------KTAEINPVFVWIPGNPGILEYYQEMLIN 49

Query: 61  XHVKNPEWDILGISHAGMSSGNSNL----KENECSVYTLDEQIHHKIEIINKFAAYGR-E 115
            H K+P W+IL ISH GM++  ++L     ++   V+TL EQI HKI+IIN F       
Sbjct: 50  LHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVP 109

Query: 116 LIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNW-IPNLP 174
           + + GHSVGA+M QK+V S++L G+V K+GL+ PT+IDIHLSEKG  ++    W    LP
Sbjct: 110 IYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLP 169

Query: 175 QLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYE 234
            +  ++   +FG  +P  L  +II + M  +++++AA +T  FL   NFV QSLGLA+ E
Sbjct: 170 HILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEE 229

Query: 235 MQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNS--DYYS 292
           M  I  DW+FQ EL++ C  N I++  LF+ +DHWV   TR E+I+ Y+           
Sbjct: 230 MDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLK 289

Query: 293 YSITDQVPHAFVIKNSCHVVDNYF 316
             ++DQ PH+FV++ S +VV++YF
Sbjct: 290 IDVSDQFPHSFVVRRSKYVVEHYF 313

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  246 bits (629), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 196/318 (61%), Gaps = 16/318 (5%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M +  +  S  P SIL+IK + VA E        ++ +PL VWIPGNPG           
Sbjct: 1   MPVQEYTKSTLPCSILNIKPS-VATE--------NEDAPLLVWIPGNPGLLYYYQEMLQH 51

Query: 61  XHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119
            H K+P+W+ILG+SHAGM+ + +SN       +++L +Q+ H++E+IN F+   R++I+M
Sbjct: 52  LHSKHPDWEILGVSHAGMTLNAHSN-----TPIFSLQDQVDHQVEVINNFSHENRKIIIM 106

Query: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179
           GHSVGA++ QKV +S+KL G V+KIGL+ PTV+DIH SE G +++ +L++IP L  +   
Sbjct: 107 GHSVGAYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSL 166

Query: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238
           +S   F   L   L +F+I  FM   +   +A  +T   L    FV QSLGLA  EM+ I
Sbjct: 167 LSYVFFYWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEI 226

Query: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298
             +WEFQ E +  C  N+I +W LF+  DHWV+++TR+ L   Y++ +  +     +TD+
Sbjct: 227 TTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDK 286

Query: 299 VPHAFVIKNSCHVVDNYF 316
           +PH+FV+K++ + V+ +F
Sbjct: 287 IPHSFVVKHAEYAVNTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  245 bits (626), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 126/317 (39%), Positives = 191/317 (60%), Gaps = 14/317 (4%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M+I  +  SK P SIL+IK T   D         ++ +PL VWIPGNPG           
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTD---------NEDAPLLVWIPGNPGLLHYYQEMIHH 51

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120
            H+K+P+W+ILGISHAGMSS   N + N   +++L +Q+ H++++IN F+   R++I+MG
Sbjct: 52  LHLKHPDWEILGISHAGMSS---NARSN-TPIFSLQDQVDHQVKVINNFSHDNRKIIIMG 107

Query: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180
           HSVGA++ QKV +SN+L G V K+GL+ PTV+DIH SE G +++T  +++P L  +  ++
Sbjct: 108 HSVGAYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFI 167

Query: 181 SEKIFGGFLPITLVKFIISFFMELNNE-NKAAHATYTFLKDSNFVEQSLGLAKYEMQIIR 239
           S   F   L   L K II  FM       +A  +T  FL    FV QSLGLA  E++ I 
Sbjct: 168 SYVFFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEIT 227

Query: 240 HDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQV 299
            +WEFQ + +  C    I  W LF+  DHWV+++TR  L   Y + V  ++    +TD++
Sbjct: 228 TNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKM 287

Query: 300 PHAFVIKNSCHVVDNYF 316
           PH+FV+K++ + ++ +F
Sbjct: 288 PHSFVVKHAEYAINAFF 304

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 38  SPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDE 97
           +PLFV+IPGNPG            H KNP W+ILGISHAGM+S +    E    VY+L++
Sbjct: 29  APLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS----EEVSPVYSLEQ 84

Query: 98  QIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLS 157
           QI HKIEIIN++   G+ +I+MGHSVGAFM QK+  S +L+ KV ++GLL PTVIDIH S
Sbjct: 85  QIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKS 144

Query: 158 EKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTF 217
           EKG ++++I  W P+   +   ++  +F   LP  + K IIS  ++ + ++     T   
Sbjct: 145 EKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD-DPQSCLGATTELL 203

Query: 218 LKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSE 277
           + +S FV+Q+LGLA  E+++IR DW +Q+E + +C  N  ++W LF+E DHWVS  TR++
Sbjct: 204 VTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRND 263

Query: 278 LIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHVVDNYF 316
           +I+ YR   +       ++  + HAFV +++  V+  YF
Sbjct: 264 IIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  241 bits (616), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 184/305 (60%), Gaps = 14/305 (4%)

Query: 12  PTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDIL 71
           P+SIL +K       L  D       + LFV+IPGNPG            H KNP+W+IL
Sbjct: 12  PSSILHLKSG--VSSLGSD-------ACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEIL 62

Query: 72  GISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKV 131
           GISHAGM+S N    +  C VYTL EQI+HK+++IN +A   +++ +MGHSVGAF+AQKV
Sbjct: 63  GISHAGMNSCN----DIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKV 118

Query: 132 VMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPI 191
           V S  L  +V ++GLL PTVIDIH SEKG +++ I    P   QL   +    F    P 
Sbjct: 119 VTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPD 178

Query: 192 TLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKM 251
            L  +IIS F + + +     AT   L +S FV+Q+LGLA  EMQ+IR DWE+Q++ +  
Sbjct: 179 FLTSWIISHFAD-DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHY 237

Query: 252 CNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHV 311
           C     ++W LF+++DHWVS++TR +LI+ Y    + +  S  ++  + HAFV +++  V
Sbjct: 238 CETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVV 297

Query: 312 VDNYF 316
           V +YF
Sbjct: 298 VQHYF 302

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  233 bits (593), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 178/321 (55%), Gaps = 14/321 (4%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M++  + DS  PT I+ IK T         +T  D+ SPLFVWIPGNPG           
Sbjct: 1   MSVQGYHDSALPTCIIHIKPT---------VTNNDESSPLFVWIPGNPGLLEYYQEFLAK 51

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKE---NECSVYTLDEQIHHKIEIINKFA-AYGREL 116
            H KNP W+ILGISHAG    +S LK+   N   +Y L +Q  HKI+IINK      REL
Sbjct: 52  VHDKNPTWEILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNREL 111

Query: 117 IVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQL 176
           ++MGHSVGA++AQ VV S  L G+V K+GL+ PT+ DIH S  G   + + N+I N+ + 
Sbjct: 112 VIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEY 171

Query: 177 AGWVSEKIFGGFLPITLVKFIISFFMELN-NENKAAHATYTFLKDSNFVEQSLGLAKYEM 235
             ++S  IF   +P    K +ISF M  + +E      T+  L     + Q LGLA +EM
Sbjct: 172 LSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEM 231

Query: 236 QIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSI 295
             IR DW FQ  L+  C  N  +LW LF+++DHWVS  T++ELI+  ++          +
Sbjct: 232 LEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDV 291

Query: 296 TDQVPHAFVIKNSCHVVDNYF 316
              + H+FV+K+   V   YF
Sbjct: 292 DKDIKHSFVVKDVDLVTRRYF 312

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  224 bits (571), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 166/278 (59%), Gaps = 2/278 (0%)

Query: 38  SPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDE 97
           +PLFV+IPGNPG              K+  W+ILGISHAGM +    LK+    VY+L +
Sbjct: 29  TPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKK-PTKVYSLKD 87

Query: 98  QIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLS 157
           Q+ HKI +IN F +  R LI+ GHS+GA++ QK+ +   L G VKKI LL PTVIDIHLS
Sbjct: 88  QVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLS 147

Query: 158 EKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTF 217
           EKG +++ I  W PN        S  +F   LP T+ + I+S F+  + +     A    
Sbjct: 148 EKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVG-SEQTCVREAAKLL 206

Query: 218 LKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSE 277
           + +  FV+QSLGLA+ EMQ +R DW FQ   ++ C   ++EL  LFA  DHWV++QTR +
Sbjct: 207 VTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFD 266

Query: 278 LIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHVVDNY 315
           L E Y ++   D+ +    +++ H+FV+ ++  VVD Y
Sbjct: 267 LAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  216 bits (551), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 189/336 (56%), Gaps = 27/336 (8%)

Query: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXX 60
           M +  + +SK+PTSI+ I+    A++L   +     L+PLF+WIPGNPG           
Sbjct: 1   MLVKSYSESKYPTSIIHIE----AEKL---IENDPSLNPLFIWIPGNPGILQYYQQFLCS 53

Query: 61  XHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYG------- 113
            H K+P W+IL I HAGM +     +     +Y L+EQI HKIE+I  F           
Sbjct: 54  LHKKHPHWEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIM 113

Query: 114 --RELIVMGHSVGAFMAQKVVMSNKLEGKV-------KKIGLLMPTVIDIHLSEKGTQIS 164
             R L++MGHSVG +M Q++V++ + +  +       KKIG + PT+IDI+LS KG  IS
Sbjct: 114 KKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILIS 173

Query: 165 TILNWIPN-LPQLAGWVSEKIFGGFLPI--TLVKFIISFFMELNNENKAAHATYTFLKDS 221
             L      LP +  ++S  +F   L     + + +I++ M     + AA  T   L +S
Sbjct: 174 HGLQLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNS 233

Query: 222 NFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIEL 281
             V+QSLGLA  EMQ IR +W+ Q++ V+ CN N I+LW LF E+DHWV+N TR++LI+ 
Sbjct: 234 VLVKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKF 293

Query: 282 YR-NSVNSDYYSYSITDQVPHAFVIKNSCHVVDNYF 316
           Y+ N  +       ++ + PH+FV+ +S  VV+ +F
Sbjct: 294 YQSNYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  202 bits (513), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 176/308 (57%), Gaps = 17/308 (5%)

Query: 21  TYVADELSVDL----TKTDKLSPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDILGISHA 76
           TY+ +++  D+    +++    PL ++IPGNPG            H +NP W+++GI H 
Sbjct: 3   TYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHT 62

Query: 77  GMSSGNSNLKENEC---SVYTLDEQIHHKIEIINKFAAYG--RELIVMGHSVGAFMAQKV 131
           GMSS    L+EN      V+TLDEQI  K+++IN+F   G  R + ++GHS+GA+M QK+
Sbjct: 63  GMSS----LRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKI 118

Query: 132 VMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPI 191
            +   L GK+  + LL PT+IDIH S KG Q++ I +W P   + A  V   +F   LP 
Sbjct: 119 ALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPT 178

Query: 192 TLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKM 251
           + +++I    +  ++E     +    +    FV+Q+LGLA+ EM  +R+ W+FQ E +  
Sbjct: 179 SWIEWIARKLIGGSDEC-VLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISF 237

Query: 252 CNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNS---DYYSYSITDQVPHAFVIKNS 308
           C  N+I++  LF+  DHWV   T  ++IELY    +S   D  + +I   + H+FV+K++
Sbjct: 238 CQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDT 297

Query: 309 CHVVDNYF 316
             VV+ YF
Sbjct: 298 TKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  195 bits (495), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 161/284 (56%), Gaps = 12/284 (4%)

Query: 40  LFVWIPGNPGXXXXXXXXXXXXHVKNPEWDILGISHAGMSS--GNSNLKENECSVYTLDE 97
           + +++PGNPG            H KNP W+I+GISH GMS+  G  +LK     VYTL E
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR----VYTLVE 96

Query: 98  QIHHKIEIINKFAAYGRELIV--MGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIH 155
           Q+ HK++ IN F      L V  +GHS+GA+MAQKVV+   L   V+ +GLL PT+IDIH
Sbjct: 97  QVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIH 156

Query: 156 LSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATY 215
            S KG Q++ I  W P   +    V   +    LP T + ++    +  ++E     +  
Sbjct: 157 RSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDEC-VLQSAE 215

Query: 216 TFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTR 275
             +K+ ++V Q+LG+A+ EM  +R+ W+FQ E +K C   +  LW LF+  DHWV + T 
Sbjct: 216 KLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTM 275

Query: 276 SELIELY--RNSVNSD-YYSYSITDQVPHAFVIKNSCHVVDNYF 316
            +++E Y  +   N+D     +I + + H+FV+K++  VV+ YF
Sbjct: 276 KDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 205 NNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQ------RELVKMCNVNQIE 258
           NN N    A Y+F KD    + S G  KY+++   H WEF+       ++++ C  N   
Sbjct: 209 NNRNLIQFANYSFPKDLLDDKPSDGTQKYKVKNTNHQWEFRLSPTHLNDILQECKANNTS 268

Query: 259 LWTLFA 264
           L +L  
Sbjct: 269 LTSLLG 274

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/132 (20%), Positives = 57/132 (43%), Gaps = 4/132 (3%)

Query: 19  KGTYVADELSVDLTKTDKLSPLFVWIPGNPGXXXXXXXXXXXXHVKNPEWDILGISHAGM 78
           KG   +  +  +L +   +  ++++I G  G             + N  +  + +   G 
Sbjct: 70  KGLSGSVRICHNLKEQSSIDEIYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQ 129

Query: 79  SSGNSNLKENECSVYTLDEQIHH-KIEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKL 137
           S  N    E   + Y++   I   K ++ +++     ++I+ GHS+G ++A       K 
Sbjct: 130 SEFND---EYNIANYSMSSIIGFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKT 186

Query: 138 EGKVKKIGLLMP 149
           E +++KI LL P
Sbjct: 187 EYQIQKIVLLAP 198

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 149 PTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNEN 208
           PTV   + S  G + S  + ++ NL  LA  V+E++   +  +      +   M+ NN+ 
Sbjct: 50  PTVTPANASRGGRETSDRILYVGNL-DLA--VTEEMLKQYFQVGGSIANVKILMDKNNK- 105

Query: 209 KAAHATYTFLK-----DSNFVEQSLGLAKYEMQIIRHDWEFQRELV 249
               A Y F++     D+N   Q+L   + E  +I+ +W FQ + V
Sbjct: 106 ---QANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQV 148

>Kpol_1028.87 s1028 (195196..196539) [1344 bp, 447 aa] {ON}
           (195196..196539) [1344 nt, 448 aa]
          Length = 447

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 94  TLDEQIHHKIE-IINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEG 139
           TL  Q  HK++ I   +  Y   ++V+GHS+GA MA    +  KL G
Sbjct: 273 TLGRQFLHKVDSIFETYPTYN--IVVVGHSLGAAMASIAAIELKLRG 317

>KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some
           similarities with uniprot|P32490 Saccharomyces
           cerevisiae YOR231W MKK1 Mitogen-activated kinase kinase
           involved in protein kinase C signaling pathway that
           controls cell integrity upon activation by Bck1p
           phosphorylates downstream target Slt2p functionally
           redundant with Mkk2p
          Length = 444

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 181 SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKD-SNFVEQSLGLAKYE----M 235
           S+K+     PI L+  I++F  ELN+      +  T+ K   +F++  L     E     
Sbjct: 360 SDKMAANMPPIELLMLILTFTPELND---IPESNVTWSKSFKSFIQYCLNKEPRERPSPR 416

Query: 236 QIIRHDWEFQRELVKMCNVNQ 256
           Q++RH W  Q  + K CN+++
Sbjct: 417 QMLRHPW-IQGHMKKPCNMHK 436

>CAGL0G07491g Chr7 (711001..712326) [1326 bp, 441 aa] {ON} similar
           to uniprot|P46985 Saccharomyces cerevisiae YJL183w MNN11
          Length = 441

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%)

Query: 115 ELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNL 173
           +L+   H  G       +++N L GK+    L  P V D H  +  TQ   +LNW P L
Sbjct: 315 DLVFPQHDNGVLDLSAFIVANSLHGKMFLDYLNDPLVRDYHWDDIYTQYGHVLNWHPEL 373

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 82/229 (35%), Gaps = 31/229 (13%)

Query: 69  DILGISHAGMSS-GNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMGHSVGAFM 127
           D+ G   +G S+ G   L         +D  I +K +I         +  V+GHS+G ++
Sbjct: 109 DLPGFGQSGSSTNGYDMLYVTSVVKKVVDNNIENKTDI---------DFKVVGHSMGCYI 159

Query: 128 AQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTI----LNWIPNL--------PQ 175
           A   V     E  + K+ L  P    I    +   I  +    L W P +         Q
Sbjct: 160 ASHFVQMYHEEYNIDKLVLTCPPPPSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVWFDQ 219

Query: 176 LAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEM 235
             G  S  I   F   T        F +   ENK       +   +N    +  +  Y +
Sbjct: 220 SKGLNSSGIMNFFSANT------ETFQDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFL 273

Query: 236 QIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRN 284
                DWE   +L  + N N +EL  ++AE D     Q    + + ++N
Sbjct: 274 GWKFPDWE---DLDNIINTNNVELVVIYAEHDKITPKQDAQLIFDAFKN 319

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 113 GRELIVMGHSVGAFMAQKVVMSNKLEGK-VKKIGLLMPTVIDIHLSEKGTQISTILNWI 170
           G +L+++GHS+G F+A  +   + ++ K VK + LL P    I   E+ ++   I  W+
Sbjct: 168 GHKLVLVGHSMGCFLACHLYEQHLVDAKVVKTLVLLTPPKAHI---EQLSKDKRIYQWV 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,416,104
Number of extensions: 1407112
Number of successful extensions: 3837
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3881
Number of HSP's successfully gapped: 36
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)