Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D033003.496ON1961969531e-132
Kpol_1017.43.496ON1841524762e-60
Suva_16.4793.496ON2121454513e-56
YPR151C (SUE1)3.496ON2061444471e-55
Smik_16.4033.496ON2031404401e-54
Skud_16.4453.496ON2151444299e-53
SAKL0F02618g3.496ON2531413971e-47
KNAG0A079603.496ON1771463651e-43
KLLA0E03983g3.496ON1911523652e-43
NDAI0B058903.496ON2781463531e-40
ZYRO0D09812g3.496ON1851893424e-40
KLTH0F14938g3.496ON2291403179e-36
Kwal_55.212483.496ON2221483063e-34
CAGL0L08426g3.496ON1401422585e-28
TDEL0D056403.496ON1241412322e-24
NCAS0F035703.496ON2301402262e-22
TBLA0D029403.496ON71441873e-18
Ecym_12333.496ON87431604e-14
KAFR0G037103.496ON79581552e-13
AFR315C3.496ON77411352e-10
Suva_16.1518.682ON2531331283e-08
YPL159C (PET20)8.682ON2531481273e-08
Skud_16.1238.682ON2551331274e-08
Smik_6.3568.682ON2531441249e-08
Kpol_1013.98.682ON2611331241e-07
NCAS0C013108.682ON2571441212e-07
ZYRO0F07480g8.682ON2361401203e-07
KNAG0J017608.682ON2581341179e-07
TPHA0G015708.682ON2551371179e-07
TDEL0A062708.682ON2421371151e-06
SAKL0H06380g8.682ON2191341098e-06
TPHA0D012908.682ON2181361052e-05
TDEL0E007103.62ON4761391002e-04
Kpol_1072.128.682ON222134973e-04
KLLA0A07447g3.62ON486142958e-04
TBLA0B038008.682ON324134930.001
KLLA0D06061g8.682ON24941920.001
NDAI0K013208.682ON25829910.002
KLTH0D11396g8.682ON22540900.003
CAGL0M02101g8.682ON267137900.003
Kpol_1066.443.62ON479139900.004
SAKL0C12342g3.62ON552154860.011
Kwal_26.88288.682ON22329840.015
KAFR0H023808.682ON22037840.016
NCAS0A099403.62ON494157850.017
ZYRO0C02244g3.62ON460141830.025
TPHA0P012603.62ON494140810.050
TBLA0B085103.62ON501174800.067
Suva_14.443.62ON525149780.14
KLTH0A01364g3.62ON476144740.40
YNL295W3.62ON524149730.60
Ecym_23908.682ON22727691.3
CAGL0I09460g1.333ON48189701.3
YLR207W (HRD3)7.339ON83399673.3
KNAG0A051308.331ON234478673.3
Kwal_23.52773.62ON47037673.4
TBLA0B027208.798ON50233648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03300
         (196 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   371   e-132
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   187   2e-60
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   178   3e-56
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   176   1e-55
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   174   1e-54
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   169   9e-53
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   157   1e-47
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   145   1e-43
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   145   2e-43
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   140   1e-40
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   136   4e-40
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   126   9e-36
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   122   3e-34
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...   103   5e-28
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    94   2e-24
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    92   2e-22
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    77   3e-18
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    66   4e-14
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    64   2e-13
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    57   2e-10
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    54   3e-08
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    54   3e-08
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    54   4e-08
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    52   9e-08
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    52   1e-07
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    51   2e-07
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    51   3e-07
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    50   9e-07
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    50   9e-07
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    49   1e-06
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    47   8e-06
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    45   2e-05
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    43   2e-04
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    42   3e-04
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    41   8e-04
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    40   0.001
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    40   0.001
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    40   0.002
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    39   0.003
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    39   0.003
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    39   0.004
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    38   0.011
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    37   0.015
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    37   0.016
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    37   0.017
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    37   0.025
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    36   0.050
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    35   0.067
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    35   0.14 
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    33   0.40 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    33   0.60 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    31   1.3  
CAGL0I09460g Chr9 complement(906191..907636) [1446 bp, 481 aa] {...    32   1.3  
YLR207W Chr12 (556788..559289) [2502 bp, 833 aa] {ON}  HRD3Resid...    30   3.3  
KNAG0A05130 Chr1 complement(748935..755969) [7035 bp, 2344 aa] {...    30   3.3  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    30   3.4  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    29   8.2  

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  371 bits (953), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 183/196 (93%)

Query: 1   MKQRLYMMNSKMFFSSTNKSLWKRKXXXXXXXXXXXXXVTGHNSATFNSIFKNLPRVPTT 60
           MKQRLYMMNSKMFFSSTNKSLWKRK             VTGHNSATFNSIFKNLPRVPTT
Sbjct: 1   MKQRLYMMNSKMFFSSTNKSLWKRKSMSSSRAVDSSHSVTGHNSATFNSIFKNLPRVPTT 60

Query: 61  RYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLPQKNHE 120
           RYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLPQKNHE
Sbjct: 61  RYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLPQKNHE 120

Query: 121 AFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWNNVPRRFL 180
           AFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWNNVPRRFL
Sbjct: 121 AFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWNNVPRRFL 180

Query: 181 KTLKPFEVNEPLRKKK 196
           KTLKPFEVNEPLRKKK
Sbjct: 181 KTLKPFEVNEPLRKKK 196

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  187 bits (476), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 7/152 (4%)

Query: 44  SATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDF--- 100
           S+    IF++LPRVPTT++LEST LTNDILFSGYRPITYPVKENPLFRN     N F   
Sbjct: 29  SSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQD 88

Query: 101 LSTQETQEKNNPVLPQKN----HEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPY 156
           L   E+   +  +L + +     + F+ L+G++GTGGI SGGVNGTW++NP VP  LLPY
Sbjct: 89  LVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPY 148

Query: 157 NWWSTSIMGMEYYPEWNNVPRRFLKTLKPFEV 188
           +WWSTSIMGMEYYPEW N+PR+ +K LKP+++
Sbjct: 149 SWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  178 bits (451), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 106/145 (73%), Gaps = 1/145 (0%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  K +   L   + +   
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
                +K+ E  +V  GE+GTGGIMSGGVNGTWKYNPTVP  LLPYNWWSTS MGMEY+P
Sbjct: 122 EAKATEKS-EHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 171 EWNNVPRRFLKTLKPFEVNEPLRKK 195
           EW NVP   ++ LKPF+    L+ K
Sbjct: 181 EWKNVPSYMMRKLKPFDRALQLQAK 205

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  176 bits (447), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 83/144 (57%), Positives = 107/144 (74%), Gaps = 3/144 (2%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYN-NDFLSTQETQEK 109
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  + +    L+  E    
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 110 NNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYY 169
               + +K H+  ++L GE+GTGGIMSGGVNGTWKYNPTVP  LLP+NWWSTS MGMEY+
Sbjct: 115 EAKTIDEKKHK--NILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 172

Query: 170 PEWNNVPRRFLKTLKPFEVNEPLR 193
           PEW NVP   ++ LKPF+    +R
Sbjct: 173 PEWKNVPPYMMRKLKPFDKALQMR 196

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  174 bits (440), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (72%), Gaps = 7/140 (5%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  K +   L T +     
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTAD----E 108

Query: 111 NPVLPQKNHEAFS---VLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167
            P+   K  E      +L GE+GTGGIMSGGVNGTWKYNPTVP  LLP+NWWSTS MGME
Sbjct: 109 APITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGME 168

Query: 168 YYPEWNNVPRRFLKTLKPFE 187
           Y+PEW N+P    + LKPF+
Sbjct: 169 YFPEWRNIPSYMTRKLKPFD 188

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  169 bits (429), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 105/144 (72%), Gaps = 3/144 (2%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  + +   L   +     
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
                +K+    +VL GE+GTGGI SGGVNGTWKYNPTVP  LLP+NWWSTS MGMEY+P
Sbjct: 122 EAKATEKDMHK-NVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 171 EWNNVPRRFLKTLKPFE--VNEPL 192
           EW NVP   ++ LKPF+  + +PL
Sbjct: 181 EWKNVPSYMMRKLKPFDKSLQQPL 204

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  157 bits (397), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 96/141 (68%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107
           + IF+ LP+VPTT++LE  +LT DILFSGYRP+TYPVKENP F    +       T   +
Sbjct: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKK 79

Query: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167
           E  N    +   E  +V+ G +GTGGI+SGGVNGTW+YNP +P  LLPYN WS+S M ME
Sbjct: 80  EYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAME 139

Query: 168 YYPEWNNVPRRFLKTLKPFEV 188
           YYPEW NVP+     LKPF++
Sbjct: 140 YYPEWLNVPKTIANKLKPFDM 160

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  145 bits (365), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 95/146 (65%), Gaps = 14/146 (9%)

Query: 49  SIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKY------NNDFLS 102
           S+F+ LP+VP T+YLE+ +L  DIL+SGYRP+ YPV+ENPLFRN NK        +D   
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89

Query: 103 TQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTS 162
           T+ T   +  V    N E F    G    GGI + G NGTWKY P +P+ +LP+NWWS S
Sbjct: 90  TEGTHRDSQTV----NTELF----GNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSAS 141

Query: 163 IMGMEYYPEWNNVPRRFLKTLKPFEV 188
            + ME YPEW++VP+  +K LKPF++
Sbjct: 142 SLAMEVYPEWSSVPKHVVKGLKPFDL 167

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  145 bits (365), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 99/152 (65%), Gaps = 13/152 (8%)

Query: 50  IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEK 109
           +++ LPRVPTTR+L   +LT DILFSGYRPI  P+++NPLF+   K         E + +
Sbjct: 11  MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVK-------ELEVERE 63

Query: 110 NNPVLPQKNHEAFS------VLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSI 163
            N     K+  AF+       + G  GTGGI+SGGVNGTW+YNP +P  LL    WS+S 
Sbjct: 64  KNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSA 123

Query: 164 MGMEYYPEWNNVPRRFLKTLKPFEVNEPLRKK 195
           MGME+YPEWN+VP +   +LKP+++++P  KK
Sbjct: 124 MGMEFYPEWNDVPNKVSASLKPYQLDQPQDKK 155

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  140 bits (353), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 95/146 (65%), Gaps = 13/146 (8%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFR-----NINKYNNDFLS 102
           N+IF+ +P+VP T+YLE+ +L+ D+L+SGYRPI YPVKENPLFR     N +       +
Sbjct: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTT 185

Query: 103 TQETQEKNNPVLPQ-KNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWST 161
           +  + EK  P   Q K H        +   GGIM+GG+NGTW+Y+P +P NLLP   WS 
Sbjct: 186 SSSSSEKKKPQQEQMKKHY-------DDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSM 238

Query: 162 SIMGMEYYPEWNNVPRRFLKTLKPFE 187
           SIMGMEYYPEW  VP   +K LKPF+
Sbjct: 239 SIMGMEYYPEWKGVPFNIVKNLKPFD 264

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  136 bits (342), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 116/189 (61%), Gaps = 31/189 (16%)

Query: 7   MMNSKMFFSSTNKSLWKRKXXXXXXXXXXXXXVTGHNSATFNSIFKNLPRVPTTRYLEST 66
           MM+ ++F ++T +S +KRK                      + IF+++PRVPTT++LES 
Sbjct: 1   MMSKRLFSTATIRS-FKRK-------------------CCSSDIFRSMPRVPTTQFLESR 40

Query: 67  KLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLPQKNHEA----- 121
           +LT DILFSGYRP+ YPVKENPLF+   + N +   T E Q ++N  L Q   +      
Sbjct: 41  ELTRDILFSGYRPVMYPVKENPLFKERTR-NGEL--TDELQSRHNSGLRQGRTQEEEKES 97

Query: 122 ---FSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWNNVPRR 178
              +SV+ G +G GGI SGG +GTW+    +P  LLPY+WWST+ MGME++PEW  VPR 
Sbjct: 98  GEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRH 157

Query: 179 FLKTLKPFE 187
            ++ LKPF+
Sbjct: 158 VVRKLKPFD 166

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  126 bits (317), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 96/140 (68%), Gaps = 4/140 (2%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107
           + IF++LP+VPTT+YLE  +LT DIL+SGYRP+ YPVKENPLF+    +    L  +   
Sbjct: 20  SEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAG-WKTQRLRGERGA 78

Query: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167
            K++ V PQ +    + + G  GTGGI SGGVNGTW+YNP +P  LLPYN WS + M ME
Sbjct: 79  RKSSTV-PQSSE--MNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWSCTSMAME 135

Query: 168 YYPEWNNVPRRFLKTLKPFE 187
           Y+PEW  VPR  +  L+PFE
Sbjct: 136 YHPEWLAVPRTVVNKLRPFE 155

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  122 bits (306), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 99/148 (66%), Gaps = 10/148 (6%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107
           + IF++LP+VPTT+YLE  +LT DIL+SGYRP+ YPVKENPLF+           TQ  +
Sbjct: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETG------WKTQRLR 73

Query: 108 EK--NNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMG 165
           E+  ++  L      + + + G +GTGGI SGGVNGTW+YNP +P  LLP++ WS++ M 
Sbjct: 74  EEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMA 133

Query: 166 MEYYPEWNNVPRRFLKTLKPFEVNEPLR 193
           MEY+PEW  VPR  +  L+PF  N P R
Sbjct: 134 MEYHPEWLAVPRTVVNKLRPF--NSPER 159

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score =  103 bits (258), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 82/142 (57%), Gaps = 12/142 (8%)

Query: 47  FNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQET 106
            N IF+ LP+VP TRYLE+  L+ D+L++GYRPI YP++ENPL  + N        T   
Sbjct: 4   VNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSN-----VRETHYY 58

Query: 107 QEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGM 166
            E +N +  +       +L G +G GGI + GV      +P+  +  L Y     SIMGM
Sbjct: 59  GESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMA--DPSKVKLGLSY-----SIMGM 111

Query: 167 EYYPEWNNVPRRFLKTLKPFEV 188
           EYYPEW  VPR  +K +KP+EV
Sbjct: 112 EYYPEWEKVPRDVVKRIKPYEV 133

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 94.0 bits (232), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 72/141 (51%), Gaps = 49/141 (34%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107
           + +F+ LPRVPTTR+LE+ +L++DILFSGYRP+ YPV+ENPLF                 
Sbjct: 28  DDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF----------------- 70

Query: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLP-YNWWSTSIMGM 166
                                            GT    P   E+ LP Y+ WST+ MG+
Sbjct: 71  -------------------------------GRGTKTEAPASLESNLPRYDLWSTTTMGL 99

Query: 167 EYYPEWNNVPRRFLKTLKPFE 187
           E +PEW+NVPR  ++ L+PF+
Sbjct: 100 ERFPEWSNVPREVVRKLRPFD 120

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 91.7 bits (226), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 74/140 (52%), Gaps = 37/140 (26%)

Query: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107
           N+IF+ LP+VP TRYLE+ +L+ +ILF+GY+PI YPV+ENPLF+            QE  
Sbjct: 115 NNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------LKIKQEDA 166

Query: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167
           ++ N                ++  G  +S    G                 WSTSI+G++
Sbjct: 167 KRENG-------------NEKRALGSSVSHKYKGI----------------WSTSILGLQ 197

Query: 168 YYPEWNNVPRRFLKTLKPFE 187
            YPEWNNVP   +K LKPF+
Sbjct: 198 DYPEWNNVPWNNIKNLKPFD 217

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 76.6 bits (187), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (88%)

Query: 49 SIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRN 92
          S+ ++LPRVPTT YLE+T+L NDI FSGYRP+ YPVKENPLFRN
Sbjct: 14 SVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 66.2 bits (160), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%)

Query: 50 IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRN 92
          I ++LPRVPTT+YL   +L  DI FSGYRP+ YPVK+NPLFR+
Sbjct: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRS 51

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
           Anc_3.496 YPR151C
          Length = 79

 Score = 64.3 bits (155), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 2/58 (3%)

Query: 50  IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLF--RNINKYNNDFLSTQE 105
           + KNLPRVPTT+YL+ +KL  DIL++GYRP+ YP+KENPL   +N    N  F   Q+
Sbjct: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFTDIQQ 64

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 33/41 (80%)

Query: 51 FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFR 91
          F+ LPRVP+T++L + K+  DILFS +RP+TYPV +NPL R
Sbjct: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 45/133 (33%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LPRVP+T +L+ + +T ++L+SGYRPI      NP                     N+P 
Sbjct: 103 LPRVPSTSHLKHSDMTTNVLYSGYRPIFI----NP---------------------NDPK 137

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
           L             ++ TG  +       +++   + +   P + W +S  G+E++ EW 
Sbjct: 138 L-------------KEDTGSTL-------YEFAMKLDDLNEPLSPWISSATGLEFFSEWE 177

Query: 174 NVPRRFLKTLKPF 186
           N+P   LK LKPF
Sbjct: 178 NIPSELLKNLKPF 190

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 45/148 (30%)

Query: 39  VTGHNSATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNN 98
           V G +     S F  LPRVP+T +L+ + +T ++L+SGYRP+      NP          
Sbjct: 88  VRGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFI----NP---------- 133

Query: 99  DFLSTQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNW 158
                      N+P L             ++ TG  +       +++   + +   P + 
Sbjct: 134 -----------NDPKL-------------KEDTGSTL-------YEFAMKLEDLNEPLSP 162

Query: 159 WSTSIMGMEYYPEWNNVPRRFLKTLKPF 186
           W +S  G+E++ EW N+P   LK LKPF
Sbjct: 163 WISSATGLEFFSEWENIPSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 45/133 (33%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LPRVP+T +L+ T +T ++L+SGYR         PLF N                 N+P 
Sbjct: 103 LPRVPSTSHLKHTDMTTNVLYSGYR---------PLFIN----------------PNDPK 137

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
           L             ++ TG  +       +++   + +   P + W +S  G+E++ EW 
Sbjct: 138 L-------------KEDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFSEWE 177

Query: 174 NVPRRFLKTLKPF 186
           N+P   LK LKPF
Sbjct: 178 NIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 45/144 (31%)

Query: 43  NSATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLS 102
           NS    S F  LP+VP+T +L+ + +T ++L+SGYRP+      NP              
Sbjct: 92  NSKKKRSDFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP-------------- 133

Query: 103 TQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTS 162
                  N+P L             ++ TG  +       +++   + +   P + W +S
Sbjct: 134 -------NDPKL-------------KEDTGSTL-------YEFAMKLEDLNEPLSPWISS 166

Query: 163 IMGMEYYPEWNNVPRRFLKTLKPF 186
             G+E++ EW+N+P   L+ LKPF
Sbjct: 167 ATGLEFFSEWDNIPSELLRNLKPF 190

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 53/133 (39%), Gaps = 42/133 (31%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP+VP+T  L   ++    L+SGYRPI               Y N               
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPI---------------YIN--------------- 141

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
                    S  +G+    G M  GVN T+       EN  P   W +S  GME Y EW+
Sbjct: 142 ---------SKGSGKNKLSGTMKNGVNSTFYEIAMKLENPSP---WMSSATGMELYSEWD 189

Query: 174 NVPRRFLKTLKPF 186
           +VP   LK LKPF
Sbjct: 190 HVPLDVLKDLKPF 202

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 60/144 (41%), Gaps = 32/144 (22%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           +  LP+V     L   +++ DIL+SGYRP         LF N     N      E    N
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRP---------LFLNFKDLENSSRKA-EFGNSN 136

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
           N  L +        +  +  +   +SG  +  +              W STS  GME + 
Sbjct: 137 NSTLYE------IAMKLDDLSPEAISGSTSSNF--------------WHSTSATGMEVFD 176

Query: 171 EWNNVPRRFLKTLKPFEVNEPLRK 194
           EW+NVP   LK LKPF+   P++K
Sbjct: 177 EWDNVPNSILKNLKPFQA--PVKK 198

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 55/140 (39%), Gaps = 43/140 (30%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LPRVP+T YL    +++ IL+SGYRP         LF      N D L T +        
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRP---------LF-----LNPDELKTSQD------- 126

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVP-ENLLPYNWWSTSIMGMEYYPEW 172
                             GG      NG   Y   +  E L   + W++S  G E YPEW
Sbjct: 127 ------------------GG---NANNGARLYEFAMKLEELGEQSLWTSSATGQEIYPEW 165

Query: 173 NNVPRRFLKTLKPFEVNEPL 192
           + VP    + LKPF    P 
Sbjct: 166 DYVPMEVQRKLKPFNAPAPF 185

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 57/134 (42%), Gaps = 36/134 (26%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP VP+T+++E+  +  ++L+SGYRP         LF +        L+ +E        
Sbjct: 96  LPSVPSTQHIEANDMCTELLYSGYRP---------LFLDSTALERGLLAAKE-------- 138

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVP-ENLLPYNWWSTSIMGMEYYPEW 172
                  +F+            S    G+  Y   +  E+  P   W+ S  G+E Y EW
Sbjct: 139 -----QASFT-----------QSASPTGSTFYEIAMKLED--PACIWANSATGLEKYTEW 180

Query: 173 NNVPRRFLKTLKPF 186
           +N+P     +LKPF
Sbjct: 181 DNIPYSVANSLKPF 194

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 55/137 (40%), Gaps = 42/137 (30%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           + +LP+ PTT +L S++   D+ +SGYRP++  V             N   S QE     
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDV-------------NQLASEQE----- 144

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
           NP                  T   +S  ++        V +NL     W  S  G E Y 
Sbjct: 145 NPC-----------------TCYEISLSMD-------IVKKNLKVSTPWLFSATGSELYK 180

Query: 171 EWNNVPRRFLKTLKPFE 187
           EW+N+P+  L  LK F 
Sbjct: 181 EWDNIPKSVLDNLKCFH 197

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 55/137 (40%), Gaps = 43/137 (31%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LPRVP+T  L+   ++  +L+SGYRP+                   F++  E        
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPL-------------------FINPDE-------- 128

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
                     + T  +G+G        GT        E L   + W TS  G+EYY EW+
Sbjct: 129 ----------IKTSSEGSG------TGGTLYEFAMKLEELGDQSPWVTSATGLEYYREWD 172

Query: 174 NVPRRFLKTLKPFEVNE 190
           ++P    K LKPF   E
Sbjct: 173 SIPGELQKKLKPFTAPE 189

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 55/134 (41%), Gaps = 49/134 (36%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP+ P+T +L+  +++ D+ +SGYRPI                   FL         NP 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPI-------------------FL---------NPA 114

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
            P+++         +    G            +P +P        W +S  G E+Y EW+
Sbjct: 115 SPKESESTLYEFAMKLEALG------------DP-IP--------WVSSATGTEFYGEWD 153

Query: 174 NVPRRFLKTLKPFE 187
           NVP   +K LKPF+
Sbjct: 154 NVPTEVIKKLKPFQ 167

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 57/136 (41%), Gaps = 39/136 (28%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP+VP T  +   ++T + L+SGYRP+    K+  L  ++N            Q+ N+ +
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVN---------STAQDANSSI 145

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
                                        +++   + E   P  W   S  G+E Y EW+
Sbjct: 146 -----------------------------YEFAMKLNELSEPSPWM-MSATGLESYSEWD 175

Query: 174 NVPRRFLKTLKPFEVN 189
            VP + +K LKP++++
Sbjct: 176 YVPSKVIKKLKPYDLS 191

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (43%), Gaps = 16/139 (11%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI---TYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           LPRVP+T Y+ +T++  + LF+GYRP+      ++       ++ +   F + + T E  
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLGNSSLRPETRTNALDNFFTSFANLKVTSESK 134

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
           N        E   V+   K     ++   +      P +P        W  SI GM Y  
Sbjct: 135 NSA----EEEVQDVIEELKRDSAQLNLKNSKGKNRKPIIP--------WDASISGMVYND 182

Query: 171 E-WNNVPRRFLKTLKPFEV 188
             + +VP+  +  LKPF++
Sbjct: 183 HSFKDVPKSVVSKLKPFKM 201

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 51/134 (38%), Gaps = 42/134 (31%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP+VP+ + L    +T DI +SG+RP++    E      +   + D  +  E     +  
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE------LENKDEDSSTWYEVSLTLDSP 150

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
           +P   H +                                     W++S  GME Y EW+
Sbjct: 151 VPPSGHNSI------------------------------------WTSSATGMERYREWH 174

Query: 174 NVPRRFLKTLKPFE 187
           +VP   + +L PF+
Sbjct: 175 SVPEEVINSLTPFQ 188

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 24/142 (16%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           +P+VP+T YL    L  + LF+GY+P+   +  +PL  N N    D L +   + KN  +
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVLLDGLFSSIRKLKNAQI 147

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYN------PTVPENLLPYNWWSTSIMGME 167
             + N       T E     ++        +Y       P +P        W  SI G+ 
Sbjct: 148 NSENN-------TVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDASISGLV 192

Query: 168 YYPE-WNNVPRRFLKTLKPFEV 188
           Y  E +  VPR  +  LKPF++
Sbjct: 193 YNDEPFKGVPRSVVSKLKPFKL 214

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 37/134 (27%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           LP+VPT + L+   +  ++L+SGYRP++        F+ +N                   
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSID------FKALND------------------ 202

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPEWN 173
            P   ++ +S      G+  +    +           ++L     W +S  G+E Y EW+
Sbjct: 203 -PTNIYDPYS---SPNGSSTLYEFAMQL---------QSLSEIFPWMSSAAGLEVYSEWD 249

Query: 174 NVPRRFLKTLKPFE 187
           ++P   LK LKP +
Sbjct: 250 SIPIEVLKKLKPLQ 263

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYP---VKENPLFR 91
           LPRVPTT ++   +  +D+L+SGYRPI       KEN L +
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 159 WSTSIMGMEYYPEWNNVPRRFLKTLKPF 186
           W +S  G E++ EW+NVP   +K LKPF
Sbjct: 166 WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 159 WSTSIMGMEYYPEWNNVPRRFLKTLKPFE 187
           W TS  G+E + EW+NVP   ++ LKPF+
Sbjct: 157 WDTSATGVETFTEWDNVPESVIRNLKPFQ 185

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 159 WSTSIMGMEYYPEWNNVPRRFLKTLKPFE--VNEPLRKKK 196
           W +S  G E+Y EW+N+P   +K L+PF+   ++P  K K
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPFQPPTDDPAAKDK 180

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRP 79
           LP+ P+T +L+   ++  +L+SGYRP
Sbjct: 85  LPKAPSTDHLKHRDVSTTLLYSGYRP 110

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 50/137 (36%), Gaps = 49/137 (35%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDF-LSTQETQEK 109
           +  LPRV      +   ++ ++L+SGYRP+ + V+  P      K   +F +  +E QE 
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVE--PKNSQEGKTLYEFAMKLEEFQEA 170

Query: 110 NNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYY 169
            +P                                              W +S  G E Y
Sbjct: 171 MSP----------------------------------------------WVSSATGSEMY 184

Query: 170 PEWNNVPRRFLKTLKPF 186
            EW+NVP   +K LKPF
Sbjct: 185 AEWDNVPGDVIKDLKPF 201

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 13/139 (9%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI---TYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           LPRVP+T  +   ++  D LF+GYRP+     P+ +      ++++   F   +    ++
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLFLGNCPIDDAEKGSELDRFLASFSDLKLLNNED 133

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170
           +     K  +    +  +         G N   +  P VP        W  SI G+ Y  
Sbjct: 134 SDSKEVKIEDILEDIQNDIRNATNEDIGDNSRTR-KPVVP--------WDASISGLIYND 184

Query: 171 E-WNNVPRRFLKTLKPFEV 188
             + N+P   +  LKPF++
Sbjct: 185 RPFKNIPNEVVSKLKPFKL 203

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 60/154 (38%), Gaps = 34/154 (22%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           +P VP T Y+  +++  + LF+GY+P+                   FL      EK   V
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPL-------------------FLGNSSLDEKRADV 201

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLL----------PYNWWSTSI 163
           L       F+ LT  K      +G +N     +    ++ +          P   W  SI
Sbjct: 202 LDG----LFTSLTKIKKGTSAPNGEINVQEILDDLQKDDTMETLKEKSHKKPVIPWDASI 257

Query: 164 MGMEYYP-EWNNVPRRFLKTLKPFEVNEPLRKKK 196
            GM Y    + +VPR  +  LKPF++    R+ K
Sbjct: 258 SGMVYNDLPFKDVPRNVVGKLKPFKLLRIERRNK 291

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 159 WSTSIMGMEYYPEWNNVPRRFLKTLKPFE 187
           W +S  G E+Y EW+ VP   +K L+PF+
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPFQ 169

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPIT 81
           LP+ P+T +L+   ++  +L+SGYRP  
Sbjct: 85  LPKAPSTDHLKQRDVSTTLLYSGYRPFV 112

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKEN 87
           +  LPRVP+T  ++  +L  ++LFS YRP++  +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 66/157 (42%), Gaps = 27/157 (17%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI-----TYPVKE---------NPLFRNINKYNND 99
           +P+VPTT Y+ S ++  + LF+GY+P+       PVK+         N +   I++ N  
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKKQLPEELKALNFIIPKISRIN-- 127

Query: 100 FLSTQETQEKNNP--VLPQKNH-----EAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPEN 152
            L +    E  NP  V P  N      +  ++L              N   K   T+   
Sbjct: 128 -LFSSNAVETLNPDHVSPLDNDGVKTIDIKNILKRSDAEVHPSDNIDNTVAKKTETLTRK 186

Query: 153 LLPYNWWSTSIMGMEYYPE-WNNVPRRFLKTLKPFEV 188
             P   W  SI G+ Y    + NVP R +  LKPF++
Sbjct: 187 --PVIPWDASISGVIYNDHPFKNVPGRIISELKPFKI 221

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 20/141 (14%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI---TYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           +PRVP T Y+ + ++  + LF+GYRP+     P+ +    +N +   ++F ++    +  
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLFLGNSPIND----KNGSTPLDNFFTSFANLKVV 113

Query: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYN--PTVPENLLPYNWWSTSIMGMEY 168
                        V+  E    GI SG ++ +   N  P +P        W  SI GM Y
Sbjct: 114 EESEVVGEVNVQEVI--EDLRRGIPSGQMSNSKGKNRKPIIP--------WDASISGMVY 163

Query: 169 YPE-WNNVPRRFLKTLKPFEV 188
             + + +VP   +  LKPF++
Sbjct: 164 NDDPFKHVPNNVVSKLKPFKM 184

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI---TYPVKENPLFRNINKYNNDFLSTQETQEKN 110
           +P+V +T  L S ++  + LF+GYRP+      ++ N     ++ +   F + + +    
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLFLGNSSLETNSKLDVLDNFFTSFANLKVSA--- 145

Query: 111 NPVLPQKNHEAFSVLTGE-KGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYY 169
               P+   ++++  +G+ K     +  G+    + +    EN  P   W  SI GM Y 
Sbjct: 146 ----PESETDSYN--SGQIKDVIDDLQNGLESEQEQSSLTRENRKPIIPWDASIGGMVYS 199

Query: 170 PE-WNNVPRRFLKTLKPFEV 188
            + + ++P+  +  L PF++
Sbjct: 200 DKAFKDLPKSVVSKLSPFKL 219

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 69/174 (39%), Gaps = 54/174 (31%)

Query: 48  NSIFKN--LPRVPTTRYLESTKLTNDILFSGYRP-------ITYPVKENPLFRNINKYNN 98
           NSI K+  +PRV +T  + S ++  D LF+GYRP       I    K +PL        +
Sbjct: 82  NSIQKSFLVPRVASTEDIPSHEVQVDGLFAGYRPLFLGESSIKRRRKASPL--------D 133

Query: 99  DFLSTQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMS-----------------GGVNG 141
            F  + ET  +N                  K T GI                      + 
Sbjct: 134 KFFHSVETHTRNRE--------------SGKSTLGIQDIIDNLRKDHEEENLEIEEHSDK 179

Query: 142 TWKYNPTVPENLLPYNWWSTSIMGMEYYPE-WNNVPRRFLKTLKPFEVNEPLRK 194
             K  P  P  ++P   W  S+ G+ Y  + + NVP+  +  LKP++V  P++K
Sbjct: 180 NTKVEPRKP--VIP---WDASVSGIFYKDQSFKNVPKHVMNKLKPYKVYLPVKK 228

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 68/149 (45%), Gaps = 19/149 (12%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI-----TYP--VKENPLFRNINKYNNDFLSTQET 106
           +P+V +T ++   ++  + LF+GYRP+     ++P  V++   F ++++   + +   + 
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPN-IQLVDA 170

Query: 107 QEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGM 166
            EK+  +  Q+  E     +  +    +       + K  P +P        W  SI GM
Sbjct: 171 SEKDGKLNVQEIIEDLQRTSLRESISNMEQSS--SSHKRRPVIP--------WDASISGM 220

Query: 167 EYYPE-WNNVPRRFLKTLKPFEVNEPLRK 194
            Y    + ++P+  +  LKPF++    RK
Sbjct: 221 VYNDMPFKHIPKNVVSKLKPFKLVRVERK 249

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 61/144 (42%), Gaps = 11/144 (7%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPV 113
           +P+V +T +++  ++  + LF+G +P+          R     +  F +  + +   +  
Sbjct: 86  VPKVHSTDHIKQDEIHTEGLFAGNKPLFLGELSLSFKRPSGALDGIFGTLTKIKRATDDG 145

Query: 114 LPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYPE-W 172
             Q+      +   + G   I SG  +   +  P +P        W  SI GM Y  + +
Sbjct: 146 GDQEIDVQGIINDLQTGDKDISSGEKSAAKR--PVIP--------WDASISGMVYNDQPF 195

Query: 173 NNVPRRFLKTLKPFEVNEPLRKKK 196
             VPR  +  LKPF++ +  RK K
Sbjct: 196 KQVPRGVVNKLKPFKLLKIERKNK 219

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 54  LPRVPTTRYLESTKLTNDILFSGYRPI-----TYPVKENPLFRNINKYNNDFLSTQ--ET 106
           +PRV +T Y+ + ++  + LF+GYRP+      +P       +N ++ ++   + Q  + 
Sbjct: 111 VPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFPSDARK-GKNFHELDDVLPNIQVVDA 169

Query: 107 QEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGM 166
            EK+  +  Q+  E     +  +    +    +  + K  P +P        W  SI GM
Sbjct: 170 SEKDGKLNVQEIIEDLQRTSLRESIHSMEQ--LPSSHKRKPVIP--------WDASISGM 219

Query: 167 EYYPE-WNNVPRRFLKTLKPFEVNEPLRK 194
            Y    +  VP+  +  +KPF++    RK
Sbjct: 220 VYNDMPFKYVPKNIILKMKPFKLLRIERK 248

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 55  PRVPTTRYLESTKLTNDILFSGYRPIT 81
           P  P T +L+   +  D+L+SGYRP++
Sbjct: 90  PVAPKTEHLKEGDIAVDLLYSGYRPLS 116

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 151 ENLLPYNWWSTSIMGMEYYPEWNNVPRRFLKTLKPF 186
           E+ LP   W  +  G   Y EW+NVP+  ++ L+P+
Sbjct: 140 EDPLP---WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>CAGL0I09460g Chr9 complement(906191..907636) [1446 bp, 481 aa] {ON}
           similar to uniprot|P38348 Saccharomyces cerevisiae
           YBR272c
          Length = 481

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 43  NSATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPL-FRNINKYNNDFL 101
           NS  F  + + L    T  YL+ST+  N +     + I   VK+N L F +I +Y     
Sbjct: 187 NSLVFTRLLELLKICFT--YLKSTEFRNSLFLISKKMIMDAVKDNILVFISICEYFTSIF 244

Query: 102 STQETQEKNNP--VLPQKNHEAFSVLTGE 128
           S  + Q+  NP  ++  +N E   +L G+
Sbjct: 245 SIVQDQKSQNPSKIICVRNCENTIMLFGD 273

>YLR207W Chr12 (556788..559289) [2502 bp, 833 aa] {ON}  HRD3Resident
           protein of the ER membrane that plays a central role in
           ER-associated protein degradation (ERAD), forms HRD
           complex with Hrd1p and ERAD determinants that engages in
           lumen to cytosol communication and coordination of ERAD
           events
          Length = 833

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPEN----LLPY------- 156
           EK N +    NH A   L     TGG  SG           +P++    LL Y       
Sbjct: 132 EKFNDLTHFTNHSAIFDLAVMYATGGCASGND------QTVIPQDSAKALLYYQRAAQLG 185

Query: 157 NWWSTSIMGMEYYPEWNNVPRRFLKTLKPF-EVNEPLRK 194
           N  +  ++  +YY  + NVPR F K+L  + ++ E LRK
Sbjct: 186 NLKAKQVLAYKYYSGF-NVPRNFHKSLVLYRDIAEQLRK 223

>KNAG0A05130 Chr1 complement(748935..755969) [7035 bp, 2344 aa] {ON}
           Anc_8.331 YDR150W
          Length = 2344

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 2/78 (2%)

Query: 58  PTTRYL-ESTKLTN-DILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKNNPVLP 115
           P+ RYL E  KL N DIL      I   +KE P    + +  ND   T         +L 
Sbjct: 385 PSLRYLKEKAKLLNMDILDCDMHKILQDIKEKPTLEFLTQKANDLDYTVVDHVTYKELLT 444

Query: 116 QKNHEAFSVLTGEKGTGG 133
            +NH +   L    G+ G
Sbjct: 445 VRNHPSLDFLMTNAGSFG 462

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 159 WSTSIMGMEYYPE-WNNVPRRFLKTLKPFEVNEPLRK 194
           W  SI GM Y  E + +VPR  +  LKPF++    RK
Sbjct: 175 WDASISGMVYNDEPFKHVPRAVVSKLKPFKLFRIERK 211

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 50  IFKNLPRVPTTRYLESTKLTNDILFSG--YRPI 80
           I+ +LP +P T YL +  L  DI+ SG  Y PI
Sbjct: 272 IYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPI 304

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,097,709
Number of extensions: 1061466
Number of successful extensions: 3308
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3347
Number of HSP's successfully gapped: 90
Length of query: 196
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 92
Effective length of database: 41,556,135
Effective search space: 3823164420
Effective search space used: 3823164420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)