Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D040603.455ON1201120157460.0
Kpol_1050.883.455ON1213122324240.0
Smik_16.3713.455ON1208115921760.0
NCAS0A116303.455ON1201115421730.0
Skud_16.4123.455ON1208116321460.0
YPR122W (AXL1)3.455ON1208115921450.0
Suva_16.4513.455ON1218116121290.0
NDAI0A046503.455ON1199115920980.0
TBLA0C054503.455ON1202115820910.0
ZYRO0C06336g3.455ON1189116020340.0
SAKL0F06886g3.455ON1183116320160.0
KAFR0A053703.455ON1201116819940.0
TDEL0F034003.455ON1170120919760.0
KNAG0A077403.455ON1197117219490.0
Ecym_44043.455ON1196120419030.0
KLTH0E05104g3.455ON1185115818480.0
AGR251C3.455ON1193115818460.0
Kwal_55.204643.455ON1189116118380.0
KLLA0D15631g3.455ON1170116215130.0
CAGL0D04686g3.455ON1181120613681e-168
NCAS0J014704.246ON9952713831e-36
TDEL0E012504.246ON9952423786e-36
Suva_10.5064.246ON10232443786e-36
KAFR0A059704.246ON10112303742e-35
KNAG0B060804.246ON9962253723e-35
TBLA0I029404.246ON9652483714e-35
Smik_12.4764.246ON10252443714e-35
YLR389C (STE23)4.246ON10272443681e-34
NDAI0J022404.246ON9992473671e-34
TPHA0B022604.246ON10412223634e-34
KLTH0D14278g4.246ON10013923625e-34
CAGL0H06457g4.246ON10082273553e-33
Skud_12.4744.246ON10222443553e-33
AER053C4.246ON10133913554e-33
SAKL0H03124g4.246ON10062413545e-33
Kwal_23.42374.246ON10012233455e-32
Kpol_1055.834.246ON10202443448e-32
ZYRO0B12320g4.246ON9942303402e-31
KLLA0E05105g4.246ON10042223365e-31
Ecym_32734.246ON10232433359e-31
TBLA0A080504.246ON9952433242e-29
AGL138C8.376ON4702251272e-06
Kpol_1024.23singletonOFF4542341192e-05
Kpol_YGOB_1024.238.376ON4642341192e-05
Kwal_23.33458.376ON4582211173e-05
TBLA0H010108.376ON4992251174e-05
CAGL0H02739g8.376ON4652411157e-05
SAKL0H14168g8.376ON4612331149e-05
Smik_12.2258.376ON4622331121e-04
SAKL0G05236g5.541ON986981141e-04
YLR163C (MAS1)8.376ON4622251084e-04
KLLA0D18095g8.376ON4692211085e-04
KAFR0H020308.376ON4622251075e-04
TPHA0C024508.376ON4692191067e-04
NCAS0C029708.376ON4612281050.001
NCAS0F011405.541ON9881131050.001
Skud_12.2308.376ON4622251020.002
TBLA0A069405.541ON9911031020.002
KNAG0A027608.376ON4672191010.003
CAGL0I07535g3.93ON10211281010.004
KLLA0B00957g5.541ON9821021000.005
Kwal_47.185775.541ON98796980.009
Ecym_41918.376ON462225960.012
KLTH0G04092g5.541ON99096970.012
KLTH0F08954g8.376ON458234950.014
Smik_4.7045.541ON98998960.015
CAGL0F03157g5.541ON99095950.017
Kpol_1004.325.541ON98897950.017
Suva_10.2608.376ON462225940.018
NDAI0G023208.376ON463224940.021
ADR184W5.541ON990111940.024
KAFR0E032505.541ON98490930.032
TDEL0A040405.541ON987102930.032
Skud_4.7055.541ON98996930.037
KNAG0C031705.541ON99497920.044
ZYRO0D12870g5.541ON986100910.053
Ecym_40765.541ON988102910.060
YDR430C (CYM1)5.541ON98996900.066
TPHA0D024305.541ON988105900.066
NDAI0H016605.541ON98797890.087
Suva_2.6065.541ON98996890.088
ZYRO0C03806g8.376ON465218890.089
TDEL0F050008.376ON456221880.099
NDAI0F014506.242ON687122781.6
SAKL0B02156g8.64ON60168736.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D04060
         (1201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....  2217   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   938   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...   842   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   841   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...   831   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...   830   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   824   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   812   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   810   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   788   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   781   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   772   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   765   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   755   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   737   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   716   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   715   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   712   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   587   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   531   e-168
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   152   1e-36
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   150   6e-36
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   150   6e-36
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   148   2e-35
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   147   3e-35
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   147   4e-35
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   147   4e-35
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   146   1e-34
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   145   1e-34
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   144   4e-34
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   144   5e-34
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   141   3e-33
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   141   3e-33
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   141   4e-33
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   140   5e-33
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   137   5e-32
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   137   8e-32
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   135   2e-31
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   134   5e-31
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   133   9e-31
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   129   2e-29
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    54   2e-06
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    50   2e-05
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    50   2e-05
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    50   3e-05
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    50   4e-05
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    49   7e-05
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    49   9e-05
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    48   1e-04
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    49   1e-04
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    46   4e-04
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    46   5e-04
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    46   5e-04
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    45   7e-04
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     45   0.001
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    45   0.001
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    44   0.002
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    44   0.002
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    44   0.003
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    44   0.004
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    43   0.005
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    42   0.009
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    42   0.012
KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {...    42   0.012
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    41   0.014
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    42   0.015
CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {...    41   0.017
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    41   0.017
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    41   0.018
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    41   0.021
ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic ...    41   0.024
KAFR0E03250 Chr5 (647254..650208) [2955 bp, 984 aa] {ON} Anc_5.5...    40   0.032
TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {O...    40   0.032
Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {...    40   0.037
KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.5...    40   0.044
ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]...    40   0.053
Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}...    40   0.060
YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}...    39   0.066
TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {O...    39   0.066
NDAI0H01660 Chr8 complement(400912..403875) [2964 bp, 987 aa] {O...    39   0.087
Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {...    39   0.088
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    39   0.089
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    39   0.099
NDAI0F01450 Chr6 (358291..360354) [2064 bp, 687 aa] {ON} Anc_6.2...    35   1.6  
SAKL0B02156g Chr2 complement(205340..207145) [1806 bp, 601 aa] {...    33   6.9  

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 2217 bits (5746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1093/1201 (91%), Positives = 1093/1201 (91%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
            SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
            SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRFSTGNI                  ESYFKTNYNASNMTLCIKGPQSVNVLTKYALT
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
            YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY
Sbjct: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
            NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD
Sbjct: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE
Sbjct: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480
            KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE
Sbjct: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480

Query: 481  FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540
            FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT
Sbjct: 481  FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540

Query: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILS 600
            LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILS
Sbjct: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILS 600

Query: 601  ANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXXXXX 660
            ANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQH             
Sbjct: 601  ANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHSSTESSIFSFEIT 660

Query: 661  NWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQS 720
            NWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQS
Sbjct: 661  NWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQS 720

Query: 721  GIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIMLE 780
            GIMSLLQ             PTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIMLE
Sbjct: 721  GIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIMLE 780

Query: 781  KHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWILS 840
            KHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWILS
Sbjct: 781  KHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWILS 840

Query: 841  DTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIATLTSL 900
            DTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIATLTSL
Sbjct: 841  DTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIATLTSL 900

Query: 901  TDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRL 960
            TDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRL
Sbjct: 901  TDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRL 960

Query: 961  ENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXXXXXXXXXXXXXQAGDSVNFETQ 1020
            ENDTIGSLNESTFKLTFLLPFINTMQKD                     QAGDSVNFETQ
Sbjct: 961  ENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTNVNLVDDVVANVQAGDSVNFETQ 1020

Query: 1021 QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXXXXXXXXXXXXX 1080
            QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRAT             
Sbjct: 1021 QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATISINSKNRSKISI 1080

Query: 1081 XXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKK 1140
                LMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKK
Sbjct: 1081 HIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKK 1140

Query: 1141 KDEAKKLYFXXXXXXXXXXSMTVXXXXXXXXXXXXXXXXWQTEPIKSALPLVLVNDIKAY 1200
            KDEAKKLYF          SMTV                WQTEPIKSALPLVLVNDIKAY
Sbjct: 1141 KDEAKKLYFIIIKEIIKIISMTVINSSSITTKSTSKKNNWQTEPIKSALPLVLVNDIKAY 1200

Query: 1201 K 1201
            K
Sbjct: 1201 K 1201

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1223 (42%), Positives = 713/1223 (58%), Gaps = 33/1223 (2%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSW++VKNYDIP Y P S RG   KLCRLPNG+L ++ISDP      CSLSVATGSHNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              IPGLAHLCEHMIL+AGSKKYP+P  YH+LI+++ G  NAYTTGEQTTFYFE+P +  +
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
            S   FE ++D+F+S FKDPLF +T  +KEIYAIESEH GNT N TKI YHA RLLANS H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS FSTGNI                  +SYFK N+ A NMTLCIKGPQSVN+LTK A+ 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  YFNGID--DSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKG---NEEDCRLEDFHI 295
            YF+ I   +SI+    F    KS     +    S  S  S  S     +E +  L    I
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 296  LSNAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWC 355
            L N ++PKY ++ CF   P +N I +KS K+P+LRL+FP+  +   F+K++L+ F  +WC
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 356  ELFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSIC 415
            E  GDE++NS+C  L  +  ITD  AF S+FALN++GL++E SLT  G+ N   IINSI 
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 416  NSAIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPS 475
             SAI KLS+    ELARFLSEC++ID++ F++K  E + M+E S++S  +Q +L + +P 
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 476  FLLKEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIET 535
             L K+ P I       I NF E+  S+ WWL+KA  +Q+FL+ Y+N+  LRI  L D   
Sbjct: 481  CLFKQSPMIVGNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSE 540

Query: 536  PKFTTLTEDLKVYSTDPFYDFEYITFKY---KFKANQLRQEDDIFRNIGIPKRNTFMPEI 592
             ++       +   TD FY+F+YI       K   +Q+    DIF N+  P +N ++PE+
Sbjct: 541  KQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQV----DIFSNLKFPAKNEYIPEL 596

Query: 593  GKSLAILSANLEAILKRNESIGYPIIY----NNSIESKPGLVLKNSNQETWVLNSPLQHX 648
            G+SL  L   L+ +   + S   PI+     + +    P L  K    E WV+    +  
Sbjct: 597  GRSLLYLREMLKKVSYESRS---PILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPS 653

Query: 649  XXXXXXXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGD 708
                        +  + P+P +TMHLE+LGQ+L +L++ +LYP+L+LGYTYEI +S  GD
Sbjct: 654  TEKKTIVTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGD 713

Query: 709  VKLMITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSV 768
            V+L  T+SG+  G+  +++                +   L RAR++TRRKYE AA+ N  
Sbjct: 714  VRLSFTLSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCA 773

Query: 769  KLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMK 828
            KLASVGL+IMLEK++W LEDR +ALEESDI+SF  FC  F +S KY+   + G  + A +
Sbjct: 774  KLASVGLIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANE 833

Query: 829  LSHLIYDHWI--LSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQT 886
            ++  + D +   L +    N    +   +T  L+PG N  F+H G   D NNCI YFIQT
Sbjct: 834  INKYLNDSFTNHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQT 893

Query: 887  GERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADP 946
            G+R+++    LTS T+Y++   LV +LRN+KQ+GYVVFGGMR L++T+G+HIT+MS ++P
Sbjct: 894  GKRDDKKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNP 953

Query: 947  EDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXX-XXXXXXXXXXXXXX 1005
             DLE  IDEY++ LE++ +  L+E  F   F+  +++TM  D                  
Sbjct: 954  LDLEEKIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGI 1013

Query: 1006 XXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAI--DLNIIKKLTLKEYLEF 1063
                QAGD     + QM  H  +K  I + R   +   N+ I  DLN IK LTLK+YL+F
Sbjct: 1014 AANVQAGDFSVLNSLQMITHRRIKNEITSKRYNFS---NDDIETDLNFIKHLTLKKYLKF 1070

Query: 1064 FRATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEIS 1123
            F                     MA +EI NRK FLQL  FLK+ G TI  D LK +V  S
Sbjct: 1071 FEENISISSVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSES 1130

Query: 1124 EGKPSKLLKEIVKYFKKKDEAKKLYFXXXXXXXXXXSMTVXXX-----XXXXXXXXXXXX 1178
            +G+P KL K +  YF  + E  K             +++V                    
Sbjct: 1131 QGRPGKLFKLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFPSSKQSDSSNIQ 1190

Query: 1179 XWQTEPIKSALPLVLVNDIKAYK 1201
             W +  +K A+ L  VND+  +K
Sbjct: 1191 TWSSS-VKPAITLTKVNDVHIFK 1212

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1159 (41%), Positives = 667/1159 (57%), Gaps = 27/1159 (2%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS  +V NY++  +IP S     +K+C+LPNGIL ++ISDP+   +SCSLSV TGSHNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              IPGLAHLCEHMILSAGSKKYPDP  +H LI+++NGS NAYTTGEQTTFYFE+P    +
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  FE +LD+F+S FKDPLF    ++KEIYAI+SEH+GN  + TKI YHA R+LANS H
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRFSTGNI                   +YF++N+   N+TLCI+G QSVN+LTK A++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  YFNGID-DSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCR-LEDFHILSN 298
             F  +   SI  +  F    K P      F  S+  + S  S  N  D R LEDF IL  
Sbjct: 241  KFGDVKPKSIVKERHFSIG-KGP------FRKSTSLRRSLNSPKN--DYRNLEDFKILDT 291

Query: 299  AYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358
             +  KY++  CF+  P  N+IFI S K P++R LFP+   +  F KDD+  +  +WCELF
Sbjct: 292  VWEKKYQNTMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELF 351

Query: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418
            GDE+  SL ++L     IT CFAF S FA+  +GL++EL LT +G K+ + I  +I +  
Sbjct: 352  GDESPGSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSEL 411

Query: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478
            +      N   L  FL E N ID+ RF+ +  E+  M+E S +SS LQENL    PS + 
Sbjct: 412  LPSFYVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVF 471

Query: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538
            K F  + +  +  I  +EE + +  WW  +A  FQ FLK ++   N R+L LGDI++ K 
Sbjct: 472  KGFKSLIEIDDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKI 531

Query: 539  TTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN----IGIPKRNTFMPE-IG 593
              + E+     TD FY+FEY T      +  L +E+  +         PK N F+P+ I 
Sbjct: 532  FHIIENKSEIRTDFFYEFEYYT-----GSVHLAEENKYYPKSSYEFNFPKSNLFLPDYIS 586

Query: 594  KSLAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXX 653
              L +    LE  LK   +   P IY+     +P LV +N N E W+L            
Sbjct: 587  DPLKLRQLFLECSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKS 646

Query: 654  XXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMI 713
                      IKPSP +T+HLEVL Q+L I+ +  LYPALR+GYTYEI +S  G V L  
Sbjct: 647  VVSFEVLGLGIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRF 706

Query: 714  TISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASV 773
            TISGF  G+  +++               ++   L +AR+  R KYE A+S N VKLAS+
Sbjct: 707  TISGFPEGVFKIVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASI 766

Query: 774  GLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI 833
            GLLI+LE+ +WTL+DR +ALE +++ SF  FCS F+K+ K +   + G+ + A +++H +
Sbjct: 767  GLLIVLEEFIWTLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYL 826

Query: 834  ----YDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
                  H  + +  S +        ST  L  G N +  + G + D NN I YFIQT +R
Sbjct: 827  NRNFTQHLKVCNEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQR 886

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
            ++     LT LT+Y+    LV +LRNRKQ+GY+V GG+R LT+T+G+H+T+MS +   +L
Sbjct: 887  DDIENLALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNL 946

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTM-QKDXXXXXXXXXXXXXXXXXXXX 1008
            E  I+EY+  LE   + +L E  F+   L PF+  + Q                      
Sbjct: 947  ETKINEYLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVAN 1006

Query: 1009 XQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATX 1068
             Q GD+     +QMK H  ++ +I   R+    +Y E +++  ++KLTLK+YL FF+A  
Sbjct: 1007 VQNGDNYTLNNRQMKQHRKVRNKITEKRLNFQEEY-EMVNIPFLQKLTLKKYLRFFQAKI 1065

Query: 1069 XXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128
                             MA+E+IA+R++FLQL  FLK+KG  IK ++LK+IVE SEG P 
Sbjct: 1066 SIYSTQRSKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPM 1125

Query: 1129 KLLKEIVKYFKKKDEAKKL 1147
             L+K +  +F+K++EA KL
Sbjct: 1126 LLVKNLFTHFRKRNEAFKL 1144

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1154 (41%), Positives = 675/1154 (58%), Gaps = 26/1154 (2%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSW ++K++D+P+Y+P +     +KLC LPNG+LT++ISDP+  + SCSLSVA+GSHNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              I GLAHLCEHMIL+AGSK YPDP  YH+ +S++NG HNA+TTGEQTTFYFE+P +   
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  F+ +LDIF+S FK+PLF     NKEIYAI+SEHDGN  ++TKILYHATR+L++  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS+FSTGN+                    YFK NY AS MTLC++GPQSVN+LTKYAL+
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F      I+ +    +S    +        S  S E+  +K +     LE F+IL  ++
Sbjct: 241  KFG----DIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKND-----LESFNILEESW 291

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
              KY DI CF      N IFIKS+KQP LR+LFP+  +   F K ++  F  +WCELFGD
Sbjct: 292  RQKYCDIPCFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGD 351

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E   SLCY+L   + IT C+A+ S+FAL ++GL++EL+LT TG +N + II  +    +E
Sbjct: 352  ETKGSLCYYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVE 411

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480
              SE    ELA F+ + N+ID+IRF+ +  +   M+E S +S  LQ +L     +++ K 
Sbjct: 412  TFSEQYVHELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKG 471

Query: 481  FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540
             P I D  E  +     +E ++ WW+ +A  FQ F+K+++N  N R++ LG +E      
Sbjct: 472  SPPITDMHEGNVGGI-NSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELF 530

Query: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILS 600
              E     +T+PFY+FEY       KA+Q     +      IP +N F+P   K   +L 
Sbjct: 531  KKEIQNTLTTEPFYEFEYKISTINLKASQSVNTYE----FCIPHKNKFIPSACKGDGVLE 586

Query: 601  A-NLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXXXX 659
               LE+ LK   S  +  I + S E+KP LV +N   E W L   L              
Sbjct: 587  QLFLESSLKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEV 646

Query: 660  XNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQ 719
             +  +K SP +T+HLE+L Q++  L++ +LYPA++LGY YEI AS  GDV+L  TI GF 
Sbjct: 647  LSTDMKGSPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFS 706

Query: 720  SGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIML 779
             GI+ L++                +   L RARV+ R  YE+AA+ N VKLAS+GLLI+L
Sbjct: 707  EGILMLIEIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVL 766

Query: 780  EKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI----YD 835
            E++MW+LEDR DALE+  + SF  FC  F   +KY+  FI G    A K++  +      
Sbjct: 767  EENMWSLEDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTK 826

Query: 836  HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIA 895
            H  ++   SL     N   ST  LKPG N++ ++PG   D NN I YFIQTG R++  + 
Sbjct: 827  HLDINKDTSLPL---NAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLC 883

Query: 896  TLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDE 955
            TLTS T+YIM   LV ELRN+KQ+GY+V GG+R LT+TIG++IT+MS ++P DLE  IDE
Sbjct: 884  TLTSFTEYIMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDE 943

Query: 956  YMWRLENDTIGSLNESTFKLTFLLPFINTM-QKDXXXXXXXXXXXXXXXXXXXXXQAGDS 1014
            Y+  +EN  +  L E+TF+  +   ++  +   +                     Q G S
Sbjct: 944  YIAFIENGVLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSS 1003

Query: 1015 VNFETQQMKLHNNLKKRIFNNRIQLNLKYNEA-IDLNIIKKLTLKEYLEFFRATXXXXXX 1073
                +  MKLH   + +I +   Q N    E  ID+ +I+KLTL  YL FF+        
Sbjct: 1004 DQLNSTSMKLHRRFRNQISDK--QYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSP 1061

Query: 1074 XXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKE 1133
                        MA ++I NRK +LQL  FLK+KG TIK+++L+EIV+ ++G  S L+K 
Sbjct: 1062 TRSKLSIMITSSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKN 1121

Query: 1134 IVKYFKKKDEAKKL 1147
            +  YF+ ++E  KL
Sbjct: 1122 LFNYFRSRNEGWKL 1135

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1163 (40%), Positives = 663/1163 (57%), Gaps = 35/1163 (3%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS  +V NY++PIYIP S     +K+C+LPNGIL ++ISDP+   +SCSLSV TGSHNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
                GLAHLCEHMIL+AGSK+YPD   +H LI+++NGS NAYTTGEQTTFYFE+P   ++
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  FE +LD+F+S FK+PLF    ++KEIYAI+SEH+GN  + TKI YHA RLLANS H
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRFSTGNI                   +YFK NY   N+T+CI+GPQSVN+L K A++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  YFNGI--DDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSN 298
             F  I   +S+  +N    S+++  +   R    S+      SK +    +LE F IL  
Sbjct: 241  KFGDIKPKNSVEGNNF---SIRAGSFRRSR----SVKSTGDFSKNDHR--KLESFKILET 291

Query: 299  AYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358
             +  KYK+ KCF+  P  N IFI S K P++R LFP+   +  F K+D+  +  +WCELF
Sbjct: 292  VWEEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELF 351

Query: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418
            GDE+  SL  +L     IT CFAF S FA+ ++GL++EL LT +G ++ + I  +I +  
Sbjct: 352  GDESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKL 411

Query: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478
            +      N   L  FL E N IDI RF+ +  ED  M+E S +S+ LQENL    PS + 
Sbjct: 412  LPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVF 471

Query: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538
            K F  + +  +  I  +E +E +  WW+ +A  FQ FLK ++N +N R+L LG++++ + 
Sbjct: 472  KGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEV 531

Query: 539  TTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN----IGIPKRNTFMPE-IG 593
                E      TD FY+FEY T K       L ++D+ +         P  N F+P+ I 
Sbjct: 532  FDKIEKRSEMYTDFFYEFEYYTGKV-----DLTRDDESYAKSYYEFNFPTSNIFLPDYIN 586

Query: 594  KSLAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXX 653
              L +    LE  LK   +   P I +   +  P LV KN N E WVL            
Sbjct: 587  DPLKLQQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKS 646

Query: 654  XXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMI 713
                      IKPSP +T+HLEVL Q+L I+ +  LYPALR+GYTYEI +S  G+V L  
Sbjct: 647  IVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRF 706

Query: 714  TISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASV 773
            TISGF  G+ ++ +               ++   + +AR++ RRKYE A+S N VKLAS+
Sbjct: 707  TISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASI 766

Query: 774  GLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI 833
            GLLI+LE++MWTL+DR DALE ++ +SF  FC  F+ + K +   I G  E A +++H +
Sbjct: 767  GLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYL 826

Query: 834  YDHWILSDTISLNYFEKNNILSTCF--------LKPGENVYFQHPGDEGDINNCINYFIQ 885
             +++    T  L    ++N  + C         L  G N +  + G + D NN I YFIQ
Sbjct: 827  NNNF----TQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQ 882

Query: 886  TGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLAD 945
            T +RN+    TLT LT+Y+    LV +LRN+KQ+GY+V GG+R LT T+G+HIT+MS   
Sbjct: 883  TAKRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGP 942

Query: 946  PEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTM-QKDXXXXXXXXXXXXXXXX 1004
              +LE  I+EY+  L+   + +  ES F+   L PF+  + Q                  
Sbjct: 943  AHNLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNE 1002

Query: 1005 XXXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFF 1064
                 Q GD+     +QMK H  ++ +I   R     +Y E  D+  ++ LTLK YLEFF
Sbjct: 1003 IVANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEY-EMFDIPFLQGLTLKRYLEFF 1061

Query: 1065 RATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISE 1124
             +                   MA+E+I +RK+FLQL  FLK+KG  IK ++LK IV+ S+
Sbjct: 1062 ESKISIYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSK 1121

Query: 1125 GKPSKLLKEIVKYFKKKDEAKKL 1147
            G P  L+K +   F++++EA KL
Sbjct: 1122 GSPVLLIKNLFTSFRRRNEAFKL 1144

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1159 (40%), Positives = 666/1159 (57%), Gaps = 27/1159 (2%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS  +V NY++  YIP S     +K+C+LPNGIL ++ISDP+   +SCSL+V TGSHNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              I GLAHLCEHMILSAGSKKYPDP  +H LI+++NGS NA+TTGEQTTFYFE+P    +
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  FE +LD+F+S FK+PLF    ++KEIYAI+SEH+GN  + TKI YHA R+LAN  H
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRFSTGNI                   +YF+ N+   N+TLCI+GPQSVN+LTK AL+
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F  I          I S+++  +   +    SL +    SK +  D  L+ F IL+  +
Sbjct: 241  KFGDIKPKSAVKERSI-SIRTRSFRRSK----SLKKRQDSSKNDYSD--LKTFKILNTTW 293

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
              KYK+  CF++ P  N+IFI S K PI+RLLFP+   +  F KDD+  +  +WCELFGD
Sbjct: 294  EKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGD 353

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E+  SL Y+L     +T CFAF S FA+  +GL++EL LT +G +N + I   + N  + 
Sbjct: 354  ESPGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLP 413

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480
                 N   L  FL E N ID++ F+ +  ED  M+E S++S  LQ++L    P  + K 
Sbjct: 414  SFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKG 473

Query: 481  FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540
            F  + +  +  I  +E  + +  WW  +A  FQ FLK ++N  N+R+L LG+I++     
Sbjct: 474  FKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFD 533

Query: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN-----IGIPKRNTFMPE-IGK 594
              ++     TD FY+FEY T      AN     D+ F +        P  N F+P+ +  
Sbjct: 534  KMKNKSDICTDFFYEFEYYT------ANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSD 587

Query: 595  SLAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXX 654
             L +    LE  LK   +   P IY+    +KP LV +N N E W+L             
Sbjct: 588  PLKLQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSV 647

Query: 655  XXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMIT 714
                     IKPSP +T+HLEVL Q L I+ +  LYPALR+GYTYEI +S  G+V L  T
Sbjct: 648  VSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFT 707

Query: 715  ISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVG 774
            ISGF  G+ ++++               ++   L +AR++ R KY++A+S N VKLASVG
Sbjct: 708  ISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVG 767

Query: 775  LLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIY 834
            LLI+LEK++WTLEDR +ALE +++ SF  FC  F+++ K++  F+ G+ E A  ++  + 
Sbjct: 768  LLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLN 827

Query: 835  DHWILSDTISLNYFEKNNIL-----STCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
            +++     IS N   K  I      ST  L  G N +  + G + D NN I YFIQT +R
Sbjct: 828  NNFTQHLKIS-NEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQR 886

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
            ++    TLT LT+Y+    LV +LRN+KQ+GY+V GG+R LT+T+G+HIT+MS +   +L
Sbjct: 887  DDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNL 946

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTM-QKDXXXXXXXXXXXXXXXXXXXX 1008
            E  I+EY+  L+   +    E  F+   L PF+N + Q                      
Sbjct: 947  ETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVAN 1006

Query: 1009 XQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATX 1068
             Q GD+     +QM+ H  ++ +I   R+     + E ID++ ++KLTLK+YL FF +  
Sbjct: 1007 VQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDH-EMIDISFLQKLTLKKYLAFFESKI 1065

Query: 1069 XXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128
                             MA++EIA+RK+FLQL  FLK+ G  IK ++LK+IVE S+G P 
Sbjct: 1066 SIYSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPI 1125

Query: 1129 KLLKEIVKYFKKKDEAKKL 1147
             L+K +  YF++++E  KL
Sbjct: 1126 LLVKNLFTYFRRRNEVFKL 1144

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1161 (41%), Positives = 655/1161 (56%), Gaps = 21/1161 (1%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS  +V NY+IP YIP S     +K+C+LPNGIL ++ISDP+   +SCSLSV TGSHNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              IPGLAHLCEHMIL+AGSKKYPDP  +H LI+++NGS NA+TTGEQTTFYFE+P   ++
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  FE  LD+F+S FK+PLF    + KEIYAI+SEH+GN  + TKI YHA R+LAN+ H
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS FSTGNI                   +YFK N+   NMTLC++G QSVN+LTK A++
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  YFNGID--DSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSK-GNEEDCRLEDFHILS 297
             F  I   + I+  N  IK+         R S  +    S  S+  N     LE+  I  
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 298  NAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCEL 357
              +  KY  + CF+    +N+IFI S+K PI+R LFP+   +  F K+D+  +  +W EL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 358  FGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNS 417
            FGDE+  SL ++L      T  FAF S FA+ ++GLV+EL LT TG ++ E I  +I + 
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 418  AIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFL 477
             +      N   L  FL E N IDI RF+ +  ED  M+E S +S  LQENL    P  +
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 478  LKEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPK 537
             K F  + + ++  I  +E N+ +  WW  +A  FQ FLK ++N +N RIL LGDI++  
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540

Query: 538  FTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPE-IGKSL 596
                 ED     T+ FY+FEY   +     +        +     P +N F+P+ +   L
Sbjct: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYE-FNFPTKNPFLPDFVNDPL 599

Query: 597  AILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXX 656
             +    LE  LK   +   P I +  IE  P LV KN N E WVL               
Sbjct: 600  KLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVS 659

Query: 657  XXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITIS 716
                   IKPSP +T+HLEVL Q+L I  +  LYPALR GYTYEI +S  G+V L  TIS
Sbjct: 660  FEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTIS 719

Query: 717  GFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLL 776
            GF  G+  + +                +  AL +AR++ R KYE A+S N VKLAS+GLL
Sbjct: 720  GFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLL 779

Query: 777  IMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYD- 835
            I+LE++MWTL+DR DALE +D+ S  NFCS F+K+ K +   I G  + A +++H + + 
Sbjct: 780  IVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNN 839

Query: 836  ---HWILSD-----TISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTG 887
               H  + D     TI L Y   N    T  + PG N +    G + D NN + YFIQT 
Sbjct: 840  FTQHLKVCDEGNRPTIRL-YPSPN----TKNIDPGTNAFISCNGHQDDPNNSLAYFIQTA 894

Query: 888  ERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPE 947
            +R+N    TLT LT+YI    LV +LRN+KQ+GY+V  G+R LT+TIG+HIT+MS +   
Sbjct: 895  QRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAH 954

Query: 948  DLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDX-XXXXXXXXXXXXXXXXX 1006
             LE  I+EY+  LE   + +  ESTF+   L PF+  ++K+                   
Sbjct: 955  SLETKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIV 1014

Query: 1007 XXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRA 1066
               Q GD      +QMK H  ++  I   R+    + NE +D+  ++KLTLK+YLEFF +
Sbjct: 1015 ANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQ-EENEMVDILFLQKLTLKKYLEFFGS 1073

Query: 1067 TXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGK 1126
                               MA+EEIA+RK+FLQL  FLK+KG  IK  +L++IVE S+G 
Sbjct: 1074 RISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGS 1133

Query: 1127 PSKLLKEIVKYFKKKDEAKKL 1147
            P  LLK +  +F+K+ EA KL
Sbjct: 1134 PVLLLKNLFTFFRKRSEAFKL 1154

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1159 (39%), Positives = 660/1159 (56%), Gaps = 37/1159 (3%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSW  V+NYD P YIP       +KLCRLPNGILT++ISDP   +++CSLSVATGSHNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
            + +PGLAHLCEHM+L+AGSK YP+   YH +++++NG+ NA+TTGEQTTFYFE+P    S
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  F++L+D+FSS FK+PLF     NKEIYAI+SEH+GN  +L KILYHATRL+AN  H
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS+FSTGNI                    YF  N+  S MTLC++GPQSVN LTK  ++
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNE-EDCRLEDFHILSNA 299
             F      IR +N   +S         +F   S     +  +  E +   LE ++IL + 
Sbjct: 241  KFG----DIRANNGLKRS---------KFGSISSRLSISSFQSKERQPTDLEQYNILKST 287

Query: 300  YNPKYKDIKCFKRNPNH-NAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358
            + PKY++  CF  + +  N IFI+S KQ  LR LFP++     F+   +  F   WCELF
Sbjct: 288  WKPKYREAPCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELF 347

Query: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418
            GDE   SLCY L   + ITDCFA+ S F+  S GL+++ +LT TG  N + IIN + ++ 
Sbjct: 348  GDETKGSLCYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNT 407

Query: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478
            I    +    +L+ FL E NTID+IRF+ +  E + M+E S IS  LQE+L     S+L 
Sbjct: 408  IAAFIDKPTDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLF 467

Query: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538
            K  P I+D      +  +  E+ +  WL +A  FQ+FLK ++NR N+ +  LG+ +    
Sbjct: 468  KGAPTISDCYSNDNNTVDMIEYEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHS 527

Query: 539  TTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAI 598
                  ++ +          +   Y  +  +L      F+   +P  N F+P   + + I
Sbjct: 528  LRSIIRIRYFLLMQCMSLNILNVIY-LRFPKLLSTQYTFQ---VPPPNAFIPPSCQDVTI 583

Query: 599  LSA-NLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXX 657
            L    LE+ LK   S     + N ++ + P L+ +NS+ E W L++P+            
Sbjct: 584  LQQLFLESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSF 643

Query: 658  XXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISG 717
               N S+ PSP ++++LE+L Q+L  L++ +LYP++RLGY+YEI +S  GD++L +TI G
Sbjct: 644  EIFNRSMIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGG 703

Query: 718  FQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLI 777
            F  GI+S+L                 +   L R+RV+ R  YE AAS N V LAS+GLLI
Sbjct: 704  FSEGIISILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLI 763

Query: 778  MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--------TNELAMKL 829
            +LE++MWTL+DR +ALEE D+ SF  FC QF +   Y+   I G         N L   L
Sbjct: 764  ILERNMWTLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNL 823

Query: 830  SHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
            +H +       +  ++   ++++ LST  L+PG N Y ++ G   D NN I YFIQTG R
Sbjct: 824  THHL-------ECSNVKNEKQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLR 876

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
             N    TLT  T+YIM   LV +LRN++Q+GY VFGG+R LT+TIG+HIT+MS   P DL
Sbjct: 877  TNRRTVTLTYFTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDL 936

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDX-XXXXXXXXXXXXXXXXXXX 1008
            E  IDEY+  LE   + SL E+ F L +   +++ +                        
Sbjct: 937  EIKIDEYIAYLEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVAN 996

Query: 1009 XQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATX 1068
             Q+G++    +  MK H +    I N R Q     +E +D+ +IK LT KE+L+FFR   
Sbjct: 997  VQSGNADELNSHFMKSHKHFFNEISNKRYQFKGD-SELVDIEVIKNLTKKEFLKFFREKV 1055

Query: 1069 XXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128
                             MA+ EI NRK FLQL  FLK++G TI  + L++IVE + G+PS
Sbjct: 1056 SIKSKVRSKISVMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPS 1115

Query: 1129 KLLKEIVKYFKKKDEAKKL 1147
             L+K++ KYF++++EA +L
Sbjct: 1116 ALIKDLFKYFRERNEALRL 1134

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1158 (42%), Positives = 678/1158 (58%), Gaps = 27/1158 (2%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSW   K +DI  Y+P+S    + KLCRLPNGIL ++ISD S    +CS+SVATGSH+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              IPG+AHLCEHMIL+AGSKKYP P  +H++++ +NGS NA+TTGEQTTFYFE+P     
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             ++ F  +LDIFSS FK PLF E   NKEIYAIESEHDGN  N +KILYHA RLL+N  H
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PF  FSTGNI                    YFK NY + NMT+CIKGPQS+N LTK AL 
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F  I D        I S+K P    +     S        K N E+  LE+F +L NA+
Sbjct: 241  NFGDIKDKDELTKFHINSIK-PQKSLRISKSRSSISSCNSFKTN-ENLDLENFKLLDNAW 298

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
              KY D  CF  + +HN IF+ S+KQPILRLLFPI      F K D+  +  +WC +FGD
Sbjct: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E   S C +L K+N IT+C+AF S FA+ +  L++EL LT TGVK  + II+ +    ++
Sbjct: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL-- 478
             L +     LA FL+E N I I+RFIN   E   MDE SE+S  LQEN  L  P +L   
Sbjct: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478

Query: 479  KEFPFINDYSETGISN-FEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPK 537
             EF  + + S    +N F+ N  S  +W+ +A  FQ FLK ++N +N++I+ +GDI+  +
Sbjct: 479  SEFLLLENESLPQKNNMFDGN--STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDID--E 534

Query: 538  FTTLTEDLKVYS--TDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKS 595
            F  +   +K  S  TD +Y+FEY   K   K +++   D  F     P +N ++P+ G +
Sbjct: 535  FKNVLNIVKEMSKKTDLYYEFEYQKLKIS-KKSRICPRDYPFT---YPIKNEYLPKFGYN 590

Query: 596  LAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWV--LNSPLQHXXXXXX 653
            L +L   L   L+ + ++ + +   +  E +  LV +N   + WV   NS  Q       
Sbjct: 591  LGLLRNILLNNLESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCI 650

Query: 654  XXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMI 713
                   N SI+ SP STMHLE++GQLL  L+  +LYPAL +GYT+EI  SV GDV L  
Sbjct: 651  VSFKLVNN-SIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSF 709

Query: 714  TISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASV 773
            T+SGF  GI  +++               +T     RAR++ R KYEDAAS + VKLASV
Sbjct: 710  TLSGFSEGIFKIIKECINIFGELTSSD-LITKKEFRRARILVRDKYEDAASDSCVKLASV 768

Query: 774  GLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI 833
            GLLI+LE+ MWTLE+R DALE  D+  F  F  +FF++  ++  +I G  E A  ++   
Sbjct: 769  GLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYF 827

Query: 834  YDHWILSDTISLNYFEKNNI--LSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNN 891
             D  +   T  L+Y +++ +  L +  L  G N+Y++  G   D NN I YFIQTG+ +N
Sbjct: 828  SDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSN 887

Query: 892  EYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLER 951
            + I +LTSLT +I+  +LV ELRN+KQ+GYVVFGG+R+L++T+GLHITIMS   P D+E 
Sbjct: 888  KKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEI 947

Query: 952  SIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXX-XXXXXXXXXXXQ 1010
             I++Y+  LE D +G+L++ TF+  +L+ +I+ +                          
Sbjct: 948  EIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVH 1007

Query: 1011 AGDSVNFETQQMKLHNNLKKRIFNN-RIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXX 1069
             GDS    ++++K H   K  +F + ++   LKY   +D+  +K L L +YL+FF+ +  
Sbjct: 1008 GGDSAILNSEKIKNHKKNKNELFGDAQMTEELKY---VDIEFLKNLNLIKYLQFFKGSIS 1064

Query: 1070 XXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSK 1129
                            M + E+ NRKLFLQL TFLK+KG  IK +EL++IVE + G+P+ 
Sbjct: 1065 TNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTL 1124

Query: 1130 LLKEIVKYFKKKDEAKKL 1147
            L KE+   FK +DE+ K 
Sbjct: 1125 LFKELFACFKARDESWKF 1142

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1160 (38%), Positives = 656/1160 (56%), Gaps = 44/1160 (3%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            M   Q+K YDIP   P S  G  +KLC+LPNG+LT++ISDP+   ++CSLSVA+GSHNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
            S IPGLAHLCEHM+L+AGS+KYPDP  YH++I ++ GS NA+TTGEQT+FYFE+P ++ S
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             +  F+  LD+F+S F +PLF  T +NKE YAIESEHD N  +  KI Y ATRLLAN  H
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRFSTGNI                    YFK N+ AS MTLC++GPQS++ L K ALT
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEE--DCRLEDFHILSN 298
             F+ I ++                  QR+  S     S   + + E  +   ++ +I  N
Sbjct: 241  KFSLIKNN-----------------PQRYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKN 283

Query: 299  AYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358
             + PKY+   CF  +     IFIKS+K P +R +FP    +  F   D+     +W ELF
Sbjct: 284  TWLPKYRGQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELF 343

Query: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418
            GDE+  S  ++L+    +T  +AF S  A+ +  L++EL LT TG +N   I   +   A
Sbjct: 344  GDESPGSFSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQA 403

Query: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478
            I  LS+ N  ELA+F+S+ N ID+IRF+ +  E + M+E   +SS +Q++L    P+++ 
Sbjct: 404  IPALSQKNTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIF 463

Query: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538
            K  P + D     I N+ EN+ S  WW+ +A  FQ FLK+++ + N+R++  G+    + 
Sbjct: 464  KGSPMMIDEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQL 523

Query: 539  TTLTEDLKVYSTDPFYDFEY-----ITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIG 593
              L+   + +  D FY+FEY     I FK     + L   +D   N  IP+ +  MP+I 
Sbjct: 524  EELSS--QEFQVDLFYEFEYFKRDGIPFK-----DILEWNNDY--NFKIPQLDCPMPDIA 574

Query: 594  KSLAILSANLEAILKRNESIGYPI-IYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXX 652
            KS + L   L    ++++S      I+NN ++  P LV +N   E WV+           
Sbjct: 575  KSYSQLKKILNDSSQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLK 634

Query: 653  XXXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLM 712
                       ++  P +TM+LE+LGQ++ IL++ E+YP+L+LG+T EI  S  GD++L 
Sbjct: 635  SIVSFEIFGLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLG 693

Query: 713  ITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLAS 772
             TISGF   + S ++               ++   L RAR++ R KYE+AA+ N   + S
Sbjct: 694  FTISGFSKQLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGS 753

Query: 773  VGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHL 832
            +GL I+LEK+MWTLEDR +ALE+ D+++F  FC  F  S KY+  F+ G    A +L+  
Sbjct: 754  IGLYIVLEKYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNE- 812

Query: 833  IYDHWILSDTISLNYFEKNN----ILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGE 888
             Y H   +  +    +E       + +T  L+PG N   QH G + D NN I YFIQTG 
Sbjct: 813  -YLHRSFTHHLGGGIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGR 871

Query: 889  RNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPED 948
            RN+  I TLT+ T +IM  NL  ELRN++QVGY+V GG+R L+N++GLHITIMS   P D
Sbjct: 872  RNDRMIFTLTNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLD 931

Query: 949  LERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXX-XXXXXXXXX 1007
            LE  IDEY+W LE+  +  L+E TF   ++  ++  +                       
Sbjct: 932  LETKIDEYLWYLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVA 990

Query: 1008 XXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRAT 1067
              Q GDS    +Q MK H  L+ +I   +    +  +EA+D ++I +++L++YL FF+  
Sbjct: 991  NVQIGDSEILSSQTMKRHKKLQTQIIQEQYDF-VTESEALDDDLISQMSLEQYLSFFKHY 1049

Query: 1068 XXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKP 1127
                              +A+++I N+K+FLQL TFLK+KG  I  DELK+IVE S GKP
Sbjct: 1050 ISIHSKLRSKISIMISSSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKP 1109

Query: 1128 SKLLKEIVKYFKKKDEAKKL 1147
              L  E+   F+ +++A +L
Sbjct: 1110 KILAMELYSCFRTRNDALRL 1129

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1163 (38%), Positives = 658/1163 (56%), Gaps = 44/1163 (3%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS   V+N+D+  Y P S     +++ +L NG+L ++IS+P+ +  SC+LSVATGSHNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              I GLAH CEHMILSAGSK YPDPN+YH +IS++ GS NA+TTGEQTTF FE+P L  S
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  F+++LDIFSSSFK PLF E  VNKEIYAI SEH  N  +  KI YHATRLLAN  H
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS+FSTG+I                    YFK N+ A NM LCIKGPQS+N L K   +
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  YFNGIDD-----SIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHI 295
             FN I        +R  N     LKS  + +  F                    LE F I
Sbjct: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLG-----------------LESFKI 283

Query: 296  LSNAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWC 355
            LS  +  KY ++  F    NHN + + S K P LRL+FPI        K ++      WC
Sbjct: 284  LSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWC 343

Query: 356  ELFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSIC 415
            ELFGDE++ SLC+F+KK++ IT+  AF S+FA+N   L++EL LT TG KN ++I+    
Sbjct: 344  ELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFF 403

Query: 416  NSAIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPS 475
            N  +  + E    ELA FLSE N I++++F+ +    +SM+E S +SS L  ++    PS
Sbjct: 404  NKYVPIVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPS 463

Query: 476  FLLKEFPFINDYSE--TGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDI 533
            F+LK  P +ND +E  + + +F E+E S+ WW+  A  FQ F+K ++N +N+R++ +GD+
Sbjct: 464  FILKGNP-MNDCNEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDL 522

Query: 534  -ETPKFTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQE---DDIFRNIGIPKRNTFM 589
             E P   T    LK+ + +P+Y+FEY    +K +++Q   +   ++I  +  IP +N F+
Sbjct: 523  KECPLMKTDLTSLKL-NIEPYYEFEY----HKCRSDQSNFKLTVEEISYSFHIPYKNVFL 577

Query: 590  PEIGKSLAILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHX 648
            P +G +L+++   L A   R+++    +   N+     P L+ KN   E WV     +  
Sbjct: 578  PSVGFNLSLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELT 637

Query: 649  XXXXXXXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGD 708
                        +  + P P+ TM LE+L +LLG +++ +LYP+ ++GYTYEI AS  GD
Sbjct: 638  FKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGD 697

Query: 709  VKLMITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSV 768
            V++  T+SGF  G+  +++               +      ++R+  R KYE+AAS NS 
Sbjct: 698  VRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNST 757

Query: 769  KLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG----TNE 824
             L ++GLLI+LEK+MW LE R +ALE +D+ SF  F S FF ++ Y+  FI G    T++
Sbjct: 758  TLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQ 817

Query: 825  LAMKLSHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFI 884
            + + L   +  H     +   +  +  N  ++  LKPG N++  H G + D NN I YFI
Sbjct: 818  INIFLDRNLTGHL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFI 873

Query: 885  QTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLA 944
            QTG+R + Y  TLT+ T +++   LV +LR RKQVGY+V GG+R+L++T+GLHITI S +
Sbjct: 874  QTGDRTDNYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSS 933

Query: 945  DPEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXXXXXXXX 1004
             P  LE  I EY+  LE D + +L    F+  ++  ++N +                   
Sbjct: 934  PPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMS 993

Query: 1005 XXXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFF 1064
                     +++   + MK H  ++ +I + R       +E IDL +I+ L    Y++FF
Sbjct: 994  RIKANVRSGNLDRVGRTMKSHRRIRAQISSKRYNFE-DEDEPIDLQLIESLDFVHYMQFF 1052

Query: 1065 RATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISE 1124
            +                    M++ EI NRK+FLQL +FLK+KG  I  ++L++IV  S+
Sbjct: 1053 KQKISIYSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSD 1112

Query: 1125 GKPSKLLKEIVKYFKKKDEAKKL 1147
            GKP+ L+KE+ +YF  + E+ K+
Sbjct: 1113 GKPTVLMKELFRYFASRGESLKI 1135

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1168 (39%), Positives = 673/1168 (57%), Gaps = 51/1168 (4%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSWT+V+++D+ +  P S     +KLC LPNGI T++ISDP+   ++CSL+VATGSHNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              IPGLAHL EHMIL+AGSK+YPDP  YH+LIS++NGS NA+TTGEQTTFYFE+P     
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  F+++LD+F+S FK+PLF  + +NKEIYAIE+EH  N    TKILYH+TRLLAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS+F+TGNI                   +YF  ++ A+ MTLC++GP SVNVLTK A+ 
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F+ I    +ND              QR  F S+S +    +  +   ++E  +IL N +
Sbjct: 241  KFSDIKS--QND-------------LQRNKFGSISSKRDSRQPRQGYSKIESSNILENIW 285

Query: 301  NPKYKDIKCF-KRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFG 359
            + +Y ++ CF   +   N+IFIKS K+P++R LFP+      F + +++ F   WC LFG
Sbjct: 286  SKRYANLPCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFG 345

Query: 360  DENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAI 419
            DE++ SL +FL +    T   ++ S FA+ S+GLV+EL+LT +GV     IIN +    +
Sbjct: 346  DESEGSLMHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIV 405

Query: 420  EKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLK 479
            + L+  + T +A FL+E N I+ +RF+ +G E   M+E S++S  LQEN+ +    +L K
Sbjct: 406  KILTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFK 465

Query: 480  EFPFI-------NDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLG- 531
              P I       N YSE+           K  W + A  FQ FL  ++N +NLR+LFLG 
Sbjct: 466  GSPSITQLYSGKNQYSESMTD-------GKIQWTAYAIKFQNFLLTFMNYENLRLLFLGS 518

Query: 532  DIETPKFTTLTEDLKVYSTDPFYDFE-YITFK-YKFKANQLRQEDDIFRNIGIPKRNTFM 589
            + +  +  T  +    + TD FY+F+ Y TF  ++  ++ +  E+ IF    +P  N F+
Sbjct: 519  NAKETRLITKEKKRIEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFT---LPSSNLFI 575

Query: 590  PEIGKSLAIL-SANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHX 648
            P+  +S   L  A  E+ LK   +   P +    I   P LV  + N E W L   +   
Sbjct: 576  PKSCRSYTYLQQAFQESSLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSS 635

Query: 649  XXXXXXXXXX--XXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVN 706
                          + ++ PS  ST+HLE+L QLL  L++ +LYP+L+LGY+Y+I +S  
Sbjct: 636  PSLRSKTIVTFELISTNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSK 695

Query: 707  GDVKLMITISGFQSGIMSLLQXXXXXXXXXXXXXPT--VTHSALHRARVMTRRKYEDAAS 764
            GDV+L  TISGF  G++ +L+                 VT+  L +ARV+ RRKY++A  
Sbjct: 696  GDVRLKFTISGFSEGLLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACC 755

Query: 765  GNSVKLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQF-FKSAKYIKSFISGTN 823
             N  KL SVGLLI+LE  +WTLEDR DALE++D+ SF NF ++F F+S  Y   FI G  
Sbjct: 756  ENCAKLGSVGLLILLESFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNL 815

Query: 824  ELAMKLSHLIYDHWILSDTISLNYFEKNNILS---TCFLKPGENVYFQHPGDEGDINNCI 880
            + A ++ H + D+     T  L+   +  IL+   T  L+ G N +  + G E D NN I
Sbjct: 816  DRAHEIHHYLNDNL----THHLDILPEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAI 871

Query: 881  NYFIQTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITI 940
             YFIQ+G R++    TLT+ T+Y+M   L+ +LR++KQ+GY+V GGMR L ++IGLHIT+
Sbjct: 872  VYFIQSGLRSDSIAYTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITV 931

Query: 941  MSLADPEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQ-KDXXXXXXXXXXX 999
            +S   P+DLE  IDEYM  LE   +G L E  F+  ++  +++ +  K+           
Sbjct: 932  VSGTPPQDLEDKIDEYMNFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAH 991

Query: 1000 XXXXXXXXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKE 1059
                        G+     + +M+ H  L  +I ++     L   E I+  +I+ LTLK 
Sbjct: 992  NLLNDIVSNVANGEYEILNSSEMREHKRLWNQISDDDHSF-LDDIELINREVIETLTLKG 1050

Query: 1060 YLEFFRATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEI 1119
            Y++FF+                    M + EI NRKLFLQL  FLK+KG  IK ++LKEI
Sbjct: 1051 YMQFFKKKISIHSNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEI 1110

Query: 1120 VEISEGKPSKLLKEIVKYFKKKDEAKKL 1147
            V+ ++GKPS +LK ++  F++++EA KL
Sbjct: 1111 VDKADGKPSVVLKLLLSEFRERNEAWKL 1138

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1209 (35%), Positives = 650/1209 (53%), Gaps = 51/1209 (4%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MSW+QVK+ ++P + P S     +KLC+LPNGIL ++ISDP+  +++CSL+VA GS+ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              +PG+AHLCEHM+L+ GSKKYP P  YH +I+++NGS+NA+TTGEQTTFYFE+P    +
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E+ FE+ +DIF+S F +PLF  T +NKEIYAI++EHD N  N+TKILYHATRLL +  H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRF+TGN+                   ++F+ NY  S MT+C++GP SVN L K A++
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F  +     N+                        ++A++         + F+IL   +
Sbjct: 241  KFGELRPHKANEKV----------------------QAALTPN-------DGFNILQTRW 271

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
                    CF      N I + S K PI+R LFP+      F K D L F   W ELFGD
Sbjct: 272  GHTKAANNCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGD 331

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E+  S C+FL +   IT+C+A+ S F+ ++ GL++ELSLT +G  N ELI  ++    + 
Sbjct: 332  ESAGSFCHFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVP 391

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENL-ALNRPSFLLK 479
            K S  +  +LARFLSE  +ID+IRF+    E++ M E S +   LQE++  L+     + 
Sbjct: 392  KFSREHTVQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMG 451

Query: 480  EFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFT 539
                +N+ S  G+  F ENE S+ WW+ +A  FQ FLK ++N  N+R++ LG +E    +
Sbjct: 452  SPMVLNEQSTQGL--FSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLS 509

Query: 540  TLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAIL 599
            T     K+  TDPFYDF Y T K   +       +D      IP +N F P   ++   L
Sbjct: 510  TTATQGKIAGTDPFYDFAYFTCKLSLRKPHANILNDY--KFSIPPKNEFKPSWAENFPSL 567

Query: 600  SANL--EAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXX 657
               L   +   +  S+G+ I  +    + P LV +N N + WVL+               
Sbjct: 568  MRKLYYSSTKSQQASLGFAIKSDEGTRT-PQLVSQNENYDMWVLSDCPASSHQSKAIVSF 626

Query: 658  XXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISG 717
                W I+PSP +TM+LE+L Q++ + +  +LYP+L+LG+T+EI  S  GDV+L + ISG
Sbjct: 627  EISCWEIQPSPENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISG 686

Query: 718  FQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLI 777
            +   +  +++                +     +AR+  R  Y+ A   +S+ +AS+GLL+
Sbjct: 687  YSKRLGKVIESLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLV 746

Query: 778  MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG----TNELAMKLSHLI 833
            ++EK+MW+L+DR DA+E  D+ +F  F + F    K+++ FI G     +++   L   +
Sbjct: 747  VMEKYMWSLQDRIDAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNL 806

Query: 834  YDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEY 893
             +H   + T   ++  +    ST  L P  N Y ++PG + D  N   Y+IQTG R++  
Sbjct: 807  TNHLHGTQT---DFQREPEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCT 863

Query: 894  IATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSI 953
              TLT+L+ Y+M   L  ELRN++Q+GYVV GG+R L N +GLHI+IMS  +P  LE  I
Sbjct: 864  AYTLTALSAYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKI 923

Query: 954  DEYMWRLENDTIGSLNESTFKLTFLLPFINTMQK-DXXXXXXXXXXXXXXXXXXXXXQAG 1012
            +EY+  LE + +  + E TF+  +L  F+N   K +                     Q+G
Sbjct: 924  NEYLLYLEREVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSG 983

Query: 1013 DSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXXXXX 1072
            DS    +  MK H  L+ +I + R     + + AI+  ++++LT+  YL FFR       
Sbjct: 984  DSDILNSSFMKKHKRLRNQIADGRYTFADR-DSAINTTLLQELTIDHYLCFFRERISIHS 1042

Query: 1073 XXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLK 1132
                         M  EEI NR+++ Q+  FLK+ GLTI+  +L+E+V+ S+GKP  L K
Sbjct: 1043 KTRAKLSVMVKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAK 1102

Query: 1133 EIVKYFKKKDEAKKLYFXXXXXXXXXXSMTVXXXXXXXXXXXXXXXXWQTEPIKSALPLV 1192
            E+ + F  + E  KL             +TV                W + P   A  L 
Sbjct: 1103 ELYQSFHSRHETWKL--CTVMLRELLKMLTVNLKFRHQRQTNMAASEWGSTP---ATGLT 1157

Query: 1193 LVNDIKAYK 1201
            L+ DI  Y+
Sbjct: 1158 LIKDINIYR 1166

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1172 (38%), Positives = 650/1172 (55%), Gaps = 53/1172 (4%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            M+W  V+NYDI   IP +     +KLC+LPNG+L ++ISDP    + CS++VATGSHNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
              +PGLAHLCEHM+ +AGSKKYPD + YH+ +S++ G+HNAYTTGEQTTF+  +P +   
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E  F+ +LD+FSS  K+PLF  T++NKEIYAI+SEHD N  +L+KILY A RL+AN  H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFS+FSTGNI                   +YF+TN+   N+T+CIKG QSVN+LTK ALT
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
             F  I  S       I+               S+S+  ++    ++  ++E F IL  A+
Sbjct: 241  NFGYIQSSRAAKGNVIR--------------RSISKRDSIRSNGKKLKKIESFRILEKAW 286

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
              KYKDIKCF  +  +N + IKS KQ  +R LFP++     F   +L  F  +W ELFGD
Sbjct: 287  KAKYKDIKCF--DDRNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGD 344

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E+  SL  +  + + IT+   + S+F     GL+++ SLT +G +N   II+ +    +E
Sbjct: 345  ESKGSLHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLE 404

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480
             +   N   L+R L E  TI+ I ++ + +E  S D  SE++  LQ +L      +L KE
Sbjct: 405  LVRWENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKE 464

Query: 481  FPFI----NDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLG-DIET 535
             P +    ND+SE  ++          WW  +A  FQ F+  ++   N+++  LG +++ 
Sbjct: 465  SPNLIELNNDHSENLMT-------VTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKH 517

Query: 536  PKFTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN---IGIPKRNTFMPEI 592
              F  L    K +STD +Y F+YI     FK  Q+  E     N   + +P +N F+P+ 
Sbjct: 518  NAFFELGSQNKDWSTDAYYGFDYIKSHLNFK--QIIDEPCTTVNDYSLALPSKNLFIPQF 575

Query: 593  GKSLAILSAN-LEAILKRNESIGYPIIYNNSIES-KPGLVLKNSNQETWVL--NSPLQHX 648
             ++LA L    +E  L+   ++  P +  + + + KP LV ++S+ E W+L  +   +  
Sbjct: 576  FQNLANLQQIFMEYSLRSRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESV 635

Query: 649  XXXXXXXXXXXXNWSIK-----PSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGA 703
                         +SI+     PS  +TMHLE+LG++L  L+T +LYP+L+L Y YEI  
Sbjct: 636  ASPDRIPKQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIAT 695

Query: 704  SVNGDVKLMITISGFQSGIMSLLQXXXXXXXXXXXXXPT--VTHSALHRARVMTRRKYED 761
            S+ GDV+L  TI GF  G++ +                   VT+S L +AR+  R KYE 
Sbjct: 696  SLKGDVQLCCTICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEA 755

Query: 762  AASGNSVKLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFF--KSAKYIKSFI 819
            A+S   VKLAS+GLLI+LE+ MWTLEDR +ALE+SD++SF  FC +F    S  Y+  F+
Sbjct: 756  ASSEICVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFV 815

Query: 820  SGTNELAMKLSHLIYD---HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDI 876
             G    A +++ LI+    H + S   S    +     ST  LKPG N Y ++PG   D 
Sbjct: 816  QGDMRYADEVNCLIHSKLTHHLNSSRCSTPTTDYRR--STTVLKPGVNYYVEYPGQGDDP 873

Query: 877  NNCINYFIQTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGL 936
            NN I +F+Q G RN+    TL   T Y+M   LV +LR +KQ+GYVV GG+R +T+T+GL
Sbjct: 874  NNSIVHFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGL 933

Query: 937  HITIMSLADPEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTM-QKDXXXXXXX 995
            HIT+MS     DLE  IDEYM  LE+  + +L ES F+  +L P+I  + +         
Sbjct: 934  HITVMSAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTS 993

Query: 996  XXXXXXXXXXXXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKL 1055
                          Q G S   E   MK H  L   I        L+ N+ +D  +++ L
Sbjct: 994  GGPTNLLSEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDF-LQGNDILDRTVVQGL 1052

Query: 1056 TLKEYLEFFRATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDE 1115
            TL  Y+ FF+                    M +EEI NR++FLQ+ TFLK+KG  IK  E
Sbjct: 1053 TLHRYMTFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTE 1112

Query: 1116 LKEIVEISEGKPSKLLKEIVKYFKKKDEAKKL 1147
            L++IV  S+G P++LL+ ++ +FK + E  KL
Sbjct: 1113 LRDIVNKSQGSPTQLLRHLLAHFKTRGENWKL 1144

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1204 (34%), Positives = 653/1204 (54%), Gaps = 29/1204 (2%)

Query: 9    YDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAH 68
            +D+ +Y P SS    +++ +L N +L ++ISDPS  +ASC++SVATGSHNDP  +PGLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL 128
             CEHM+LS+GSKKYP+PN +H+ ++ +NGS NA+TTGEQT+FYFE+P   ++    FE+L
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTG 188
            +DI ++SFK+P+F +  VNKEIYAI SEH GN   L+K+LYHATRLLAN  HPFS FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  NIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
            N+                    YFK ++ A  M +CI+G QS+N L+K A   F  I  S
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPGS 249

Query: 249  IRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAYNPKYKDIK 308
                +     LK   +       SS+   S ++        L++  IL + + P+Y    
Sbjct: 250  AAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLAS-------LDESRILKDTWLPRYSKEP 302

Query: 309  CFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDENDNSLCY 368
             F   P +N++ I+S K P++R +FP++     F   ++  +   WC++ GDE   S C+
Sbjct: 303  VFTPRPKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCH 362

Query: 369  FLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIEKLSEANDT 428
            FL+++N I+D  AF S+FA+N  GL+++L LT  G  N  +I+       +  + + + +
Sbjct: 363  FLRQNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLS 422

Query: 429  ELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKEFPFI---N 485
            ++ ++LSE N+ID+++F+ +  E + M+  +E+  +L ++L++  P F+LK    +   N
Sbjct: 423  KIGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCN 482

Query: 486  DYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTTLTEDL 545
            D     I ++ E++ S +WW  +A  FQ F+K +   +N++++ LG +    F + +  L
Sbjct: 483  DPRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSNSMQL 542

Query: 546  KVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILSANLEA 605
               + D  Y+++Y+  K   +  +L   D+ +    IP  N F+  +G  L+ +   L A
Sbjct: 543  ---TADTHYEYDYL--KAYIEITELEAIDNEYE-FHIPSPNQFLVPVGHKLSYIKKALLA 596

Query: 606  ILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXXXXXNWSI 664
               ++E+    I+  +  +++ P L  KN+  E W     +               + ++
Sbjct: 597  ASAQSENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTL 656

Query: 665  KPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQSGIMS 724
            KP+P  TM LE+LGQLL  +++  LYPA R GYTYE+  S  GDV+L IT+SGF  GIM 
Sbjct: 657  KPAPEYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMG 716

Query: 725  LLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIMLEKHMW 784
            +L                ++     RARVM R KYE+AAS N   LAS+GLLI+LE  MW
Sbjct: 717  ILNIILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMW 776

Query: 785  TLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTN-ELAMKLSHLIYDHWILSDTI 843
            TLEDR +ALE+ D+ SF  F   F     Y+   + G++  LA K++  + D  +     
Sbjct: 777  TLEDRLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCV-DAKLTHHMS 835

Query: 844  SLNYFEKNNIL---STCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIATLTSL 900
            SL      NIL   +T F+  G N+  +  G   D NN I YFIQTG R+N Y  TLT  
Sbjct: 836  SLE--TGKNILVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVF 893

Query: 901  TDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRL 960
            T+++M   LV +LR +KQ+GYVV GG+R L++T+GLHIT MS   PE LE+ IDEY+  L
Sbjct: 894  TEFLMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYL 953

Query: 961  ENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXXXXXXXXXXXXXQAGDSVNFETQ 1020
            E+  +  LN   FK+ +L  F+  ++ +                         S N  + 
Sbjct: 954  ESMVLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQN-GSM 1012

Query: 1021 QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXXXXXXXXXXXXX 1080
             MK H  ++ +I   R     + +E I+   I+ LTL+EY+ FF                
Sbjct: 1013 AMKSHKRIRNQISYRRYNFE-EEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSV 1071

Query: 1081 XXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKK 1140
                 M+K+E+ ++ +FLQ+ +FLK+KG  I  ++LK I+  S GKP+ LLK +  YF+ 
Sbjct: 1072 MVTSPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRV 1131

Query: 1141 KDEAKKLYFXXXXXXXXXXS---MTVXXXXXXXXXXXXXXXXWQTEPIKSALPLVLVNDI 1197
            + E+ KL            S                        ++ +  A+PL+ V D+
Sbjct: 1132 RGESIKLLTAIVKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDV 1191

Query: 1198 KAYK 1201
             +Y+
Sbjct: 1192 NSYR 1195

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1158 (36%), Positives = 638/1158 (55%), Gaps = 54/1158 (4%)

Query: 6    VKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPG 65
            V+++D+  Y P SS     +LCRL NGIL ++ISDP+    S S+SVA+GSH DP  + G
Sbjct: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLG 67

Query: 66   LAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNF 125
            LAHLCEH ILSAGSKK+P  + YH++++++ GSHNAYTTGE TTFYFE+P    S E  F
Sbjct: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127

Query: 126  ERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRF 185
            +++LD  +SSFK+P+F ++S+NKEIYAIESEH+ N  +  K LYHATRLLAN +HPFSRF
Sbjct: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187

Query: 186  STGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
             TGN                     YFKTNY+A+ M LC++GPQS+N L K A  YF  +
Sbjct: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247

Query: 246  DDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMS----KGNEEDCRLEDFHILSNAYN 301
              S   D T     + P  + +R S    SQ+  +     K +++  +++D      A+ 
Sbjct: 248  PASRDRDPT-----RPP--LKKRPSSGVASQDLHVRPLDFKNSKQQTQVQD------AFV 294

Query: 302  PKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDE 361
            P              N + I+S+K P+LRL+FP+         +D++     WC+ FGDE
Sbjct: 295  PD-----------TSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDE 343

Query: 362  NDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIEK 421
               SL + LK +NLI    A  ++F+  + GL +E +LT  G  + +LII  + +  I +
Sbjct: 344  GVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPR 403

Query: 422  LSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKEF 481
            L      ++A+ LSE N  D++ F+ +G E +SM+  + +SSRL        P  LLK  
Sbjct: 404  LIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGS 463

Query: 482  PFIN-DYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540
            P I  + + + I ++ E+  S+ WW+ +A  FQ F+  +VNR+NLRI+ LG+   PK   
Sbjct: 464  PLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNC--PKSDL 521

Query: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIG----IPKRNTFMPEIGKSL 596
            L+    V  TD +Y+F Y   K     + L   ++++R  G    +P  + F+P +G+ L
Sbjct: 522  LSSVTSVSKTDAYYEFTYQISKI----DMLSVREELYRIPGFSFRVPCYDMFLPTVGRKL 577

Query: 597  AILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHXXXXXXXX 655
             ++   L+A   R+++    ++  N+ +++ P L  KNSN E WV               
Sbjct: 578  GLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSII 637

Query: 656  XXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITI 715
                 + +I+  P+ TM LEVL QLLG  ++  LYP+ +LGYTYEI  S  G  +L  TI
Sbjct: 638  SIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTI 697

Query: 716  SGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGL 775
            SGF  G+ ++++              TVT +   +ARV  R KYE+AAS NS  LA++GL
Sbjct: 698  SGFPEGVCAMVRVIIDQTKSLINSD-TVTPAMFRKARVAVRNKYEEAASANSTTLATLGL 756

Query: 776  LIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG----TNELAMKLSH 831
            LI+LE+ MW +EDR DALEE DI SF  FCS F     Y+  F  G    T E++  L  
Sbjct: 757  LIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDS 816

Query: 832  LIYDHWILSDTISLNYFEKNNILS--TCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
             +  H      +S   + +  +    T  LKPG N++ +      D ++ I YFIQTG+R
Sbjct: 817  GLTSH------LSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDR 870

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
            ++  + +LT LT+++M   LV +LR +KQ+GY VF G+R L+ T+GLHIT MS + PE L
Sbjct: 871  DDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHL 930

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXXXXXXXXXXXXX 1009
            E  ID+Y+  +E+D + +++E  F+  ++  F    +++                     
Sbjct: 931  ESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEAN 990

Query: 1010 QAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXX 1069
                ++  +   M+ H  ++ +I  +R        E  DL +++ LTL ++  FF+    
Sbjct: 991  VHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDL-EPADLGLLRALTLGQFRRFFQEKIS 1049

Query: 1070 XXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSK 1129
                            ++ +EIA ++LFLQ+ ++LK+KGL I   EL+ IVE S+GKPS 
Sbjct: 1050 ICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPST 1109

Query: 1130 LLKEIVKYFKKKDEAKKL 1147
            L++ + K+F  + E  +L
Sbjct: 1110 LMRGLFKFFLARGETLRL 1127

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1158 (35%), Positives = 648/1158 (55%), Gaps = 45/1158 (3%)

Query: 4    TQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVI 63
            T+   +D+ +Y P SS    +++ RL N +LT +ISDPS  +ASC++S+ATGSHNDP  I
Sbjct: 5    TKPAVFDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEI 64

Query: 64   PGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSES 123
            PGLAH CEHM+LS+GSK++P+PN++H+ +S++NGS NA+T+GEQT+FYFE+P   +S   
Sbjct: 65   PGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSL 124

Query: 124  NFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFS 183
             F++++ I + + K+P+F +  +NKEIYAI SEH GN  +LTK++YHA RLLA+ +HPF 
Sbjct: 125  VFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFH 184

Query: 184  RFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFN 243
            +F TGNI                    YF+ ++ A NM LC++GPQS+N L+K A   F+
Sbjct: 185  QFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFS 244

Query: 244  GIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCR-LEDFHILSNAYNP 302
             I          I +L+ P  +  R S       S+  K      R LE F IL +A++ 
Sbjct: 245  DIPS--------IPTLQVPRLLRWRSS-------SSFDKNRNLSVRPLESFQILKDAWSA 289

Query: 303  KYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDEN 362
            +Y     F + P HN+I ++S+K P++R +FPI+     F   +L  +  +WCEL GDE 
Sbjct: 290  RYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDEC 349

Query: 363  DNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIEKL 422
            + SLC++L+  + IT+  A+ SNFA+N  GL+++L LT  G  N + II  +    I  +
Sbjct: 350  EGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAI 409

Query: 423  SEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE-- 480
             +A  + LA+++SE N++D+++F+ +  E + MD  +++   L ++L+    SFLLK   
Sbjct: 410  LDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTL 469

Query: 481  -FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFT 539
             +   N+ S   +  + EN+ SK+WW  +A  FQ F+  ++++  +RI+ LG++    F 
Sbjct: 470  TYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFN 529

Query: 540  TLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAIL 599
               + +   +TD ++++EY+     F   ++   DDI     IP  N FM  +G  L+ +
Sbjct: 530  CNPDKI---TTDTYFEYEYVKI---FIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFI 583

Query: 600  SANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXXX 658
               L A   ++E+    ++  +  + + P L  KNS  E W+    +             
Sbjct: 584  KHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSME 643

Query: 659  XXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGF 718
              + S++P+P  TMHLE+LGQLL  ++   LYPA R GYTYE+  S  GDV+L +TISGF
Sbjct: 644  LISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGF 703

Query: 719  QSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIM 778
              GI++LL+              ++      +AR++ R KY++A+S + V LAS+GLLI+
Sbjct: 704  TDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLIL 763

Query: 779  LEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--------NE-LAMKL 829
            LE  MW LEDR +ALE+  + SF  F  +F     Y+   I G+        NE L+ +L
Sbjct: 764  LENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERL 823

Query: 830  SHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
            +H    H   +D       E     +T  +  G N++F+  G   D NN I YFIQTGER
Sbjct: 824  TH----HISRADDNVCRLSEP----ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGER 875

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
            +N YI TLT LT++IM   LV +LR +KQ+GY+V GG+R L++T+GLHIT M+ + PE L
Sbjct: 876  DNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFL 935

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXXXXXXXXXXXXX 1009
            E  I+EY+  LE+  +  L    FK  ++   ++ +  +                     
Sbjct: 936  EEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEAN 995

Query: 1010 QAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATXX 1069
                  N  +  MK H  L+ +I   R   + + +E +D   ++ L L EY+ FFR    
Sbjct: 996  VHSGQRN-TSLAMKSHKRLRTQISYRRYNFD-EDDEPVDARTLQNLKLSEYMRFFRQRIS 1053

Query: 1070 XXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSK 1129
                            M+KEE+  + L+LQ+ +FLK+KG  I   +L  IV+ S+GKP+ 
Sbjct: 1054 IYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTA 1113

Query: 1130 LLKEIVKYFKKKDEAKKL 1147
            LLK ++ YF+ + E+ KL
Sbjct: 1114 LLKGLLSYFRSQGESLKL 1131

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1161 (37%), Positives = 618/1161 (53%), Gaps = 51/1161 (4%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            MS+   KN+D+  Y P S      KLC+L NG+L  +ISDPS  + SCS+SVATGSHNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
                GLAHLCEH ILS GSKKYP  N YH++++++ GSHNAYTTGE TTFYFE+P +  S
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180
             E +F++ LD+ +SS K PLF +  +NKEIYAIESEH+ N   + K LYHA+RLLAN  H
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240
            PFSRF TGN                    S+ K  Y  SNM+LC++G QS+N LTK A+ 
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300
            +F  +  S +N                R S SSL      +KG  +   +  F IL   +
Sbjct: 241  FFGDLPASGQNI--------------ARPSSSSLFS----NKGTAQS--MPYFKILKYEW 280

Query: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360
             PKYKD++ F +  + N + I+S+K P+LRL+FP+       +  D+  F   WC+ FGD
Sbjct: 281  TPKYKDVRAFSQG-SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGD 339

Query: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420
            E+  SL   LK   LI+   +  S+FA    GL +EL+LT  G KN   I+  + +  I 
Sbjct: 340  ESVGSLADCLKGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIP 399

Query: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480
            KL      ++AR LSE N I++++F+ +  E + MD  + +S+ L  +L    P  LLK 
Sbjct: 400  KLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG 459

Query: 481  FPFINDYSE-TGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFT 539
             P I    E + I ++ EN  S+ WW+ +A  FQ  +  +VNR+NLR + LGD     F 
Sbjct: 460  SPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNF- 518

Query: 540  TLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAIL 599
             L        TD +Y+F+Y        + QL        +   P  +TF+P + + L+++
Sbjct: 519  -LASVRSTTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLI 577

Query: 600  SANLEAILKRNESIGYPII-YNNSIESKPGLVLKNSNQETWVLNSPLQHXXXXXXXXXXX 658
               L+    R +S    +I  ++ +++ P L  KNSN E WV    L             
Sbjct: 578  KQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFE 637

Query: 659  XXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGF 718
              + S+  SP +TM+LE+LGQLL   ++  LYP+ +LGYTYEI  S  GDV+L +T+SGF
Sbjct: 638  IISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGF 697

Query: 719  QSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIM 778
              G+ +L++               ++      AR+  R KYE+AA+ N   LAS+GLLI+
Sbjct: 698  PEGVYNLIKIIVEEIKSFSSRD-IISSKVFREARIAVRSKYEEAAAANCTALASLGLLII 756

Query: 779  LEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWI 838
            LE+ MW +EDR +ALEE    +F  FCS F  S  Y+  FI G      K++  +   W 
Sbjct: 757  LEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFL--KWS 814

Query: 839  LSDTI--SLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIAT 896
            L+  +  +  Y           LK G N++ +      D NN I YFIQTGER +    T
Sbjct: 815  LTSHLEDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYT 874

Query: 897  LTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEY 956
             T L ++ +   LV +LRN+KQ+GY VFGG+R L+ +IGLHIT MS + PE LE  I+EY
Sbjct: 875  YTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEY 934

Query: 957  MWRLENDTIGSLNESTFKLTFLLPF--------INTMQKDXXXXXXXXXXXXXXXXXXXX 1008
            +  LE   + ++ E  F+  ++  +        +N MQK                     
Sbjct: 935  LSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVR----- 989

Query: 1009 XQAGDSVNFETQ--QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRA 1066
                 S N E Q   M+LH N K +I N R    ++  E ++ +I++ +TL E+  FF  
Sbjct: 990  -----SGNLEEQGSAMRLHKNTKNQISNRRYNFGME-EEPVNRDILRTITLSEFRSFFSE 1043

Query: 1067 TXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGK 1126
                               M  EEI+ ++LFLQ+ +FLK+KGL I   +L +I+E S G+
Sbjct: 1044 KISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGR 1103

Query: 1127 PSKLLKEIVKYFKKKDEAKKL 1147
             S +L+ + +YF    E  KL
Sbjct: 1104 TSGILRGLFRYFSANGETMKL 1124

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1162 (32%), Positives = 603/1162 (51%), Gaps = 60/1162 (5%)

Query: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
            M+   V+  D+PIY P S+    ++  +L NGI  ++ISDP    AS   SVATGSHNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIP-CLFT 119
              +PGLAHLCEHMI+S+ SKK+P  + YH L+ E NG+ NA+TTGEQT+FYFEIP     
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  SSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSK 179
            + +  F+ L+ + +     P+F+   +NKEI AI++EH+ N   ++K LYH T+ LA  +
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSRFSTGNIXXXXX--XXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKY 237
              FSRFSTGNI                    + ++  N+ A N+++ I+G QS++ L K 
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  ALTYFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILS 297
              T F       R  +T IKS        Q FS                   +E F  L 
Sbjct: 241  VQTTFG----DFRTKST-IKS--------QSFS-------------------IESFKKLQ 268

Query: 298  NAYNPKYKDIKCFKRNP-NHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCE 356
              +  +Y +    K+ P   N+I I+S+K PILRL+FP+   +  F++ +L  F  VW +
Sbjct: 269  KVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSD 328

Query: 357  LFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQ-ELIINSIC 415
            LFGDE+  S+       N++T      S F ++  GLV++  LT +G K   E ++  + 
Sbjct: 329  LFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLF 388

Query: 416  NSAIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPS 475
               +      +  E+A++L+E NTI++++F+ +  ++++MD+ S++ S L   L    P 
Sbjct: 389  QGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCEDPQ 445

Query: 476  FLL-KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIE 534
            F+L     F  +   + I ++ E+  SK WW S+A  F  F+K Y++  N +++FLGD++
Sbjct: 446  FILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQ 505

Query: 535  TPKFTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGK 594
            +  F    +       D  Y F+Y       K N ++     FR   +P    F+  + K
Sbjct: 506  SNDFLKSRQVPTNVKFDEHYRFQYEL--SLIKLNHVKMSPKDFR---LPSSTAFLFGLEK 560

Query: 595  SLAILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVL-NSPLQHXXXXX 652
            +L+ L  +L A+L++++     II  +  +++ P L+ KN N E WV   + L++     
Sbjct: 561  NLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEENSLEY--SSR 618

Query: 653  XXXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLM 712
                    N  ++PS  +TM+LE+L QLL   +   LYP+ R+GY Y+I A+  GDV+L 
Sbjct: 619  SVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLA 678

Query: 713  ITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKLAS 772
            +TI+GF  G+  +LQ               +T+S    +R++ R KYE+AA  NS  LAS
Sbjct: 679  VTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLAS 738

Query: 773  VGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFF-KSAKYIKSFISGTNELAMKLSH 831
            +G+LI+LEK + TLE+R DALE+ DI SF  FC   +   + Y+   I G   +A  ++ 
Sbjct: 739  LGVLILLEKELTTLEERLDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQ 798

Query: 832  LIYD--HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889
             +    H +    ++     +     T  L  G N + +    + D  N + YFI+TG+R
Sbjct: 799  YMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDR 858

Query: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949
             N    T++SL +Y M   LV +LRN+KQ+GYVV GG+R LT+T+G+HI++MS   P  +
Sbjct: 859  TNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTI 918

Query: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDXXXXXXXXXX-XXXXXXXXXX 1008
            E  I+EY++ LE + +G++ E+ F+   L  ++  ++ +                     
Sbjct: 919  EDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEAS 978

Query: 1009 XQAGD-SVNFETQQMKL--HNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFR 1065
              +G+   N ++Q   +  H  LK  I       +      +D+ ++ KLTL+E+   F 
Sbjct: 979  VHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFS---ETKVDVCLLSKLTLQEFKRLFM 1035

Query: 1066 ATXXXXXXXXXXXXXXXXXLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEG 1125
                                M K +I    + +QL  FLK KG  I RDEL+EIV  + G
Sbjct: 1036 EKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAG 1095

Query: 1126 KPSKLLKEIVKYFKKKDEAKKL 1147
            KP+ L KE+  +F+ + ++ +L
Sbjct: 1096 KPTSLFKELFHHFRTQGQSLRL 1117

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  531 bits (1368), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 365/1206 (30%), Positives = 606/1206 (50%), Gaps = 137/1206 (11%)

Query: 4    TQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVI 63
            T VK + +P Y+P       YKL +LPNGI  ++ISD      SCSL+VA GSHNDP+ +
Sbjct: 3    TDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATV 62

Query: 64   PGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSES 123
            PGLAHLCEHMIL+AGS  +P P  +H LI++ NG  NAYTTGEQT+FYF++P +  S  +
Sbjct: 63   PGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEGT 122

Query: 124  -NFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPF 182
              FE LL +FSS+FK PLF  + +NKEIYAI+SEH+ N  N  K+LY ATRLLAN  HPF
Sbjct: 123  LAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPF 182

Query: 183  SRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYF 242
            SRF TG++                   SYF  N+   N+TLC++GPQS+N L K  +  F
Sbjct: 183  SRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNF 242

Query: 243  NGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAYNP 302
            N I          +  L + +  + R S + L +E+           L+  +IL + + P
Sbjct: 243  NDIKP--------LPVLPTAI-GNNRDSDTELFEET-----------LKRLNILYDVWAP 282

Query: 303  KYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLL---RFIMVWCELFG 359
            +Y  + CF     +N I + S  +   R++ P+  +D    ++D +    F  +  EL G
Sbjct: 283  RYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITND---TREDAIFTEVFTNICVELLG 339

Query: 360  DENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAI 419
            +E   S C+FLK+ + + +C+ + S FA+ + G+V+E     TG    E I+N +  + I
Sbjct: 340  NEEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLI 399

Query: 420  EKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLK 479
                     +LARF+ E   I+ I F+   K  + M+E S++S +LQ++L      +LL 
Sbjct: 400  PMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLLM 459

Query: 480  EFP-FINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538
            + P F+++Y E  +S  E+     ++W      F+ FL+R++   N +++    I T + 
Sbjct: 460  KSPSFLHNYEE--MSKTEK----LHYWPLIVEKFKVFLRRHMILPNAKVI----IPTSEP 509

Query: 539  TTLT--------EDLKVYS-TDPFYDFEYITFKYKFKANQLRQEDDIFR-NIGIPKRNTF 588
             T T        + ++V S TDP+Y+F Y  +   F  +++     IF      P  N F
Sbjct: 510  FTKTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRV-----IFPYQFSFPGPNEF 564

Query: 589  MPEIGKSLAILSANLEAILKR-NESIGYPIIY--NNSIESKPGLVLKNSNQETW------ 639
            +P   ++L  L   L  I +R N S   PI+   N+   S P LV +  + E W      
Sbjct: 565  IPPKYRNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVD 624

Query: 640  -----VLNSPLQHXXXXXXXXXXXXXNWSIKPSPASTMHLEVLGQLLGILMTRELYPALR 694
                 V+N+ ++              N  I+P+P S++HL ++ +++ + +   LY   +
Sbjct: 625  GIFSKVVNADIK------SYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTK 678

Query: 695  LGYTYEIGASVNGDVKLMITISGFQSGIMSLLQXXXXXXXXXXXXXPTV-THSALHRARV 753
            LG+++ + A+++G +   I ++G  +GI+ +L+               + T++ + +ARV
Sbjct: 679  LGFSFHLQAALDGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARV 738

Query: 754  MTRRKYEDAASGNSVKLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAK 813
              R +YE A  G+SVK+ + GLL+ LE H+W+ E+R DALEESDI  F+ F + FF++ K
Sbjct: 739  AIRSRYEAATKGSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHK 798

Query: 814  YIKSFISGTNELAM-KLSHLIYDHWILSDTISLNYFEKNNILSTC--------FLKPGEN 864
            + K F   ++   + K++      +++   ++    E N+ L  C         LKPGE 
Sbjct: 799  HTKVFAQSSSTSNIDKIA-----RYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEE 853

Query: 865  VYFQHPGDEGDINNCINYFIQTGERNNEYIAT--LTSLTDYIMQSNLVSELRNRKQVGYV 922
             + +  G + D NNC+  +++        +    +   TDY+ Q  LV ELRN++QVGY 
Sbjct: 854  RHIKLIGRDNDPNNCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYA 913

Query: 923  VFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRLENDTIGSLNESTFKLTFLL--- 979
            V GG+  L N +G+++ ++S   PE +E+ I+ Y   +      ++++     + ++   
Sbjct: 914  VDGGLVILNNVVGVNVVVVSSTSPEHIEQEIESYYAHVRQYLSDNVDQIWRDYSKIINDR 973

Query: 980  -PFINTMQKDXXXXXXXXXXXXXXXXXXXXXQAGDSVNFETQQMKLHNNLKKRIFNNRIQ 1038
             P +  +  D                           N E +   +    +  + N   Q
Sbjct: 974  DPLMYLLDHDVWY------------------------NIERENSDIPEYSRDHVAN--CQ 1007

Query: 1039 LNLKYNEAIDLNII------------KKLTLKEYLEFFRATXXXXXXXXXXXXXXXXXL- 1085
               KY + I+L ++               +++EYL+F  ++                 + 
Sbjct: 1008 RVFKYKDLIELLVVDTPISGRHPDYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVW 1067

Query: 1086 ----MAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKKK 1141
                M K ++  R++  QL +FLK+KGL I   +L +I+  + GK + + K + + FK++
Sbjct: 1068 VYSPMDKRDVFQRQVKYQLESFLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQ 1127

Query: 1142 DEAKKL 1147
            +EA K 
Sbjct: 1128 NEAGKF 1133

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 138/271 (50%), Gaps = 18/271 (6%)

Query: 1   MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60
           M+    KN+++    P       Y+   LPN +  ++I+DP  + A+ SL V  GS NDP
Sbjct: 25  MTAASYKNHNLSFQKPDLDE-RSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120
             +PGLAH CEH++   GS+K+PD N Y   +S+  G  NAYT    T ++FEI      
Sbjct: 84  EPLPGLAHFCEHLLF-MGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI------ 136

Query: 121 SESNFERL---LDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLAN 177
              N E L   LD FS  F  PLF + + +KEI A++SE+  N  N    +Y   + L+N
Sbjct: 137 ---NAEHLFGALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSN 193

Query: 178 SKHPFSRFSTGNIXXXXXXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKY 237
            KHP+ +FSTGNI                    ++  +Y+A+ M LCI G + ++ L ++
Sbjct: 194 LKHPYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQW 253

Query: 238 ALTYFNGIDDSIRNDNTFIKSLKSPVYMHQR 268
               FN     ++N +  +   + P+ + ++
Sbjct: 254 TADLFN----DVKNKDKPLPVFQDPILLKEQ 280

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 94/199 (47%), Gaps = 8/199 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  WT  ++  AL++   +    F    F+   Y +S I G    + AM++  L+  
Sbjct: 673 LINERTWTTTEKLSALDKISYDQLLTFIPTIFEEL-YFESLIHGNLKYDEAMEIDSLV-- 729

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             +L++   LN   +N+ L +  L  G+   ++    D  ++N+CI +  Q  +  +E +
Sbjct: 730 KLLLTENNILNLQIQNDKLRSYILPKGKTFRYETDLKDPKNVNSCIQHVTQI-DIYSEEL 788

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +   +L   ++       LR ++Q+GYVVF    +   T  + I + S      LE  ID
Sbjct: 789 SAKCALFAQMIHEPCFDTLRTKEQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRID 848

Query: 955 EYMWRLENDTIGSLNESTF 973
            + +++   ++ +++E TF
Sbjct: 849 NF-YKIFGKSLKTMSEDTF 866

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 130/242 (53%), Gaps = 7/242 (2%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++I DP+ + ++ +L V  G+ +DP  +PGLAH CEH++   GS+K+P
Sbjct: 50  YRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEHLLF-MGSRKFP 108

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T +YF++      +  + +  LD FS  F  PLF +
Sbjct: 109 DENEYSSFLSKHGGSSNAYTGAQNTNYYFQV------NHEHLKGALDRFSGFFTGPLFSK 162

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A++SE+  N  N    LY   + L+N  HP+ +FSTGN+             
Sbjct: 163 DSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTLNEIPKSKGVD 222

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                 +++   Y+A+ M LC+ G + ++ L+ +A   F+ + +  R    F  S+    
Sbjct: 223 VRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDVPNLPRPAPEFEASILDGA 282

Query: 264 YM 265
           Y+
Sbjct: 283 YL 284

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 81/187 (43%), Gaps = 13/187 (6%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  WT E++ + +E+        F    F+   + ++ + G    E A ++  LI  
Sbjct: 675 LVNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEEM-FFETLVHGNIKYEEADQIDSLI-- 731

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIA 895
             + S+++S +  +   I S        + Y     D  ++N+CI Y IQ G  + E ++
Sbjct: 732 QMLRSNSVSNSQIKNARIRSYVLPLGKTHRYEAKLADTQNVNSCIQYVIQLGVYD-EALS 790

Query: 896 TLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDE 955
            +  L   ++       LR ++Q+GYVVF    +   T  + I I S       E +   
Sbjct: 791 AIGRLFAQMLHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQS-------EHTTPY 843

Query: 956 YMWRLEN 962
             WR+E+
Sbjct: 844 LEWRIES 850

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 129/244 (52%), Gaps = 7/244 (2%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  ++I DP  + A+ SL V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 75  YRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGLAHFCEHLLF-MGSEKFP 133

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T ++FE+      +  +    LD FS  F  PLF++
Sbjct: 134 DENEYSSYLSKHGGSSNAYTASQNTNYFFEV------NHQHLLGALDRFSGFFSCPLFQK 187

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A+ SE+  N  N    +Y   + L NSKHP+ +FSTGNI             
Sbjct: 188 DSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFSTGNIETLGESPKENGLN 247

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  + K  Y+A+ M LCI G + ++ L+++    F  + ++ R    + +S+  P 
Sbjct: 248 IRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKDVSNNDREVPYYPESIMQPE 307

Query: 264 YMHQ 267
           ++ +
Sbjct: 308 HLQK 311

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 83/188 (44%), Gaps = 15/188 (7%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W+  ++    E+       +F    ++   + ++ + G   +E A+++  LI  
Sbjct: 700 LINERSWSTAEKLQVFEKLTFEQLNSFIPTIYEGV-FFETLVHGNIKHEEAIEVDSLIKS 758

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             ++++ I  N    NN L +  L  G++  ++    D  ++N+CI +  Q    + E +
Sbjct: 759 --LIANNID-NLQVSNNRLRSYLLPKGKSFRYETDLKDPKNVNSCIQHVTQLDVYSEE-L 814

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           + L+ L   ++       LR ++Q+GYVVF    +   T  + I I S       E +  
Sbjct: 815 SALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQS-------EHTTP 867

Query: 955 EYMWRLEN 962
              WR+ N
Sbjct: 868 YLEWRINN 875

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 125/230 (54%), Gaps = 13/230 (5%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  +VI DP+ + A+ +L V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 64  YRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHLLF-MGSEKFP 122

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL---LDIFSSSFKDPL 140
           D N Y   +S+  GS NAYT+   T +YFE+         N E L   LD FS  F  PL
Sbjct: 123 DENEYSSFLSKHGGSSNAYTSSLNTNYYFEV---------NHEHLYNALDRFSGFFTCPL 173

Query: 141 FKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXX 200
           F + S +KEI A++SE+  N  N    +Y   + L+N +HP+ +FSTGN+          
Sbjct: 174 FNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITLGENPKSL 233

Query: 201 XXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIR 250
                     ++  +Y+A+ M LCI G + ++ L+ +A   F  + ++ R
Sbjct: 234 NLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVRNTNR 283

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 85/182 (46%), Gaps = 6/182 (3%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W++E++ + +E         F    F+   Y ++ + G    E A+++  LI D
Sbjct: 689 LINERSWSVEEKLNVVEHITFEQLLAFIPTVFEEL-YYETLVHGNLKFEEAIEIESLIND 747

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             I ++  + N   KNN L + F+  G+   F+    D  ++N+CI +  Q    N E +
Sbjct: 748 ILITNENHN-NLQVKNNRLRSYFIPKGKTYRFEKELKDSKNVNSCIQHVTQLDVYNEE-L 805

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           + L+ L   ++       LR ++Q+GYVVF    +   T  + I + S      LE  I+
Sbjct: 806 SALSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIE 865

Query: 955 EY 956
           E+
Sbjct: 866 EF 867

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  147 bits (372), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 121/225 (53%), Gaps = 13/225 (5%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++ISDP+ + A+ +L V  G+  DP  +PGLAH CEH++   GS K+P
Sbjct: 47  YRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLF-MGSSKFP 105

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL---LDIFSSSFKDPL 140
           + N Y   +S+  GS NAYT  + T +YF++         N+E L   LD FS  F  PL
Sbjct: 106 NENEYSSYLSKHGGSSNAYTGAQNTNYYFQV---------NYEHLYGALDRFSGFFTGPL 156

Query: 141 FKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXX 200
           F + S +KEI A++SE+  N  N    LY   + L N  HP+ +FSTGN+          
Sbjct: 157 FNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKEL 216

Query: 201 XXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
                     ++  +Y+A+ M LCI G + ++ +TK+    F  +
Sbjct: 217 GLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDV 261

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 91/199 (45%), Gaps = 9/199 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W++E++ D +E+       NF    F+   Y ++ I G    E AM+++ L+  
Sbjct: 677 LINERSWSVEEKLDVMEKITYEELINFIPTIFEEL-YFEALIHGNLKYEEAMEIASLVK- 734

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             IL  +       KN+ + +  +  GE   ++    D  ++N+CI Y  Q  +  +E +
Sbjct: 735 --ILQPSDVTRLQTKNSRMRSYLIPRGETYRYETKLKDAKNVNSCIQYVTQL-DVYDEKL 791

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +  + L   ++       LR ++Q+GYVVF    +   T  + I I S      LE  ID
Sbjct: 792 SAKSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANMRILIQSEHTTPYLEFRID 851

Query: 955 EYMWRLENDTIGSLNESTF 973
            +  +   + + +++E  F
Sbjct: 852 TFYQKF-GELLNAMSEEDF 869

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  147 bits (371), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 131/248 (52%), Gaps = 13/248 (5%)

Query: 23  DYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKY 82
           +Y+   LPN +  ++I D + + A+ SL V  G+  DP  +PGLAH CEH++   GS+KY
Sbjct: 21  NYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGLAHFCEHLLF-MGSEKY 79

Query: 83  PDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL---LDIFSSSFKDP 139
           PD N Y   +S + GS+NAYT    T ++FEI         N+E L   LD FS  F  P
Sbjct: 80  PDENEYSSFLSTNGGSYNAYTGALNTNYFFEI---------NYEHLEGALDRFSGFFSRP 130

Query: 140 LFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXX 199
           LF + S +KEI A++SE+  N  +    +Y   + L+N KHP+ +FSTGNI         
Sbjct: 131 LFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTGNIQTLGTIPNE 190

Query: 200 XXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSL 259
                      ++  +Y+A+ M L I G + +++L  +A + F  + +  R    + + +
Sbjct: 191 QGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDVKNLNRELPVYEEKM 250

Query: 260 KSPVYMHQ 267
            +  Y+ Q
Sbjct: 251 LTEEYLMQ 258

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 89/182 (48%), Gaps = 8/182 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNEL--AMKLSHLIYD 835
           +++   W+++++   +++       NF    F    Y +S + G  E   A +++ L+  
Sbjct: 647 VIDDRAWSIKEKLSTMQKLTFEDLENFLPTIFNEV-YFESLVHGNFEKSDAAEVNQLVEK 705

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
           +  +S +I  N   +N+ L +  L+ GE   ++    D  ++N+CI +  Q G  N+  +
Sbjct: 706 Y--ISGSIH-NPQIRNDRLRSYVLQKGETYRYETLLEDPENVNSCIQHVTQIGLYNDR-L 761

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           A L+SL   I+     + LR ++Q+GYVVF    +   T  + I + S    E LE  ID
Sbjct: 762 AALSSLFAQIINEPCFNILRTKEQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRID 821

Query: 955 EY 956
           E+
Sbjct: 822 EF 823

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  147 bits (371), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 126/244 (51%), Gaps = 7/244 (2%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  ++I DP  + A+ SL V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 74  YRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLF-MGSEKFP 132

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T ++FE+      +  +    LD FS  F  PLF +
Sbjct: 133 DENEYSSFLSKHGGSSNAYTASQNTNYFFEV------NHQHLFDALDRFSGFFSCPLFNK 186

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A+ SE+  N  N    +Y   + L N+KHP+ +FSTGNI             
Sbjct: 187 DSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENGLN 246

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  + K  Y+A+ M LCI G + ++ L+ +    F  + ++ R    + + +  P 
Sbjct: 247 IRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKNVSNNGREVPYYAEPIMQPE 306

Query: 264 YMHQ 267
           ++ +
Sbjct: 307 HLQK 310

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 88/196 (44%), Gaps = 17/196 (8%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W+  ++    E+       NF    ++   + ++ I G   +E A+++  LI  
Sbjct: 699 LINERSWSTVEKLQVFEKLTFEQLINFIPTIYEGV-FFETLIHGNIKHEEAVEVDSLIKS 757

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             ++++ I+ N    NN L +  L  G++  ++    D  ++N+CI +  Q    + E +
Sbjct: 758 --LITNNIN-NLQVANNRLRSYLLPKGKSFRYETALKDSQNVNSCIQHVTQLDVYSEE-L 813

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           + L+ L   ++       LR ++Q+GYVVF    +   T  + I I S       E +  
Sbjct: 814 SALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQS-------EHTTP 866

Query: 955 EYMWRLEN--DTIGSL 968
              WR+ N  +T G +
Sbjct: 867 YLEWRINNFYETFGQI 882

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  146 bits (368), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 126/244 (51%), Gaps = 7/244 (2%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  ++I DP  + A+ SL V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 74  YRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLF-MGSEKFP 132

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T ++FE+      +  +    LD FS  F  PLF +
Sbjct: 133 DENEYSSYLSKHGGSSNAYTASQNTNYFFEV------NHQHLFGALDRFSGFFSCPLFNK 186

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A+ SE+  N  N    +Y   + L N+KHP+ +FSTGNI             
Sbjct: 187 DSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPKENGLN 246

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  + K  Y+A+ M LCI G + ++ L+ +    F  + ++ R    + + +  P 
Sbjct: 247 VRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKDVANNGREVPLYAEPIMQPE 306

Query: 264 YMHQ 267
           ++ +
Sbjct: 307 HLQK 310

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 86/196 (43%), Gaps = 17/196 (8%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W+  ++    E+       NF    ++   Y ++ I G   +E A+++  LI  
Sbjct: 699 IINERSWSTAEKLQVFEKLTFEQLINFIPTIYEGV-YFETLIHGNIKHEEALEVDSLIKS 757

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             ++ + I  N    NN L +  L  G+   ++    D  ++N+CI +  Q  +  +E +
Sbjct: 758 --LIPNNIH-NLQVSNNRLRSYLLPKGKTFRYETALKDSQNVNSCIQHVTQL-DVYSEDL 813

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           + L+ L   ++       LR ++Q+GYVVF    +   T  + I I S       E +  
Sbjct: 814 SALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQS-------EHTTP 866

Query: 955 EYMWRLEN--DTIGSL 968
              WR+ N  +T G +
Sbjct: 867 YLEWRINNFYETFGQV 882

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  145 bits (367), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 126/247 (51%), Gaps = 23/247 (9%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  ++ISDP+ + A+ SL V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 52  YRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLF-MGSEKFP 110

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL---LDIFSSSFKDPL 140
           D N Y   +S+  G  NAYT  + T ++FEI         N+E L   LD FS  F  PL
Sbjct: 111 DENDYSSFLSKHGGHSNAYTGSQNTNYFFEI---------NYEHLKGALDRFSGFFSCPL 161

Query: 141 FKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXX 200
           F   S +KEI A++SE+  N  +    +Y   + L+   HP+ +FSTGN+          
Sbjct: 162 FNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESK 221

Query: 201 XXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI----------DDSIR 250
                     ++  NY+A+ M LCI G + ++ L+ Y  ++F  +          D  I 
Sbjct: 222 NVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVKNIDKELPFYDSKIL 281

Query: 251 NDNTFIK 257
           ND+   K
Sbjct: 282 NDDQLTK 288

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 2/102 (1%)

Query: 872 DEGDINNCINYFIQTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLT 931
           D  ++N+CI + IQ    + E ++ +  L   ++       LR ++Q+GYVVF    +  
Sbjct: 775 DRKNVNSCIQHVIQVDIYSEE-LSAICGLFAQMLHEPCFDTLRTKEQLGYVVFSSTLNNH 833

Query: 932 NTIGLHITIMSLADPEDLERSIDEYMWRLENDTIGSLNESTF 973
            T  + I + S      LE  IDE+  +   D +  +++  F
Sbjct: 834 GTANIRILVQSEKSTPYLEWRIDEFYKKF-GDLLNGMSDEDF 874

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 116/222 (52%), Gaps = 7/222 (3%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++ISDP  + A+ S+ V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 93  YRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLF-MGSEKFP 151

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  G  NAYT    T ++FE+      +  +    LD FS  F  PL   
Sbjct: 152 DQNEYSSYLSKHGGHSNAYTAALNTNYFFEV------NHEHLHGALDRFSGFFTGPLMNA 205

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S  KEI A++SE+  N  N     Y   + ++N  HP+ +FSTGNI             
Sbjct: 206 DSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKLGLN 265

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
                  ++ ++Y+A+ M LCI G Q ++ L+ +A  +F  +
Sbjct: 266 TRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDV 307

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 120/269 (44%), Gaps = 18/269 (6%)

Query: 711 LMITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRKYEDAASGNSVKL 770
           L ITISGF   ++ LL              P+     + + + +   K     S   V  
Sbjct: 657 LDITISGFNDKLLVLLSRFIEGVKLYQ---PSEERFNIFKNKAIQNLK----NSLFEVPY 709

Query: 771 ASVGLL--IMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELA 826
           + +G L   ++ +  W ++++ D LE    + F +F    +    Y  + + G    E A
Sbjct: 710 SQMGTLYNTIMNESTWPIKEKLDVLEALTFDQFVSFVPSIYNEF-YFDALVHGNIRYEEA 768

Query: 827 MKLSHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQ-HPGDEGDINNCINYFIQ 885
           M+ + L+     L+    LN   +N+ L +  L  GE+  ++    D+ ++N+CI + +Q
Sbjct: 769 MEANDLLKS---LASFKILNLHVRNSRLRSYILPEGESYRYEIDMEDKDNLNSCIQHVVQ 825

Query: 886 TGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLAD 945
            G    E ++ L+ L   +++      LR ++Q+GYVVF    +   T  + I + S   
Sbjct: 826 LGLYTEE-LSALSGLFAQMIREPCFDTLRTKEQLGYVVFSSNLNNHGTANMRILVQSEHS 884

Query: 946 PEDLERSIDEYMWRLENDTIGSLNESTFK 974
              LE  IDE+  +   +++ +++E  F+
Sbjct: 885 TSYLEWRIDEFYKKF-GESLNNMSEEDFE 912

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  144 bits (362), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 101/392 (25%), Positives = 172/392 (43%), Gaps = 60/392 (15%)

Query: 23  DYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKY 82
           +Y+   LPN +  ++I DP+ + A+ +L V  GS  DP  +PGLAH CEH++   GS K+
Sbjct: 57  NYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFCEHLLF-MGSSKF 115

Query: 83  PDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFK 142
           P+ N Y   +S+  G  NAYT+   T ++F++      ++ +    L  FS  F  PLF 
Sbjct: 116 PNENEYSSYLSKHGGGSNAYTSARNTNYFFQV------NQESLHGALLRFSGFFSCPLFN 169

Query: 143 ETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXX 202
           + S +KEI A++SE+  N  +    LY   +  +N +HPF +FSTGN+            
Sbjct: 170 KESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNLKTLGDIPKSKDV 229

Query: 203 XXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSP 262
                   ++ ++Y+A+ M LC+ G + ++ ++++    F  + +S R   T+   +  P
Sbjct: 230 DIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDVPNSDRPVPTYEAKMLPP 289

Query: 263 VYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAYNPKYKDIKCFKRNPNHNAIFIK 322
            Y+ Q                                                 NA  +K
Sbjct: 290 QYLTQII-----------------------------------------------NAKPVK 302

Query: 323 STKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDENDNSLCYFLKKDNLITDCFAF 382
             K+  +  + P D+D+ + +K            L G E   SL  +LK      +  A 
Sbjct: 303 DLKKVEITFVAP-DVDEQWDSKPG-----HYLSHLIGHEGSGSLLAYLKLKGWANELSAG 356

Query: 383 HSNFALNSVGLVVELSLTGTGVKNQELIINSI 414
               + ++    V++ LT  GVKN E +I S+
Sbjct: 357 SHTVSEDNAFFSVDIDLTDEGVKNYESVIQSV 388

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 86/186 (46%), Gaps = 8/186 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--TNELAMKLSHLIYD 835
           ++ +  WT+ ++ + +++        F    F+   + +  + G  + E A++  +L+  
Sbjct: 683 VINERAWTIANKLEVVKQLKFEHLKLFIPAIFEQFSF-EILVHGNFSCEAALEADNLVR- 740

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGEN-VYFQHPGDEGDINNCINYFIQTGERNNEYI 894
              L+     N+  K++   +  L  G+   Y Q   D+ +IN+CI +  Q G  + E +
Sbjct: 741 --ALAPRDVQNFQLKSSKPRSVLLPQGKTFCYQQMLADDKNINSCIQHVTQFGSYSEE-L 797

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +   SL   ++       LR ++Q+GYVVF    +   T+ L + I S  D   LE  ID
Sbjct: 798 SAKASLFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRID 857

Query: 955 EYMWRL 960
            ++ ++
Sbjct: 858 AFLVKM 863

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 123/227 (54%), Gaps = 7/227 (3%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++I D + + A+ +L V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 63  YRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHFCEHLLF-MGSEKFP 121

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T ++FE+      +  +    LD FS  F  PLF +
Sbjct: 122 DENEYSSYLSKHGGSSNAYTGSQNTNYFFEV------NADHLHGALDRFSGFFSCPLFNQ 175

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A++SE+  N  N    +Y   + L+N  HP+ +FSTGN+             
Sbjct: 176 NSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNLETLGDKPKAAGLD 235

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIR 250
                  ++  NY+A+ M LCI G + ++ L+++A   F  + +S R
Sbjct: 236 IREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVKNSDR 282

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 88/198 (44%), Gaps = 6/198 (3%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNEL--AMKLSHLIYD 835
           ++ +  W  +++ +  E+       NF    +    Y +SF+ G  E   A ++  L+  
Sbjct: 689 VVNERTWPTKEKLEVAEKLKFEQLDNFVRAIY-DGMYYESFVHGNLESKEAREVDSLV-S 746

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIA 895
            ++  D I     + N + S    K     Y     DE ++N+CI + +Q  +  NE ++
Sbjct: 747 TFLKKDDIKNIDVQSNRLRSYIIPKGKSYAYETDLYDENNVNSCIQHVVQL-DVYNEKLS 805

Query: 896 TLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDE 955
            L+ L   ++       LR ++Q+GYVVF    +   T  + I + S      LE  IDE
Sbjct: 806 ALSGLFAQMLHEPCFDILRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDE 865

Query: 956 YMWRLENDTIGSLNESTF 973
           + ++   + + +++E  F
Sbjct: 866 F-YKTFGEKLRNMDEEDF 882

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 122/244 (50%), Gaps = 7/244 (2%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  ++I DP  + A+ SL V  G+  DP  +PGLAH CEH++   GS+K+P
Sbjct: 74  YRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGLAHFCEHLLF-MGSEKFP 132

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T ++FEI      +  +    LD F+  F  PLF +
Sbjct: 133 DENEYSSYLSKHGGSSNAYTASQNTNYFFEI------NHQHLFGALDRFAGFFSCPLFNK 186

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A+ SE+  N  N    +Y   + L N  HP+ +FSTGNI             
Sbjct: 187 DSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFSTGNIETLGTLPKENGQN 246

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  +    Y+A+ M LCI G + ++ L+ +    F  I ++ R    + + +    
Sbjct: 247 VRDELLQFHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDISNNDREVPHYAEPIMQSE 306

Query: 264 YMHQ 267
           Y+ +
Sbjct: 307 YLQK 310

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 84/189 (44%), Gaps = 17/189 (8%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NELAMKLSHLIYD 835
           ++ +  W+  ++    E+       NF    ++ A + ++ I G    E AM++  LI  
Sbjct: 699 LINERSWSTAEKLQVFEKLSYEQLINFIPTIYEGA-FFETLIHGNIKREEAMEVDSLIKS 757

Query: 836 HWILSDTISLNYFE-KNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEY 893
                 T+++N  +  NN L +  L  G++  ++    D  ++N+CI +  Q  +  +E 
Sbjct: 758 MI----TVNINNLQVSNNRLRSYLLPKGKSFRYETALKDSLNVNSCIQHVTQL-DVYSEE 812

Query: 894 IATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSI 953
           ++ L+ L   ++       LR ++Q+GYVVF    +   T  + I I S       E + 
Sbjct: 813 LSALSGLFTQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQS-------EHTT 865

Query: 954 DEYMWRLEN 962
               WR+ N
Sbjct: 866 PYLEWRITN 874

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  141 bits (355), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 107/391 (27%), Positives = 168/391 (42%), Gaps = 60/391 (15%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN +  +++ D + + ++ SL V  G+  DP  +PGLAH CEH++   GSKK+P
Sbjct: 69  YRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLF-MGSKKFP 127

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           + N Y   +S+  G+ NAYT  + T +YF +      +  N    LD FS  F  PLF E
Sbjct: 128 NENEYASFLSKHGGASNAYTASQNTNYYFHV------NHENLYDALDRFSGFFSCPLFNE 181

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
           +S  KEI A++SE+  N  N    LY   + L N  HP+ +FSTGN              
Sbjct: 182 SSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSKGVN 241

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  ++  +Y+A+ M L I G + ++ L ++A   F  + +            K P 
Sbjct: 242 VRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDVPN---------HGTKVPE 292

Query: 264 YMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAYNPKYKDIKCFKRNPNHNAIFIKS 323
           Y  Q F+   L                                +K  K  P      +K+
Sbjct: 293 YHAQAFTPEHL--------------------------------MKVIKVKP------VKN 314

Query: 324 TKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDENDNSLCYFLKKDNLITDCFAFH 383
            K   +  + P DMD  +  K    R++     L G E  +SL  +LK ++   D  A  
Sbjct: 315 LKSVEISFVVP-DMDKHWQVKP--ARYL---SHLIGHEGTDSLLAYLKNNSWAIDLSAGA 368

Query: 384 SNFALNSVGLVVELSLTGTGVKNQELIINSI 414
           +  +  +    V + LT  GV   E +I ++
Sbjct: 369 TTVSEGNAYFSVNVDLTDEGVVQYEAVICAV 399

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 86/180 (47%), Gaps = 8/180 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--TNELAMKLSHLIYD 835
           ++ +  WT +++ D  E+   +   NF    ++   Y +  + G  ++E A+++  L+  
Sbjct: 695 LINERSWTTQEKLDITEQLTFDHLANFVPTIYEQM-YFELLVHGNFSHEEALEVYDLVSS 753

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             ++ + I  N   +N+ L + F+  G   +++    D+ ++N+CI   IQ G  + E +
Sbjct: 754 --LVPNEIR-NSEGRNSKLRSYFIPAGGAYHYETALADKENVNSCIQKVIQLGAYS-ELL 809

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +   SL   ++     + LR  +Q+GYVVF    +   T+ L I + S      LE  ID
Sbjct: 810 SAKGSLLAQMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQSERSSSYLESRID 869

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  140 bits (354), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 124/241 (51%), Gaps = 11/241 (4%)

Query: 23  DYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKY 82
           +Y+  +LPN +  ++I DP+ + A+ +L +  G+  DP  IPGLAH CEH++   GS K+
Sbjct: 61  NYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLAHFCEHLLF-MGSSKF 119

Query: 83  PDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFK 142
           PD N Y   +S+  G+ NAYT  + T +YF++      +  +    LD FS  F  PLF 
Sbjct: 120 PDENEYSSFLSKHGGASNAYTGSQNTNYYFQV------NHEDLRGALDRFSGFFTSPLFN 173

Query: 143 ETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXX 202
           + S +KEI A++SE+  N  N    +Y   +   +  HP+ +FSTGN+            
Sbjct: 174 KNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFSTGNLKTLGETPKNQGL 233

Query: 203 XXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSP 262
                   ++   Y+A+ M LC+ G + ++ ++++    F      +RN+N  +     P
Sbjct: 234 DIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYELFK----DVRNNNCSVPEYSIP 289

Query: 263 V 263
           +
Sbjct: 290 L 290

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 87/188 (46%), Gaps = 8/188 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--TNELAMKLSHLIYD 835
           ++ +  W+ +++ D  ++       NF    ++   Y +  + G  + E A +++ L+  
Sbjct: 687 LINERSWSTKEKLDLTKQLTFEHLKNFIPTIYEQL-YYEILVHGNFSQEAATEINDLV-K 744

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             + +D  +L    KN  L +  +   +    + P  DE ++N+CI +  Q G  + E +
Sbjct: 745 MMVPNDIKNLQV--KNGKLRSYIIPQEKTFRMELPLADEKNVNSCIQHVTQFGIYS-EDL 801

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +  T+L   ++       LR ++Q+GYVVF    S   T+ L + I S  D   LE  ID
Sbjct: 802 SAKTALLAQLIDEPCFDTLRTKEQLGYVVFSSALSTHGTVNLRLLIQSERDSSYLESRID 861

Query: 955 EYMWRLEN 962
            ++ +  N
Sbjct: 862 SFLKKFGN 869

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  137 bits (345), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 120/223 (53%), Gaps = 7/223 (3%)

Query: 23  DYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKY 82
           +Y+   LPN +  ++I D + + A+ +L V  GS  DP  +PGLAH CEH++   GS KY
Sbjct: 57  EYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLAHFCEHLLF-MGSSKY 115

Query: 83  PDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFK 142
           P+ N Y   +S+  G  NAYT+ + T ++F++      ++ N    LD FS  F  PLF 
Sbjct: 116 PNENEYSSYLSKHGGGSNAYTSSQNTNYFFQV------NQGNLHGALDRFSGFFSCPLFN 169

Query: 143 ETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXX 202
           + S +KEI A++SE+  N  +    LY   +  ++ +HP+ +FSTGN+            
Sbjct: 170 KDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHPYHKFSTGNLKTLGELPKSQNL 229

Query: 203 XXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
                   ++  +Y+A+ M LC+ G + ++VL+++    F  +
Sbjct: 230 DVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDLFKDV 272

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 89/186 (47%), Gaps = 8/186 (4%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--TNELAMKLSHLIYD 835
           ++ +  WT++D+ + +E+       NF    F+   + ++ + G  + E A+++  L+  
Sbjct: 683 LINERSWTIKDKLEVVEQLTFQHLENFLPTIFEQF-FFEALVHGNFSYETAVEIHKLVK- 740

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYF-QHPGDEGDINNCINYFIQTGERNNEYI 894
              L+     N   K++   +  + PG   Y+ Q   DE +IN+CI +  Q G  + E +
Sbjct: 741 --ALAPNDIKNCLLKSSKPRSLHIPPGRAYYYEQRLADEKNINSCIQHVNQFGTYSEE-L 797

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           A   +L   ++       LR ++Q+GYVVF    +   T+ L I I S  D   LE  ID
Sbjct: 798 AAKAALFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLESRID 857

Query: 955 EYMWRL 960
            ++ ++
Sbjct: 858 AFLAKM 863

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  137 bits (344), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 125/244 (51%), Gaps = 11/244 (4%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+   LPN    ++I D S + ++ SL V  G+  DP  + GLAH CEH++   GSKK+P
Sbjct: 75  YRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHLLF-MGSKKFP 133

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           + N Y   +++  GS NAYT  + T ++FEI      +  +    LD FS  F  PLF  
Sbjct: 134 NENEYSSYLNKHGGSSNAYTGAQNTNYFFEI------NHEHLHGALDRFSGFFTCPLFNP 187

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A++SE+  N  N    +Y   + L+N KHP+ +FSTGN+             
Sbjct: 188 NSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTLDEMPKKEGLD 247

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPV 263
                  ++  +Y+A+ M LC+ G + ++ ++ +    F    +++ N+N  +     P+
Sbjct: 248 IRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLF----EAVPNNNRPLPEYNEPI 303

Query: 264 YMHQ 267
            + +
Sbjct: 304 LLEE 307

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 110/252 (43%), Gaps = 19/252 (7%)

Query: 711 LMITISGFQSGIMSLLQXXXXXXXXXXXXXPTVTHSALHRARVMTRRK---YEDAASGNS 767
           L ITISGF   ++ LLQ             P+     + + + +   K   YE   S  S
Sbjct: 638 LDITISGFNDKLIVLLQRFIYGVSVYQ---PSKLRFKIFKEKTIQNLKNCLYEVPYSQIS 694

Query: 768 VKLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--NEL 825
              +S     ++ +  W+++ +   +E+     F  F    ++   Y    + G   NE 
Sbjct: 695 TLYSS-----LINERTWSVKQKLSIIEKITYEQFLAFLPTIYEEC-YFDGLVHGNFRNEE 748

Query: 826 AMKLSHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQ-HPGDEGDINNCINYFI 884
           A+++  L+    I +D ++L+   KN  L +  +  GE   F+    D  ++N+C+ + +
Sbjct: 749 AVEIDSLV-QSLITTDIVNLHV--KNTRLRSYVIPNGETYRFEIDLEDAENVNSCVQHVV 805

Query: 885 QTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLA 944
           Q G  + E ++ ++ L   I+       LR ++Q+GYVVF    +   T  + I + S  
Sbjct: 806 QLGGYSEE-LSAMSGLFAQILNEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEH 864

Query: 945 DPEDLERSIDEY 956
               LE  IDE+
Sbjct: 865 STPYLEWRIDEF 876

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 121/230 (52%), Gaps = 13/230 (5%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++I D   + A+ +L V  G+  DP  +PGLAH CEH++   GS+KYP
Sbjct: 49  YRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEHLLF-MGSEKYP 107

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERL---LDIFSSSFKDPL 140
           D N Y   +S+  G+ NAYT  + T +YFE+         N E L   LD F+  F  PL
Sbjct: 108 DENEYSSYLSKHGGASNAYTGSQNTNYYFEV---------NHEHLFGALDRFAGFFTCPL 158

Query: 141 FKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXX 200
           F   S +KEI A++SE+  N  +    LY   + L N +HP+ +FSTGN           
Sbjct: 159 FNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIPTSN 218

Query: 201 XXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIR 250
                     ++K +Y+A+ M LC+ G + ++ L+ +A + F  + +  R
Sbjct: 219 GIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQDVPNIAR 268

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 86/188 (45%), Gaps = 15/188 (7%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTN--ELAMKLSHLIYD 835
           ++ +  W+++++ + L+         +    ++   + ++F+ G    E A+++  L+  
Sbjct: 674 LINERTWSVKEKLEVLKRLTFEQLVTYLPTIYEEM-FFEAFVHGNMKYEEAIEVDSLV-- 730

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHP-GDEGDINNCINYFIQTGERNNEYI 894
             ++ + I  N+  KN  L + FL  GE   ++    D  ++N+CI +  Q G  + E I
Sbjct: 731 QMLVPNDIR-NFQTKNGKLRSYFLPQGETYRYETKLQDSQNLNSCIQHVTQLGVYSEE-I 788

Query: 895 ATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSID 954
           +   SL   ++       LR ++Q+GYVVF    +   T  + I + S       E +  
Sbjct: 789 SAKASLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQS-------EHTTP 841

Query: 955 EYMWRLEN 962
              WR+E+
Sbjct: 842 FLEWRIES 849

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  134 bits (336), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 116/222 (52%), Gaps = 7/222 (3%)

Query: 24  YKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYP 83
           Y+  +LPN +  ++ISD   + A+ +L V  GS  DP  +PGLAH CEH++   G++KYP
Sbjct: 62  YRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLF-MGNEKYP 120

Query: 84  DPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
           D N Y   +S+  GS NAYT  + T +YF +      +  N    LD FS  F  PLF +
Sbjct: 121 DENDYSSFLSKHGGSSNAYTGSQNTNYYFHL------NHENLYPALDRFSGFFSCPLFNK 174

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            S +KEI A++SE+  N  N    +Y   + L N +HP+ +FSTGNI             
Sbjct: 175 ASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLKGID 234

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
                  + K NY+A+ M LC+ G + ++ L  +    F  +
Sbjct: 235 IRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV 276

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 88/184 (47%), Gaps = 10/184 (5%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG--TNELAMKLSHLIYD 835
           ++ +  WT + + D  ++       +F    ++   + +S + G  + E+A +++ L+  
Sbjct: 687 LVNERSWTTKAKLDVTKDLTFEHLKSFVPTIYEQL-FHESLVLGNFSVEMAYEINQLV-- 743

Query: 836 HWILSDTISLNYFEKNNILSTCFLKPGENV--YFQHPGDEGDINNCINYFIQTGERNNEY 893
             ++ D I  N   KNN L +  L P E+   Y     D+ ++N+CI Y IQ G  + E 
Sbjct: 744 DILVVDRIP-NLEVKNNKLRSYIL-PEESAFRYEYMLEDKANVNSCIQYLIQLGAYSEE- 800

Query: 894 IATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSI 953
           +A   SL   ++       LR ++Q+GY+VF  + +   T  L + + S  D   +E  I
Sbjct: 801 LAAKASLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSAYVESRI 860

Query: 954 DEYM 957
            +++
Sbjct: 861 VKFL 864

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  133 bits (335), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 121/243 (49%), Gaps = 7/243 (2%)

Query: 23  DYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKY 82
           +Y+  +LPN +   +I D S + A+ +L V  G   DP  +PGLAH CEH++   GS+K+
Sbjct: 79  NYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLF-MGSEKF 137

Query: 83  PDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFK 142
           P+ N Y   +S   G+ NAYT+ + T +YF +      +  N    LD FS  F  PLF 
Sbjct: 138 PNENEYSSYLSHHGGASNAYTSTQNTNYYFMV------NHGNLYDALDRFSGFFTSPLFS 191

Query: 143 ETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXX 202
            +S NKE+ A++SE+  N  +    +    R L N  HPF +FSTGN             
Sbjct: 192 VSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSRGI 251

Query: 203 XXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSP 262
                   ++   Y+A+ M L I G + ++ L+ +A   F  + D   + + +   + +P
Sbjct: 252 EIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVPDKGIDVHEYNAKVFTP 311

Query: 263 VYM 265
            Y+
Sbjct: 312 TYL 314

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 2/103 (1%)

Query: 872 DEGDINNCINYFIQTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLT 931
           DE ++N+C    IQ G  + +  A   SL   ++     + LR  +Q+GYVV+   ++  
Sbjct: 798 DEENVNSCFEMVIQLGMYSEDMNAK-GSLLAQLINEPCFNTLRTEEQLGYVVWSSKQNTH 856

Query: 932 NTIGLHITIMSLADPEDLERSIDEYMWRLENDTIGSLNESTFK 974
            +  L I + S +D   +E  +D+++     DT+ S++E  F+
Sbjct: 857 ASTNLRILVQSESDTVYIESRVDKFLNNFA-DTLRSMSEQAFE 898

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  129 bits (324), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 126/243 (51%), Gaps = 12/243 (4%)

Query: 23  DYKLCRL-PNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKK 81
           +Y+  +L  N +  ++I D + + A+ +L V  G+  DPS +PGLAH CEH++   GSK 
Sbjct: 40  NYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHLLF-MGSKN 98

Query: 82  YPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLF 141
           +P+ N Y   ++++ G  NAYT    T ++FEI      + +N    L  FS  FK PLF
Sbjct: 99  FPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEI------NHANLFEALRRFSCFFKTPLF 152

Query: 142 KETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXX 201
              S  KEI+AI+SE+  N  N    LY   + L+N +HP+ +FSTG+            
Sbjct: 153 NNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLLENTETLN 212

Query: 202 XXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKS 261
                    ++   Y+++ M LCI G + +  L+++A   F    +++ N N  + +   
Sbjct: 213 LNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILF----ENVPNKNVILPTFSQ 268

Query: 262 PVY 264
           PV+
Sbjct: 269 PVW 271

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 88/187 (47%), Gaps = 13/187 (6%)

Query: 778 MLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKY-IKSFISGTNELAMKLSHLIYDH 836
           ++ +  W++E+    +++ D     +F    ++   +   +F +   E A ++  L+   
Sbjct: 669 LINERSWSVEENLKVVQDIDFPQLQDFIPTIYQELFFETLAFGNIQYEQAQEVDSLV--R 726

Query: 837 WILSDTISLNYFEKNNILSTCFLKPGENVYFQ-HPGDEGDINNCINYFIQTGERNNEYIA 895
            ++ +TI  N   KN+ L +  +  G+   ++    D+ ++N CI Y  Q G  + EY+A
Sbjct: 727 TLIPNTIK-NSQVKNDRLRSYIIPSGKTFKYEVFQKDKNNLNTCIQYICQFGIYS-EYLA 784

Query: 896 TLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDE 955
            + SL   IM     + LR ++Q+GY+VF    S   T  L I + S       E S D 
Sbjct: 785 AVVSLLAQIMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCNLSIMVQS-------EYSTDY 837

Query: 956 YMWRLEN 962
             +R+EN
Sbjct: 838 LQFRIEN 844

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 86/225 (38%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           ++ +LPNG+     + P+   AS  + V  GS  +     G AH  EH+    G+K    
Sbjct: 30  RISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFK-GTKNRTQ 88

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      S + +  R LD+ S      +   
Sbjct: 89  VGI--ELEIENLGSHLNAYTSRENTVYYAK------SLQEDIPRALDVLSDILTRSVLDP 140

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            +V +E   I  E +       ++++     ++    P  R   G I             
Sbjct: 141 KAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGRTILGPI-------ENIKSI 193

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                + Y  TNY    M L   G    + L +Y   YF  I  S
Sbjct: 194 QQRDLKEYISTNYKGDRMALVGAGAVDHDELVRYGEKYFGHIPKS 238

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 18/234 (7%)

Query: 26  LCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDP 85
           + RL NG+       P+   A+  + V  GS  + +   G AH  EH+      K+    
Sbjct: 13  ISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKR---S 69

Query: 86  NSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKET 144
               +L  E+ GSH NAYT+ E T +Y +      + + N  + +DI S         ++
Sbjct: 70  QKKIELDIENIGSHLNAYTSRENTVYYAK------TLKENVPQAIDILSDILTKSTLDKS 123

Query: 145 SVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXX 204
           ++ +E   I  E +       ++++     +A S     R   G I              
Sbjct: 124 AIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPI-------KNIKSIT 176

Query: 205 XXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS-IRNDNTFIK 257
               ++Y   NY    M L   G    N + KYA  YF  +  S ++N +T +K
Sbjct: 177 RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNIDTGLK 230

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 92/234 (39%), Gaps = 18/234 (7%)

Query: 26  LCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDP 85
           + RL NG+       P+   A+  + V  GS  + +   G AH  EH+      K+    
Sbjct: 23  ISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKR---S 79

Query: 86  NSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKET 144
               +L  E+ GSH NAYT+ E T +Y +      + + N  + +DI S         ++
Sbjct: 80  QKKIELDIENIGSHLNAYTSRENTVYYAK------TLKENVPQAIDILSDILTKSTLDKS 133

Query: 145 SVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXX 204
           ++ +E   I  E +       ++++     +A S     R   G I              
Sbjct: 134 AIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPI-------KNIKSIT 186

Query: 205 XXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS-IRNDNTFIK 257
               ++Y   NY    M L   G    N + KYA  YF  +  S ++N +T +K
Sbjct: 187 RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNIDTGLK 240

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 81/221 (36%), Gaps = 17/221 (7%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+     + P+   A+  + V  GS  + S   G AH  EH+    G+K        
Sbjct: 27  LPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAFK-GTKNRTQVGIE 85

Query: 89  HKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
            ++  E+ GSH NAYT+ E T +Y +      +   N    +DI S      +    ++ 
Sbjct: 86  MEI--ENIGSHLNAYTSRENTVYYAK------TLTQNIPNAVDILSDILTKSVLDTNAIE 137

Query: 148 KEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXXXXX 207
           +E   I  E +       ++++     +     P  R   G I                 
Sbjct: 138 RERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPI-------KNIKTIQQRD 190

Query: 208 XESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
              Y  TNY    M L   G    + L +YA  YF  I  S
Sbjct: 191 LREYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFGHIPKS 231

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 83/225 (36%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           K   L NG+       P+   AS  + V  GS  + S   G AH  EH+     + +   
Sbjct: 61  KTTVLSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTR--- 117

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L+ E+ GSH NAYT+ E T +Y +      + + N    +DI S         +
Sbjct: 118 SQRDIELVIENLGSHLNAYTSRENTVYYAK------TLKDNIPNAIDILSDILTKSTLDK 171

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            ++ +E   I  E +       ++++     +     P  R   G I             
Sbjct: 172 NAIERERSVIIRESEEVDQMYDEVVFDHLHEIVYKDQPLGRTILGPIKNINTIQRNDL-- 229

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                ++Y  TNY    M L   G  +   L KYA  YF  +  S
Sbjct: 230 -----QNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVKKS 269

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 89/241 (36%), Gaps = 19/241 (7%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+       P++  A+  + V  GS  +     G AH  EH+       +     + 
Sbjct: 33  LPNGLTVASEFIPNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFKGTQNRS---QTD 89

Query: 89  HKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
            +L  E+ GSH NAYT+ E T +Y +      S E +  + ++I S      +    ++ 
Sbjct: 90  IELEIENIGSHLNAYTSRENTVYYAK------SLEGDVPKAVNILSDILTRSVLDPKAIE 143

Query: 148 KEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXXXXX 207
           +E   I  E +       ++++     +A  + P  R   G I                 
Sbjct: 144 RERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLGRTILGPI-------KNIKSISRKD 196

Query: 208 XESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPVYMHQ 267
            +SY   NY    M L   G      L  YA  Y   I  S       + S + P+ + Q
Sbjct: 197 LKSYITENYKGDRMVLAAAGAVDHEKLVDYAQKYLGHIPKS--ESPMPLGSPRGPLPVFQ 254

Query: 268 R 268
           R
Sbjct: 255 R 255

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 88/233 (37%), Gaps = 17/233 (7%)

Query: 17  ASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILS 76
           ASS     ++  L NG+       P+   A+  + V  GS  + +   G AH  EH+   
Sbjct: 18  ASSTIPKTQISVLANGLTVASERIPNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAFK 77

Query: 77  AGSKKYPDPNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSS 135
               +     +  +L  E+ GSH NAYT+ E T +Y +      S E++  + +DI S  
Sbjct: 78  GTQNRT---QTGIELEIENIGSHLNAYTSRENTVYYAK------SLENDIPQAVDILSDI 128

Query: 136 FKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXX 195
               +    ++ +E   I  E +       ++++     +     P  R   G I     
Sbjct: 129 LTRSVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLGRTILGPIKNIKT 188

Query: 196 XXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                        ++Y   NY+   M L   G    + L  YA TYF  I  S
Sbjct: 189 IQRDDL-------QAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFGHIRKS 234

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 84/233 (36%), Gaps = 17/233 (7%)

Query: 17  ASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILS 76
           ASS+    +  +LPNG+       P+   A+  + V  GS  +     G AH  EH+   
Sbjct: 19  ASSQIPGTRTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFK 78

Query: 77  AGSKKYPDPNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSS 135
               +        +L  E+ GSH NAYT+ E T +Y +      S E +  + +DI S  
Sbjct: 79  GTQNR---SQQGIELEIENIGSHLNAYTSRENTVYYAK------SLEEDIPKAVDILSDI 129

Query: 136 FKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXX 195
               +    ++ +E   I  E +       ++++     +     P  R   G I     
Sbjct: 130 LTKSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI----- 184

Query: 196 XXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                        + Y   NY    M L   G      L +YA  YF  +  S
Sbjct: 185 --KNIKSITRSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFGHVPRS 235

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EHM L  GS KYP  + + K+++ S  +     TG   TFY       
Sbjct: 75  NPPNATGVPHILEHMTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY----PFA 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESE 156
           T+++++FE L D++  +  +PL K     +E + +E E
Sbjct: 130 TTNKADFENLRDVYLDATFNPLLKPEDFYQEGWRLEHE 167

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 81/225 (36%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           +  +LPNG+       P+   A+  + V  GS  +     G AH  EH+       +   
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNR--- 83

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      S + +  + +DI S      +   
Sbjct: 84  SQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQEDIPKAVDILSDILTKSVLDN 137

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
           +++ +E   I  E +       ++++     +     P  R   G I             
Sbjct: 138 SAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI-------KNIKSI 190

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                + Y   NY    M L   G      L +YA  YF  +  S
Sbjct: 191 TRTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKS 235

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 84/221 (38%), Gaps = 17/221 (7%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+     S P+   A+  + V TGS  +     G AH  EH+       +     + 
Sbjct: 38  LPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAFKGTQNR---SQTG 94

Query: 89  HKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
            +L  E+ GSH NAYT+ E T +Y +   L        + L DI + S  DP  K     
Sbjct: 95  IELEIENIGSHLNAYTSRENTVYYAK--SLKQDIPKAVDILADILTRSVLDP--KAIERE 150

Query: 148 KEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXXXXX 207
           +++   ESE      +  ++++     +     P  R   G I                 
Sbjct: 151 RDVIIRESEEVDKMYD--EVVFDHLHTITYKNQPLGRTILGPI-------KNIKSIQRSD 201

Query: 208 XESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
            + + + +Y    M L   G    + L +YA  YF  +  S
Sbjct: 202 LQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFGHVRKS 242

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 82/225 (36%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+       P+   A+  + V  GS  +     G AH  EH+       +   
Sbjct: 26  RTSTLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTENR--- 82

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +   L        E L DI + S  DP   E
Sbjct: 83  SQRAIELEIENIGSHLNAYTSRENTVYYAK--SLQNDIPKAVEILSDILTKSTLDPRAIE 140

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
               +++   ESE      +  ++++     +A    P  R   G I             
Sbjct: 141 RE--RDVIIRESEEVDKMYD--EVVFDHLHDIAYKDQPLGRTILGPI-------KNIKSI 189

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                +SY   NY    M L   G    + L  YA  YF  +  S
Sbjct: 190 SRTDLKSYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFGHLQKS 234

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 82/219 (37%), Gaps = 17/219 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           ++ +L NG+       P+   A+  + V  GS  +     G AH  EH+     SK+   
Sbjct: 28  EISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKR--- 84

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      + + N    +DI S    +   ++
Sbjct: 85  SQKQIELDIENIGSHLNAYTSRENTVYYAK------TLKENLPLAVDILSDILTNSKLEK 138

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            ++ +E   I  E +       ++++     +A    P  R   G I             
Sbjct: 139 NAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLGRTILGPIKNIKSINRSDLVH 198

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYF 242
                  Y  +NY    M L   G  +   L K A  YF
Sbjct: 199 -------YITSNYKGDRMVLAGAGDINHQDLIKLAEKYF 230

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 81/228 (35%), Gaps = 29/228 (12%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+       P+   A+  + V  GS  +     G AH  EH+            N  
Sbjct: 30  LPNGLTVATELIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQ------NRS 83

Query: 89  HKLIS---ESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKET 144
            K I    E+ GSH NAYT+ E T +Y +   L        + L DI + S  DP   E 
Sbjct: 84  QKGIELEIENIGSHLNAYTSRENTVYYAK--SLKEDIPKAVDILSDILTKSVLDPRAIER 141

Query: 145 S---VNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXX 201
               + +E   ++  HD       ++++     +     P  R   G I           
Sbjct: 142 ERDVIIRESEEVDKMHD-------EVVFDHLHAITYKDQPLGRTILGPI-------KNIK 187

Query: 202 XXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDSI 249
                    Y   NY    M L   G  + + L +YA  YF  +  S+
Sbjct: 188 SITRNDLREYITKNYKGDRMVLAGAGAVNHDELVEYAQKYFGHLGKSV 235

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GSKKYP  + + K++++S  +     TG   TF+       
Sbjct: 75  NPPNSTGVPHVLEHTTL-CGSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFF----PFA 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHA 171
           T++  +F  L D++  +  +PL K+    +E + +  EHD  T   T I++  
Sbjct: 130 TTNAKDFNNLRDVYLDATLNPLLKQEDFYQEGWRL--EHDTVTDVTTPIVFKG 180

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 80/225 (35%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           +  RLPNG+       P+   A+  + V  GS  +     G AH  EH+       +   
Sbjct: 27  RTSRLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNR--- 83

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      S + +  + + I S      +   
Sbjct: 84  SQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQEDIPKAVGILSDILTKSVLDN 137

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            ++ +E   I  E +       ++++     +     P  R   G I             
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI-------KNIKSI 190

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                ++Y   NY    M L   G      L +YA  YF  +  S
Sbjct: 191 TRSDLKNYITRNYKGDRMVLAGAGAVDHEELVEYAQKYFGHVPKS 235

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 54  TGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFE 113
            G   +P    G+AH+ EH  L  GSKKYP  + + K+++ S  +     TG   T Y  
Sbjct: 71  VGFKTNPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMY-- 127

Query: 114 IPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESE 156
                T++  +F+ L D++  +   PL K+    +E + +E++
Sbjct: 128 --PFATTNSKDFKNLQDVYLDATFSPLLKQEDFFQEGWRLENK 168

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 80/219 (36%), Gaps = 23/219 (10%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           L NG+       P+   A+  + V  GS  +     G AH  EH+    G+K     N  
Sbjct: 34  LDNGLTVATEFIPNTASATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTK-----NRS 87

Query: 89  HKLIS---ESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKET 144
            + I    E+ GSH NAYT+ E T +Y +      S   +  + +DI S      +    
Sbjct: 88  QRGIELEIENIGSHLNAYTSRENTVYYAK------SLREDIPKAVDILSDILTKSVLDPK 141

Query: 145 SVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXX 204
           ++ +E   I  E +       ++++     +A    P  R   G I              
Sbjct: 142 AIERERDVIIRESEEVDKMYDEVVFDHLHEIAYRDQPLGRTILGPIKNIKSIKRTDL--- 198

Query: 205 XXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFN 243
               ++Y  TNY    M L   G    + L  YA  YF 
Sbjct: 199 ----QNYIMTNYKGDRMVLASAGSVDHDNLVAYAQKYFG 233

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 11/128 (8%)

Query: 30  PNGILTMV-ISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           P   L +V I+  +  +     +VAT   ND     G+ H  EH+I   GSKKYP     
Sbjct: 25  PRTKLQLVHINHKASPLVEGYFAVATECPNDS----GVPHTLEHLIF-MGSKKYPYKGLL 79

Query: 89  HKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNK 148
             L +    S NA+T  +QT +      L ++    F++LL ++     +P   + +   
Sbjct: 80  DTLGNLCMSSTNAWTATDQTVY-----TLTSAGWQGFKKLLPVYLDHLLNPTLTDEACVT 134

Query: 149 EIYAIESE 156
           E+Y I+ +
Sbjct: 135 EVYHIDPQ 142

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 53  ATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYF 112
           + G   +P    G+ H+ EH  L  GS KYP  + + K+++ S  +     TG   TFY 
Sbjct: 69  SIGFKTNPPDSTGVPHILEHTTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY- 126

Query: 113 EIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
                 T++E++F  L D++  +  +PL  +    +E + +E
Sbjct: 127 ---PFATTNETDFANLRDVYLDATLNPLLNQQDFLQEGWRLE 165

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 5/96 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS+KYP  + + K+++ S  +     TG   TFY       
Sbjct: 75  NPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY----PFA 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           T+++++F  L D++  +  +PL K     +E + +E
Sbjct: 130 TANKADFANLRDVYIDATFNPLLKHEDFLQEGWRLE 165

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 80/225 (35%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           ++ +L NGI       P+   A+  + V  GS  + S   G AH  EH+     + +   
Sbjct: 26  QISQLSNGITVASEVLPNTSTATVGIFVDAGSRAENSRNNGTAHFLEHLAFKGTTNR--- 82

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      S + +  + +DI S          
Sbjct: 83  SQVGIELEIENIGSHLNAYTSRENTVYYAK------SLKEDIPKAMDILSDILTRSTLNP 136

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            ++ +E   I  E +       ++++     +        R   G I             
Sbjct: 137 KAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALGRTILGPIENIKSIQRKDLA- 195

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                  Y  TNY    M L   G    + L +Y   YF  I  S
Sbjct: 196 ------EYISTNYTGDRMALVGAGSVDHDKLVEYGERYFGHIRKS 234

>KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 990

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS+KYP  + + K+++ S  +     TG   TFY       
Sbjct: 75  NPPDASGVPHILEHTTL-CGSEKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY----PFA 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           T+++++F  L D++  +   PL K     +E + +E
Sbjct: 130 TANKADFANLRDVYLDATFKPLLKHEDFLQEGWRLE 165

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 82/234 (35%), Gaps = 17/234 (7%)

Query: 16  PASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMIL 75
           P ++     +   L NG+       P+   A+  + V  GS  + +   G AH  EH+  
Sbjct: 14  PLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAHFLEHLAF 73

Query: 76  SAGSKKYPDPNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSS 134
             G+K         +L  E+ GSH NAYT+ E T +Y +      +   N    +D+ S 
Sbjct: 74  K-GTKNRTQVGI--ELEIENIGSHLNAYTSRENTVYYAK------TLTQNIPNAVDVLSD 124

Query: 135 SFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXX 194
                +    ++ +E   I  E +       ++++     +     P  R   G I    
Sbjct: 125 ILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPI---- 180

Query: 195 XXXXXXXXXXXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                         + Y   NY    M L   G      L +YA  YF  I  S
Sbjct: 181 ---ENIKTIQRRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKYFGHIPKS 231

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS KYP  + + K++++S  +     TG   TF+       
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF----PFS 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESE 156
           T++  +F  L  ++  S  +PL K+   ++E + +E E
Sbjct: 130 TTNPQDFANLRGVYLDSTLNPLLKQEDFDQEGWRLEHE 167

>CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 Saccharomyces cerevisiae
           YDR430c
          Length = 990

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 60  PSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFT 119
           P    G+ H+ EH  L  GS+KYP  + + K++++S  +     TG   TF+       T
Sbjct: 76  PPDATGVPHILEHTTL-CGSEKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF----PFAT 130

Query: 120 SSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           ++  +F  L D++ +S   PL KE    +E + +E
Sbjct: 131 TNARDFVNLRDVYLNSTLRPLLKEQDFYQEGWRLE 165

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 7/97 (7%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISES-NGSHNAYTTGEQTTFYFEIPCL 117
           +P    G+ H+ EH  L  GS+KYP  + + K+++ S +   NA T  + T F F     
Sbjct: 75  NPPDCTGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLSNFMNAMTAHDYTFFPFS---- 129

Query: 118 FTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
            T++E++F+ L D++  +  +PL K     +E + +E
Sbjct: 130 -TTNETDFKNLRDVYIDATLNPLLKIEDFFQEGWRLE 165

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 17/225 (7%)

Query: 25  KLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPD 84
           +  +LPNG+       P+   A+  + V  GS  +     G AH  EH+       +   
Sbjct: 27  RTSKLPNGLTIASEYIPNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAFKGTQNR--- 83

Query: 85  PNSYHKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKE 143
                +L  E+ GSH NAYT+ E T +Y +      S + +  + ++I S      +   
Sbjct: 84  SQQGIELEIENIGSHLNAYTSRENTVYYAK------SLQEDIPKAVEILSDILTKSVLDS 137

Query: 144 TSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXX 203
            ++ +E   I  E +       ++++     +     P  R   G I             
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI-------KNIKSI 190

Query: 204 XXXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                ++Y   NY    M L   G      L ++A  YF  +  S
Sbjct: 191 TRSDLKNYITKNYKGDRMVLAGAGAVDHEKLVEHAQKYFGHVPKS 235

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 79/224 (35%), Gaps = 23/224 (10%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+       P+   A+  + V  GS  +     G AH  EH+    G+K     N  
Sbjct: 32  LPNGLTVATEWMPNTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAFK-GTK-----NRS 85

Query: 89  HKLIS---ESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKET 144
            K I    E+ GSH NAYT+ E T +Y +      S + +  + +DI S      +    
Sbjct: 86  QKGIELEIENIGSHLNAYTSRENTVYYAK------SLKEDIPKAVDILSDILTRSVLDPE 139

Query: 145 SVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXX 204
           ++ +E   I  E +       ++++     +     P  R   G I              
Sbjct: 140 AIERERDVIIRESEEVDKMYDEVVFDHLHEVTYKDQPLGRTILGPI-------KNIQSIT 192

Query: 205 XXXXESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
                 Y   NY    M L   G      L +YA   F  +  S
Sbjct: 193 RDDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYAQRCFGHLGKS 236

>ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR430C (CYM1)
          Length = 990

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 53  ATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYF 112
           + G    P    G+ H+ EH  L  GS+KYP  + + K+++ S  +     T    TFY 
Sbjct: 69  SVGFRTPPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTAHDHTFY- 126

Query: 113 EIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCN 163
                 T+++ +F  L D++  +   PL +     +E + +E    G+  +
Sbjct: 127 ---PFATTNQKDFANLRDLYLDATLRPLLRHADFLQEGWRLEHRDVGDASS 174

>KAFR0E03250 Chr5 (647254..650208) [2955 bp, 984 aa] {ON} Anc_5.541
           YDR430C
          Length = 984

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 65  GLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESN 124
           G+ H+ EH  L  GS++YP  + + K+++ S  +     TG   TF+       T++  +
Sbjct: 81  GVPHILEHTTL-CGSQRYPVHDPFFKMLNRSVANFMNAMTGPDYTFF----PFATTNSKD 135

Query: 125 FERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           F  L++I+  S  +PL  E    +E + +E
Sbjct: 136 FNNLIEIYLDSTLNPLLTEEDFYQEGWRLE 165

>TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {ON}
           Anc_5.541 YDR430C
          Length = 987

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 53  ATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYF 112
           + G   +P    G+ H+ EH  L  GS KYP  + + K+++ S  +     TG   TF+ 
Sbjct: 69  SIGFKTNPPDCTGVPHILEHTTL-CGSYKYPVRDPFFKMLNRSLANFMNAMTGPDYTFF- 126

Query: 113 EIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
                 T+++++F  L  ++ SS  +PL K     +E + +E
Sbjct: 127 ---PFSTTNKTDFANLRSVYLSSTLNPLLKPEDFYQEGWRLE 165

>Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS KYP  + + K++++S  +     TG   TF+       
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF----PFS 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           T++  +F  L  ++  S  +PL K+   ++E + +E
Sbjct: 130 TTNPQDFANLRGVYLDSTLNPLLKQEDFDQEGWRLE 165

>KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.541
           YDR430C
          Length = 994

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 60  PSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFT 119
           P    G+ H+ EH  L  GS KYP  + + K++++S  +     TG   TF+       T
Sbjct: 88  PPDSTGVPHILEHTTL-CGSVKYPVHDPFFKMLNKSLANFMNAMTGPHYTFF----PFAT 142

Query: 120 SSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESE 156
           ++  +F  L D++  S  +PL K     +E + +E+ 
Sbjct: 143 TNGRDFANLRDVYLDSILNPLLKWEDFVQEGWRLENR 179

>ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]
           {ON} highly similar to uniprot|P32898 YDR430C
           Saccharomyces cerevisiae CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 55  GSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEI 114
           G   +P    G+ H+ EH  L  GS KYP  + + K+++ S  +     TG   TFY   
Sbjct: 71  GFKTNPPNATGVPHILEHTTL-CGSVKYPVRDPFFKMLNRSLSNFMNAMTGPDYTFY--- 126

Query: 115 PCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
               T++ ++F  L D++  +  +PL       +E + +E
Sbjct: 127 -PFSTTNRADFANLRDVYVDATFNPLLTPEDFYQEGWRLE 165

>Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii ADR184W
          Length = 988

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 5/102 (4%)

Query: 53  ATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYF 112
           + G   +P    G+ H+ EH  L A S+KYP  + + K+++ S  +     TG   TFY 
Sbjct: 69  SIGFKTNPPDKSGVPHILEHTTLCA-SQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY- 126

Query: 113 EIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
                 T+++ +F  L D++  +   PL +     +E + +E
Sbjct: 127 ---PFATTNKKDFANLRDLYLDATLHPLLRHEDFLQEGWRLE 165

>YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}
           CYM1Lysine-specific metalloprotease of the mitochondrial
           intermembrane space, member of the pitrilysin family;
           degrades proteins and presequence peptides cleaved from
           imported proteins; required for normal mitochondrial
           morphology
          Length = 989

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS KYP  + + K++++S  +     TG   TF+       
Sbjct: 75  NPPDSTGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF----PFS 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           T++  +F  L  ++  S  +PL K+   ++E + +E
Sbjct: 130 TTNPQDFANLRGVYLDSTLNPLLKQEDFDQEGWRLE 165

>TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 53  ATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISES-NGSHNAYTTGEQTTFY 111
           + G   +P    G+ H+ EH  L  GS KYP  + + K+++ S +   NA T  + T F 
Sbjct: 69  SIGFKTNPPDSTGVPHILEHTTL-CGSVKYPVRDPFFKMLNRSLSNFMNAMTAHDYTFFP 127

Query: 112 FEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESE 156
           F      T+++++F+ L D++  +   PL K     +E + +E++
Sbjct: 128 FA-----TTNQNDFKNLRDVYIDATLRPLLKAEDFFQEGWRLENK 167

>NDAI0H01660 Chr8 complement(400912..403875) [2964 bp, 987 aa] {ON}
           Anc_5.541 YDR430C
          Length = 987

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS KYP  + + K+++ S  +     TG   TF+       
Sbjct: 75  NPPNCTGVPHVLEHTTL-CGSLKYPVRDPFFKMLNRSLANFMNAMTGHDYTFF----PFS 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIES 155
           T++  +FE L +++  +  +PL K     +E + +E+
Sbjct: 130 TTNAKDFENLRNVYLDATLNPLLKAEDFYQEGWRLEN 166

>Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 59  DPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLF 118
           +P    G+ H+ EH  L  GS KYP  + + K++++S  +     TG   TF+       
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF----PFS 129

Query: 119 TSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIE 154
           T++  +F  L  ++  S  +PL K+   ++E + +E
Sbjct: 130 TTNPQDFINLRGVYLDSTLNPLLKQEDFDQEGWRLE 165

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 81/218 (37%), Gaps = 17/218 (7%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           LPNG+       P+   A+  + V  GS  + +   G AH  EH+    G+K      + 
Sbjct: 34  LPNGLTVASERLPNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAFK-GTKNR--SQTG 90

Query: 89  HKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
            +L  E+ GSH NAYT+ E T ++ +      S E +  R ++I S      +    ++ 
Sbjct: 91  IELEIENIGSHLNAYTSRENTVYFAK------SLEEDVPRAVEILSDILTRSVLDPKAIE 144

Query: 148 KEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXXXXX 207
           +E   I  E +       ++++     +A       R   G I                 
Sbjct: 145 RERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALGRTILGPI-------KNIKTITRED 197

Query: 208 XESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGI 245
            ++Y   NY    M L   G      L +YA   F  I
Sbjct: 198 LKNYIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFGHI 235

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 78/221 (35%), Gaps = 17/221 (7%)

Query: 29  LPNGILTMVISDPSREMASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSY 88
           L NG+       P    A+  + V  GS  +     G AH  EH+    G+K      S 
Sbjct: 25  LNNGLTVATERIPEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAFK-GTKDR--TQSG 81

Query: 89  HKLISESNGSH-NAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
            +L  E+ GSH NAYT+ E T +Y +      S   +  R +DI S      +    ++ 
Sbjct: 82  IELEIENIGSHLNAYTSRENTVYYAK------SLRDDIPRAVDILSDILTRSVLDPRAIE 135

Query: 148 KEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFSRFSTGNIXXXXXXXXXXXXXXXXX 207
           +E   I  E +       ++++     +A       R   G +                 
Sbjct: 136 RERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLGRTILGPV-------KNIKSITRKD 188

Query: 208 XESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFNGIDDS 248
            + Y   NY    M L   G    + L K A  +F  I  S
Sbjct: 189 LKDYITKNYKGDRMVLAGAGAVDHDDLVKQAERFFGHIPKS 229

>NDAI0F01450 Chr6 (358291..360354) [2064 bp, 687 aa] {ON} Anc_6.242
           YPL222W
          Length = 687

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 27/122 (22%)

Query: 88  YHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVN 147
           +H     S+GSH ++TT  + + Y  I     + E++F+  LDI +    DPL  +    
Sbjct: 53  FHTPRYVSSGSHFSFTTPMKRSHYKPILVSKETLENDFQ--LDIEN----DPLIPKILSG 106

Query: 148 KEIYAIESEH---------------------DGNTCNLTKILYHATRLLANSKHPFSRFS 186
           ++IY  E +                      DG   NL   + H  +L  + K PFSRF+
Sbjct: 107 EKIYYDEDKSIFPYSLAYAGYQFGSFAGQLGDGRVVNLFDYMNHTFQLKGSGKTPFSRFA 166

Query: 187 TG 188
            G
Sbjct: 167 DG 168

>SAKL0B02156g Chr2 complement(205340..207145) [1806 bp, 601 aa] {ON}
           similar to uniprot|P43579 Saccharomyces cerevisiae
           YFL013C IES1 Subunit of the INO80 chromatin remodeling
           complex
          Length = 601

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 118 FTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLAN 177
           FT  +  F+ L D+FS   +  LF  T+  K  ++I        CN+T   Y+A + +AN
Sbjct: 103 FTRKDIQFQFLCDLFSDEKQ--LF--TNTFKHTFSITPTATDEVCNVTSAHYNARKFIAN 158

Query: 178 SKHPFSRF 185
            K  FS+ 
Sbjct: 159 DKLTFSQL 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 122,875,214
Number of extensions: 5519330
Number of successful extensions: 16815
Number of sequences better than 10.0: 99
Number of HSP's gapped: 16951
Number of HSP's successfully gapped: 125
Length of query: 1201
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1080
Effective length of database: 39,606,813
Effective search space: 42775358040
Effective search space used: 42775358040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)